F379721

General Info

Members Datasets Scaffolds Average Seq Length
274 141 274 258

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10138753|Ga0157370_101387531
Length 294
Sequence MPIRHLVAALLLGSAAIPAAAQDAQSLVAKNLEARGGEAALSAIKNIHFKGRSIAPGGFELTYEETRDRTGPSAAAGRVDLTIQGLDLIQAYDGHGDGWRINPFQGRKDPEKMSSDEARSMADGALIEGPLLASLHDGSRVEYLGRDDFEGTSAYKLRVTQKDGDQFTYWLDPDTYLEIKVDETRKLRGAEVTNETSLGDYEKVAGVYFPMSVESWSQGNDNQRQKTIIATGEANVAIPAGYFDEPGGSSAPAKAAGAEPPDASNKPHSKGATRTKSGXXXXPAAIPSTPAKGE

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 1.09
Rhizosphere 95.99
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002145 3300002067 Bacteria 6948
2 JGI25157J39369_1000445 3300002741 Bacteria 26502
3 rootH1_10108422 3300003316 Bacteria 3711
4 rootL2_10339873 3300003322 Bacteria 1131
5 Ga0055533_1002646 3300003756 Bacteria 3973
6 Ga0065715_10228406 3300005293 Bacteria 1243
7 Ga0070658_10002067 3300005327 Bacteria 16834
8 Ga0070658_10024064 3300005327 Bacteria 4887
9 Ga0070658_10024715 3300005327 Bacteria 4817
10 Ga0070658_10090075 3300005327 Bacteria 2527
11 Ga0070683_100091894 3300005329 Bacteria 2851
12 Ga0070683_100130776 3300005329 Bacteria 2375
13 Ga0070683_100151428 3300005329 Bacteria 2199
14 Ga0070670_100191280 3300005331 Bacteria 1777
15 Ga0070680_100003296 3300005336 Bacteria 12049
16 Ga0070680_100011740 3300005336 Bacteria 6792
17 Ga0070680_100116036 3300005336 Bacteria 2231
18 Ga0070660_100011140 3300005339 Bacteria 6378
19 Ga0070660_100019419 3300005339 Bacteria 4981
20 Ga0070660_100423228 3300005339 Bacteria 1103
21 Ga0070689_100360209 3300005340 Unclassified 1222
22 Ga0070661_100156185 3300005344 Bacteria 1726
23 Ga0070692_10043221 3300005345 Bacteria 2316
24 Ga0070692_10085327 3300005345 Unclassified 1708
25 Ga0070669_100050318 3300005353 Bacteria 3043
26 Ga0070669_100230441 3300005353 Bacteria 1468
27 Ga0070671_100345374 3300005355 Unclassified 1270
28 Ga0070671_100487538 3300005355 Bacteria 1059
29 Ga0070659_100010346 3300005366 Bacteria 6860
30 Ga0070659_100020067 3300005366 Bacteria 5075
31 Ga0070659_100156625 3300005366 Bacteria 1860
32 Ga0070667_100472085 3300005367 Bacteria 1148
33 Ga0070709_10050045 3300005434 Unclassified 2616
34 Ga0070714_100016817 3300005435 Bacteria 5915
35 Ga0070714_100017090 3300005435 Bacteria 5873
36 Ga0070713_100004013 3300005436 Bacteria 9799
37 Ga0070713_100020351 3300005436 Bacteria 5086
38 Ga0070701_10022872 3300005438 Bacteria 3002
39 Ga0070663_100006510 3300005455 Bacteria 7033
40 Ga0070663_100551110 3300005455 Unclassified 964
41 Ga0070678_100509758 3300005456 Bacteria 1063
42 Ga0070662_100030504 3300005457 Bacteria 3774
43 Ga0070681_10056531 3300005458 Bacteria 3905
44 Ga0070679_100055393 3300005530 Bacteria 3949
45 Ga0070679_100082312 3300005530 Bacteria 3208
46 Ga0070679_100135636 3300005530 Bacteria 2443
47 Ga0070672_100011908 3300005543 Bacteria 6080
48 Ga0070672_100315514 3300005543 Bacteria 1328
49 Ga0070704_100061036 3300005549 Bacteria 2696
50 Ga0068855_100055350 3300005563 Bacteria 4660
51 Ga0068855_100187243 3300005563 Bacteria 2337
52 Ga0068855_100471383 3300005563 Bacteria 1368
53 Ga0070664_100212117 3300005564 Bacteria 1731
54 Ga0068854_100004122 3300005578 Bacteria 9133
55 Ga0068856_100016446 3300005614 Bacteria 7159
56 Ga0068856_100021630 3300005614 Bacteria 6251
57 Ga0068856_100047513 3300005614 Bacteria 4228
58 Ga0068856_100160046 3300005614 Unclassified 2262
59 Ga0068856_100424993 3300005614 Bacteria 1349
60 Ga0068852_100002257 3300005616 Bacteria 13226
61 Ga0068852_100002731 3300005616 Bacteria 12209
62 Ga0068852_100005304 3300005616 Bacteria 9200
63 Ga0068852_100009472 3300005616 Bacteria 7236
64 Ga0068859_100001609 3300005617 Bacteria 23072
65 Ga0068859_100349812 3300005617 Bacteria 1573
66 Ga0068866_10042248 3300005718 Bacteria 2268
67 Ga0068863_100250377 3300005841 Bacteria 1711
68 Ga0068858_100377299 3300005842 Bacteria 1360
69 Ga0068860_100506861 3300005843 Bacteria 1205
70 Ga0070717_10018791 3300006028 Bacteria 5405
71 Ga0097621_100018232 3300006237 Bacteria 5354
72 Ga0068871_100012064 3300006358 Bacteria 6358
73 Ga0097620_100001609 3300006931 Bacteria 23072
74 Ga0097620_100176525 3300006931 Bacteria 2218
75 Ga0097620_100349813 3300006931 Bacteria 1573
76 Ga0105240_10028642 3300009093 Bacteria 7270
77 Ga0105240_10040644 3300009093 Bacteria 5945
78 Ga0111539_10467633 3300009094 Unclassified 1468
79 Ga0105242_10498689 3300009176 Bacteria 1158
80 Ga0105248_10433725 3300009177 Bacteria 1480
81 Ga0105238_10213043 3300009551 Bacteria 1908
82 Ga0105238_10679311 3300009551 Bacteria 1041
83 Ga0105239_10004411 3300010375 Bacteria 16846
84 Ga0157373_10067281 3300013100 Bacteria 2534
85 Ga0157373_10070909 3300013100 Bacteria 2462
86 Ga0157373_10103221 3300013100 Bacteria 2006
87 Ga0157373_10104909 3300013100 Bacteria 1988
88 Ga0157373_10140197 3300013100 Bacteria 1700
89 Ga0157373_10211526 3300013100 Bacteria 1367
90 Ga0157371_10016916 3300013102 Bacteria 5430
91 Ga0157371_10051595 3300013102 Bacteria 2922
92 Ga0157371_10059395 3300013102 Archaea 2711
93 Ga0157371_10071240 3300013102 Bacteria 2461
94 Ga0157371_10073664 3300013102 Bacteria 2418
95 Ga0157370_10026709 3300013104 Bacteria 5697
96 Ga0157370_10042440 3300013104 Bacteria 4384
97 Ga0157370_10094249 3300013104 Bacteria 2809
98 Ga0157370_10138753 3300013104 Bacteria 2265
99 Ga0157369_10090741 3300013105 Bacteria 3262
100 Ga0157369_10105177 3300013105 Bacteria 3005
101 Ga0157369_10163826 3300013105 Bacteria 2346
102 Ga0157369_10241324 3300013105 Unclassified 1887
103 Ga0157369_10308703 3300013105 Bacteria 1645
104 Ga0157369_10556309 3300013105 Bacteria 1185
105 Ga0157378_10060045 3300013297 Bacteria 3393
106 Ga0157372_10227014 3300013307 Bacteria 2165
107 Ga0157372_10295494 3300013307 Bacteria 1884
108 Ga0157372_10426660 3300013307 Unclassified 1545
109 Ga0157375_10016270 3300013308 Bacteria 6674
110 Ga0157375_10041773 3300013308 Bacteria 4431
111 Ga0157375_10050091 3300013308 Bacteria 4096
112 Ga0163163_10000419 3300014325 Bacteria 39366
113 Ga0157380_10314537 3300014326 Bacteria 1449
114 Ga0182008_10009746 3300014497 Bacteria 5170
115 Ga0182008_10200771 3300014497 Bacteria 1015
116 Ga0157377_10226230 3300014745 Bacteria 1200
117 Ga0182007_10009620 3300015262 Bacteria 3882
118 Ga0206354_10880819 3300020081 Bacteria 1300
119 Ga0209674_100063 3300025226 Bacteria 275507
120 Ga0209674_101628 3300025226 Bacteria 5624
121 Ga0209258_100649 3300025242 Bacteria 25589
122 Ga0209026_1000037 3300025250 Bacteria 282562
123 Ga0207647_10066589 3300025904 Bacteria 2184
124 Ga0207647_10087497 3300025904 Bacteria 1861
125 Ga0207647_10187823 3300025904 Bacteria 1198
126 Ga0207699_10036059 3300025906 Unclassified 2817
127 Ga0207705_10003141 3300025909 Bacteria 12576
128 Ga0207705_10041836 3300025909 Bacteria 3287
129 Ga0207705_10146487 3300025909 Bacteria 1767
130 Ga0207705_10150416 3300025909 Bacteria 1744
131 Ga0207705_10158111 3300025909 Bacteria 1701
132 Ga0207654_10001095 3300025911 Bacteria 14674
133 Ga0207707_10040281 3300025912 Bacteria 4080
134 Ga0207695_10029303 3300025913 Bacteria 6087
135 Ga0207693_10174906 3300025915 Bacteria 1689
136 Ga0207660_10001739 3300025917 Bacteria 14597
137 Ga0207660_10002691 3300025917 Bacteria 11659
138 Ga0207657_10000993 3300025919 Bacteria 30099
139 Ga0207657_10026986 3300025919 Bacteria 5266
140 Ga0207657_10214292 3300025919 Bacteria 1544
141 Ga0207649_10155835 3300025920 Bacteria 1578
142 Ga0207652_10014890 3300025921 Bacteria 6306
143 Ga0207652_10048990 3300025921 Bacteria 3614
144 Ga0207652_10186599 3300025921 Bacteria 1865
145 Ga0207652_10490013 3300025921 Bacteria 1107
146 Ga0207681_10016549 3300025923 Bacteria 4615
147 Ga0207681_10164453 3300025923 Bacteria 1676
148 Ga0207694_10105010 3300025924 Bacteria 2242
149 Ga0207694_10503909 3300025924 Bacteria 1014
150 Ga0207650_10014457 3300025925 Bacteria 5487
151 Ga0207659_10229751 3300025926 Archaea 1496
152 Ga0207659_10236940 3300025926 Bacteria 1474
153 Ga0207700_10002136 3300025928 Bacteria 11315
154 Ga0207664_10010769 3300025929 Bacteria 6468
155 Ga0207664_10080302 3300025929 Bacteria 2650
156 Ga0207644_10057138 3300025931 Bacteria 2817
157 Ga0207644_10441875 3300025931 Bacteria 1068
158 Ga0207644_10533923 3300025931 Bacteria 970
159 Ga0207690_10017358 3300025932 Bacteria 4391
160 Ga0207690_10044149 3300025932 Bacteria 2937
161 Ga0207690_10086156 3300025932 Bacteria 2207
162 Ga0207690_10521996 3300025932 Unclassified 963
163 Ga0207706_10021151 3300025933 Bacteria 5846
164 Ga0207686_10200541 3300025934 Bacteria 1429
165 Ga0207670_10368411 3300025936 Unclassified 1141
166 Ga0207691_10004995 3300025940 Bacteria 12799
167 Ga0207711_10131136 3300025941 Bacteria 2248
168 Ga0207689_10092941 3300025942 Bacteria 2478
169 Ga0207661_10105635 3300025944 Bacteria 2373
170 Ga0207661_10114602 3300025944 Bacteria 2285
171 Ga0207661_10166378 3300025944 Bacteria 1917
172 Ga0207661_10343884 3300025944 Bacteria 1345
173 Ga0207667_10012878 3300025949 Bacteria 9608
174 Ga0207667_10927591 3300025949 Bacteria 861
175 Ga0207640_10002836 3300025981 Bacteria 9300
176 Ga0207677_10087856 3300026023 Bacteria 2252
177 Ga0207639_10003267 3300026041 Bacteria 10923
178 Ga0207678_10000589 3300026067 Bacteria 33202
179 Ga0207678_10111522 3300026067 Bacteria 2334
180 Ga0207678_10565510 3300026067 Unclassified 995
181 Ga0207702_10014276 3300026078 Bacteria 6596
182 Ga0207641_10219841 3300026088 Bacteria 1761
183 Ga0207648_10132106 3300026089 Bacteria 2198
184 Ga0207676_10504991 3300026095 Bacteria 1149
185 Ga0207674_10000655 3300026116 Bacteria 45111
186 Ga0207674_10072310 3300026116 Bacteria 3464
187 Ga0207698_10000577 3300026142 Bacteria 21420
188 Ga0207698_10096881 3300026142 Bacteria 2432
189 Ga0207698_10312330 3300026142 Bacteria 1468
190 Ga0207698_10618866 3300026142 Bacteria 1069
191 Ga0373956_0010552 3300035119 Bacteria 3788
192 Ga0373937_0018001 3300036401 Bacteria 6301
193 Ga0395899_0000340 3300037312 Bacteria 58575
194 Ga0395899_0025632 3300037312 Bacteria 4450
195 Ga0395899_0032761 3300037312 Bacteria 3905
196 Ga0395899_0056827 3300037312 Bacteria 2891
197 Ga0395899_0063007 3300037312 Bacteria 2729
198 Ga0395899_0079988 3300037312 Bacteria 2379
199 Ga0395899_0118139 3300037312 Bacteria 1901
200 Ga0395899_0180675 3300037312 Bacteria 1481
201 Ga0395900_0000468 3300037418 Bacteria 57784
202 Ga0395900_0001094 3300037418 Bacteria 34490
203 Ga0395900_0002159 3300037418 Bacteria 21983
204 Ga0395900_0004766 3300037418 Bacteria 14295
205 Ga0395900_0011701 3300037418 Bacteria 8975
206 Ga0395900_0015883 3300037418 Bacteria 7669
207 Ga0395900_0035413 3300037418 Bacteria 5141
208 Ga0395900_0052582 3300037418 Bacteria 4192
209 Ga0395900_0059441 3300037418 Bacteria 3935
210 Ga0395900_0169065 3300037418 Bacteria 2226
211 Ga0395900_0226481 3300037418 Bacteria 1882
212 Ga0395898_0006296 3300037466 Bacteria 12688
213 Ga0395898_0050973 3300037466 Bacteria 4048
214 Ga0395898_0139878 3300037466 Bacteria 2317
215 Ga0395898_0176899 3300037466 Bacteria 2039
216 Ga0395898_0221758 3300037466 Bacteria 1803
217 Ga0395905_0000606 3300037471 Bacteria 48007
218 Ga0395905_0000897 3300037471 Bacteria 38814
219 Ga0395905_0005315 3300037471 Bacteria 13161
220 Ga0395905_0013079 3300037471 Bacteria 7968
221 Ga0395905_0025621 3300037471 Bacteria 5562
222 Ga0395905_0040412 3300037471 Bacteria 4375
223 Ga0395905_0045146 3300037471 Bacteria 4133
224 Ga0395905_0046617 3300037471 Bacteria 4064
225 Ga0395905_0053281 3300037471 Bacteria 3787
226 Ga0395905_0056503 3300037471 Bacteria 3671
227 Ga0395905_0091425 3300037471 Bacteria 2853
228 Ga0395905_0161528 3300037471 Bacteria 2105
229 Ga0395905_0194564 3300037471 Bacteria 1901
230 Ga0395905_0223049 3300037471 Bacteria 1764
231 Ga0395901_0000031 3300038443 Bacteria 241733
232 Ga0395901_0000086 3300038443 Bacteria 125359
233 Ga0395901_0006736 3300038443 Bacteria 11605
234 Ga0395901_0018654 3300038443 Bacteria 7085
235 Ga0395901_0031383 3300038443 Bacteria 5479
236 Ga0395901_0041025 3300038443 Bacteria 4795
237 Ga0395901_0057528 3300038443 Bacteria 4044
238 Ga0395901_0061016 3300038443 Bacteria 3924
239 Ga0395901_0072973 3300038443 Bacteria 3578
240 Ga0395901_0125713 3300038443 Bacteria 2695
241 Ga0439458_0000578 3300042157 Bacteria 9424
242 Ga0466963_0067973 3300044694 Bacteria 2392
243 Ga0466957_0246722 3300044842 Unclassified 1186
244 Ga0466959_0075937 3300045049 Bacteria 2427
245 Ga0466958_0237372 3300045836 Bacteria 1165
246 Ga0466967_0018344 3300045976 Bacteria 5589
247 Ga0495629_0000387 3300046459 Bacteria 36902
248 Ga0495641_0043661 3300046461 Bacteria 2073
249 Ga0495639_0002030 3300046475 Bacteria 8961
250 Ga0495594_0002707 3300046499 Bacteria 9191
251 Ga0495635_0001654 3300046663 Bacteria 15027
252 Ga0495658_0000016 3300046683 Bacteria 94726
253 Ga0495581_0000241 3300047315 Bacteria 25987
254 Ga0495680_0001682 3300047322 Bacteria 23524
255 Ga0495593_0015427 3300047673 Bacteria 4326
256 Ga0495602_0170270 3300048088 Bacteria 1691
257 Ga0495614_0004707 3300048089 Bacteria 6154
258 Ga0496108_0435072 3300048911 Bacteria 1146
259 Ga0496115_0000044 3300048918 Bacteria 115745
260 Ga0496115_0360818 3300048918 Bacteria 1184
261 Ga0501036_0127132 3300049572 Bacteria 2152
262 Ga0501037_0209084 3300049573 Unclassified 1377
263 Ga0501043_0004865 3300049579 Bacteria 10852
264 Ga0501068_0054974 3300049584 Bacteria 2412
265 Ga0501070_0170232 3300049586 Bacteria 1794
266 Ga0501073_0043501 3300049589 Bacteria 3167
267 Ga0501073_0328699 3300049589 Bacteria 1055
268 Ga0501074_0126483 3300049590 Bacteria 1828
269 Ga0501076_0635190 3300049592 Unclassified 881
270 Ga0501080_0023646 3300049742 Bacteria 5693
271 Ga0501044_0051305 3300049823 Bacteria 4254
272 Ga0501045_0166281 3300049824 Bacteria 1643
273 Ga0501084_0179964 3300054114 Bacteria 1785
274 Ga0501082_0198471 3300060353 Bacteria 1745

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10504991 Ga0207676_105049911 219
2 3300025942 Ga0207689_10092941 Ga0207689_100929412 226
3 3300026116 Ga0207674_10072310 Ga0207674_100723101 226
4 3300005718 Ga0068866_10042248 Ga0068866_100422482 227
5 3300005293 Ga0065715_10228406 Ga0065715_102284061 230
6 3300005438 Ga0070701_10022872 Ga0070701_100228722 231
7 3300005549 Ga0070704_100061036 Ga0070704_1000610362 231
8 3300005617 Ga0068859_100001609 Ga0068859_1000016097 231
9 3300005843 Ga0068860_100506861 Ga0068860_1005068611 231
10 3300006931 Ga0097620_100001609 Ga0097620_1000016097 231
11 3300009176 Ga0105242_10498689 Ga0105242_104986891 231
12 3300013100 Ga0157373_10067281 Ga0157373_100672812 231
13 3300013102 Ga0157371_10051595 Ga0157371_100515952 231
14 3300013308 Ga0157375_10041773 Ga0157375_100417732 231
15 3300014326 Ga0157380_10314537 Ga0157380_103145371 231
16 3300014497 Ga0182008_10200771 Ga0182008_102007711 231
17 3300025934 Ga0207686_10200541 Ga0207686_102005412 231
18 3300026023 Ga0207677_10087856 Ga0207677_100878563 231
19 3300009094 Ga0111539_10467633 Ga0111539_104676333 232
20 3300037418 Ga0395900_0226481 Ga0395900_0226481_697_1404 232
21 3300037471 Ga0395905_0223049 Ga0395905_0223049_743_1447 232
22 3300009093 Ga0105240_10040644 Ga0105240_100406442 233
23 3300013100 Ga0157373_10140197 Ga0157373_101401972 233
24 3300013102 Ga0157371_10073664 Ga0157371_100736642 233
25 3300013105 Ga0157369_10163826 Ga0157369_101638262 233
26 3300013307 Ga0157372_10295494 Ga0157372_102954942 233
27 3300013308 Ga0157375_10016270 Ga0157375_100162703 233
28 3300025913 Ga0207695_10029303 Ga0207695_100293032 233
29 3300046459 Ga0495629_0000387 Ga0495629_0000387_7525_8232 233
30 3300046461 Ga0495641_0043661 Ga0495641_0043661_99_806 233
31 3300046475 Ga0495639_0002030 Ga0495639_0002030_6199_6906 233
32 3300046499 Ga0495594_0002707 Ga0495594_0002707_324_1031 233
33 3300046663 Ga0495635_0001654 Ga0495635_0001654_12519_13226 233
34 3300046683 Ga0495658_0000016 Ga0495658_0000016_23235_23942 233
35 3300047315 Ga0495581_0000241 Ga0495581_0000241_6523_7230 233
36 3300047322 Ga0495680_0001682 Ga0495680_0001682_3508_4215 233
37 3300047673 Ga0495593_0015427 Ga0495593_0015427_154_861 233
38 3300048089 Ga0495614_0004707 Ga0495614_0004707_94_801 233
39 3300010375 Ga0105239_10004411 Ga0105239_100044112 234
40 3300005339 Ga0070660_100423228 Ga0070660_1004232282 235
41 3300005353 Ga0070669_100050318 Ga0070669_1000503182 235
42 3300005355 Ga0070671_100487538 Ga0070671_1004875382 235
43 3300005366 Ga0070659_100156625 Ga0070659_1001566252 235
44 3300005367 Ga0070667_100472085 Ga0070667_1004720851 235
45 3300005456 Ga0070678_100509758 Ga0070678_1005097581 235
46 3300005543 Ga0070672_100011908 Ga0070672_1000119083 235
47 3300005563 Ga0068855_100471383 Ga0068855_1004713831 235
48 3300025920 Ga0207649_10155835 Ga0207649_101558352 235
49 3300025921 Ga0207652_10490013 Ga0207652_104900132 235
50 3300025923 Ga0207681_10164453 Ga0207681_101644532 235
51 3300025931 Ga0207644_10533923 Ga0207644_105339231 235
52 3300025932 Ga0207690_10086156 Ga0207690_100861562 235
53 3300025940 Ga0207691_10004995 Ga0207691_100049952 235
54 3300025949 Ga0207667_10927591 Ga0207667_109275911 235
55 3300026089 Ga0207648_10132106 Ga0207648_101321062 235
56 3300026142 Ga0207698_10618866 Ga0207698_106188661 235
57 3300005336 Ga0070680_100116036 Ga0070680_1001160361 237
58 3300005339 Ga0070660_100019419 Ga0070660_1000194192 237
59 3300005455 Ga0070663_100551110 Ga0070663_1005511101 237
60 3300005564 Ga0070664_100212117 Ga0070664_1002121172 237
61 3300025909 Ga0207705_10158111 Ga0207705_101581112 237
62 3300025919 Ga0207657_10026986 Ga0207657_100269864 237
63 3300025931 Ga0207644_10057138 Ga0207644_100571382 237
64 3300025932 Ga0207690_10521996 Ga0207690_105219962 237
65 3300025944 Ga0207661_10343884 Ga0207661_103438842 237
66 3300026067 Ga0207678_10565510 Ga0207678_105655102 237
67 3300037471 Ga0395905_0013079 Ga0395905_0013079_1681_2550 237
68 3300003322 rootL2_10339873 rootL2_103398732 239
69 3300005327 Ga0070658_10090075 Ga0070658_100900752 239
70 3300005329 Ga0070683_100091894 Ga0070683_1000918941 239
71 3300005455 Ga0070663_100006510 Ga0070663_1000065102 239
72 3300005530 Ga0070679_100055393 Ga0070679_1000553933 239
73 3300025909 Ga0207705_10146487 Ga0207705_101464872 239
74 3300025921 Ga0207652_10048990 Ga0207652_100489903 239
75 3300025944 Ga0207661_10105635 Ga0207661_101056352 239
76 3300026067 Ga0207678_10000589 Ga0207678_1000058915 239
77 3300037312 Ga0395899_0079988 Ga0395899_0079988_582_1454 239
78 3300037418 Ga0395900_0004766 Ga0395900_0004766_12545_13417 239
79 3300037466 Ga0395898_0139878 Ga0395898_0139878_1237_2109 239
80 3300037471 Ga0395905_0005315 Ga0395905_0005315_209_1081 239
81 3300038443 Ga0395901_0041025 Ga0395901_0041025_2236_3108 239
82 3300025931 Ga0207644_10441875 Ga0207644_104418752 240
83 3300003316 rootH1_10108422 rootH1_101084222 242
84 3300005434 Ga0070709_10050045 Ga0070709_100500452 242
85 3300005435 Ga0070714_100016817 Ga0070714_1000168172 242
86 3300005436 Ga0070713_100020351 Ga0070713_1000203513 242
87 3300005614 Ga0068856_100016446 Ga0068856_1000164464 242
88 3300006028 Ga0070717_10018791 Ga0070717_100187911 242
89 3300025906 Ga0207699_10036059 Ga0207699_100360593 242
90 3300025915 Ga0207693_10174906 Ga0207693_101749062 242
91 3300025929 Ga0207664_10010769 Ga0207664_100107693 242
92 3300026078 Ga0207702_10014276 Ga0207702_100142766 242
93 3300048911 Ga0496108_0435072 Ga0496108_0435072_294_1043 242
94 3300048918 Ga0496115_0360818 Ga0496115_0360818_249_998 242
95 3300005614 Ga0068856_100047513 Ga0068856_1000475132 244
96 3300005616 Ga0068852_100009472 Ga0068852_1000094722 244
97 3300005841 Ga0068863_100250377 Ga0068863_1002503772 244
98 3300006237 Ga0097621_100018232 Ga0097621_1000182322 244
99 3300006358 Ga0068871_100012064 Ga0068871_1000120642 244
100 3300006931 Ga0097620_100176525 Ga0097620_1001765253 244
101 3300009177 Ga0105248_10433725 Ga0105248_104337252 244
102 3300009551 Ga0105238_10679311 Ga0105238_106793112 244
103 3300013297 Ga0157378_10060045 Ga0157378_100600452 244
104 3300013308 Ga0157375_10050091 Ga0157375_100500912 244
105 3300025924 Ga0207694_10503909 Ga0207694_105039091 244
106 3300025941 Ga0207711_10131136 Ga0207711_101311362 244
107 3300026041 Ga0207639_10003267 Ga0207639_1000326717 244
108 3300026088 Ga0207641_10219841 Ga0207641_102198411 244
109 3300026142 Ga0207698_10096881 Ga0207698_100968813 244
110 3300026142 Ga0207698_10312330 Ga0207698_103123302 244
111 3300005353 Ga0070669_100230441 Ga0070669_1002304412 245
112 3300005617 Ga0068859_100349812 Ga0068859_1003498122 245
113 3300005842 Ga0068858_100377299 Ga0068858_1003772992 245
114 3300006931 Ga0097620_100349813 Ga0097620_1003498132 245
115 3300005327 Ga0070658_10002067 Ga0070658_1000206712 246
116 3300005339 Ga0070660_100011140 Ga0070660_1000111402 246
117 3300005345 Ga0070692_10085327 Ga0070692_100853271 246
118 3300013102 Ga0157371_10016916 Ga0157371_100169162 246
119 3300025909 Ga0207705_10003141 Ga0207705_100031418 246
120 3300025911 Ga0207654_10001095 Ga0207654_100010959 246
121 3300025919 Ga0207657_10000993 Ga0207657_100009933 246
122 3300037312 Ga0395899_0000340 Ga0395899_0000340_9040_9912 246
123 3300037418 Ga0395900_0000468 Ga0395900_0000468_8965_9837 246
124 3300037466 Ga0395898_0006296 Ga0395898_0006296_2771_3643 246
125 3300038443 Ga0395901_0000031 Ga0395901_0000031_184073_184945 246
126 3300049573 Ga0501037_0209084 Ga0501037_0209084_386_1141 246
127 3300049579 Ga0501043_0004865 Ga0501043_0004865_259_1014 246
128 3300049586 Ga0501070_0170232 Ga0501070_0170232_394_1149 246
129 3300049590 Ga0501074_0126483 Ga0501074_0126483_934_1689 246
130 3300049742 Ga0501080_0023646 Ga0501080_0023646_472_1227 246
131 3300054114 Ga0501084_0179964 Ga0501084_0179964_505_1260 246
132 3300060353 Ga0501082_0198471 Ga0501082_0198471_390_1145 246
133 3300014325 Ga0163163_10000419 Ga0163163_100004193 247
134 3300035119 Ga0373956_0010552 Ga0373956_0010552_824_1657 247
135 3300036401 Ga0373937_0018001 Ga0373937_0018001_3292_4125 247
136 3300037418 Ga0395900_0015883 Ga0395900_0015883_4368_5243 247
137 3300037418 Ga0395900_0035413 Ga0395900_0035413_3737_4606 247
138 3300037471 Ga0395905_0040412 Ga0395905_0040412_1997_2866 247
139 3300038443 Ga0395901_0031383 Ga0395901_0031383_1043_1912 247
140 3300038443 Ga0395901_0061016 Ga0395901_0061016_1947_2822 247
141 3300038443 Ga0395901_0125713 Ga0395901_0125713_1218_2087 247
142 3300048088 Ga0495602_0170270 Ga0495602_0170270_712_1545 247
143 3300005336 Ga0070680_100003296 Ga0070680_1000032962 249
144 3300005344 Ga0070661_100156185 Ga0070661_1001561852 249
145 3300005530 Ga0070679_100135636 Ga0070679_1001356361 249
146 3300005563 Ga0068855_100187243 Ga0068855_1001872432 249
147 3300005578 Ga0068854_100004122 Ga0068854_1000041223 249
148 3300005614 Ga0068856_100021630 Ga0068856_1000216304 249
149 3300005616 Ga0068852_100005304 Ga0068852_1000053046 249
150 3300009093 Ga0105240_10028642 Ga0105240_100286425 249
151 3300009551 Ga0105238_10213043 Ga0105238_102130432 249
152 3300013100 Ga0157373_10104909 Ga0157373_101049091 249
153 3300013104 Ga0157370_10026709 Ga0157370_100267093 249
154 3300013105 Ga0157369_10308703 Ga0157369_103087032 249
155 3300013105 Ga0157369_10556309 Ga0157369_105563092 249
156 3300013307 Ga0157372_10426660 Ga0157372_104266601 249
157 3300020081 Ga0206354_10880819 Ga0206354_108808191 249
158 3300025924 Ga0207694_10105010 Ga0207694_101050102 249
159 3300025949 Ga0207667_10012878 Ga0207667_100128784 249
160 3300025981 Ga0207640_10002836 Ga0207640_100028368 249
161 3300037312 Ga0395899_0063007 Ga0395899_0063007_335_1195 250
162 3300037418 Ga0395900_0001094 Ga0395900_0001094_19171_20031 250
163 3300037466 Ga0395898_0176899 Ga0395898_0176899_561_1421 250
164 3300037471 Ga0395905_0000897 Ga0395905_0000897_17300_18160 250
165 3300038443 Ga0395901_0018654 Ga0395901_0018654_4894_5754 250
166 3300013104 Ga0157370_10042440 Ga0157370_100424402 251
167 3300048918 Ga0496115_0000044 Ga0496115_0000044_88918_89673 251
168 3300049572 Ga0501036_0127132 Ga0501036_0127132_385_1155 251
169 3300049584 Ga0501068_0054974 Ga0501068_0054974_1241_2011 251
170 3300049589 Ga0501073_0043501 Ga0501073_0043501_2152_2922 251
171 3300049589 Ga0501073_0328699 Ga0501073_0328699_246_1016 251
172 3300049592 Ga0501076_0635190 Ga0501076_0635190_53_823 251
173 3300049823 Ga0501044_0051305 Ga0501044_0051305_2407_3177 251
174 3300049824 Ga0501045_0166281 Ga0501045_0166281_208_978 251
175 3300005331 Ga0070670_100191280 Ga0070670_1001912802 252
176 3300005336 Ga0070680_100011740 Ga0070680_1000117402 252
177 3300005340 Ga0070689_100360209 Ga0070689_1003602092 252
178 3300005355 Ga0070671_100345374 Ga0070671_1003453741 252
179 3300005366 Ga0070659_100010346 Ga0070659_1000103465 252
180 3300005366 Ga0070659_100020067 Ga0070659_1000200674 252
181 3300005458 Ga0070681_10056531 Ga0070681_100565312 252
182 3300005543 Ga0070672_100315514 Ga0070672_1003155142 252
183 3300005563 Ga0068855_100055350 Ga0068855_1000553503 252
184 3300013100 Ga0157373_10103221 Ga0157373_101032212 252
185 3300013100 Ga0157373_10211526 Ga0157373_102115262 252
186 3300025912 Ga0207707_10040281 Ga0207707_100402812 252
187 3300025923 Ga0207681_10016549 Ga0207681_100165492 252
188 3300025925 Ga0207650_10014457 Ga0207650_100144572 252
189 3300025926 Ga0207659_10229751 Ga0207659_102297512 252
190 3300025932 Ga0207690_10017358 Ga0207690_100173582 252
191 3300025933 Ga0207706_10021151 Ga0207706_100211512 252
192 3300025936 Ga0207670_10368411 Ga0207670_103684111 252
193 3300037418 Ga0395900_0169065 Ga0395900_0169065_836_1711 252
194 3300037466 Ga0395898_0221758 Ga0395898_0221758_881_1756 252
195 3300037471 Ga0395905_0161528 Ga0395905_0161528_48_923 252
196 3300005327 Ga0070658_10024064 Ga0070658_100240644 253
197 3300005327 Ga0070658_10024715 Ga0070658_100247152 253
198 3300005329 Ga0070683_100130776 Ga0070683_1001307763 253
199 3300005329 Ga0070683_100151428 Ga0070683_1001514282 253
200 3300005345 Ga0070692_10043221 Ga0070692_100432212 253
201 3300005457 Ga0070662_100030504 Ga0070662_1000305045 253
202 3300005530 Ga0070679_100082312 Ga0070679_1000823123 253
203 3300005614 Ga0068856_100160046 Ga0068856_1001600462 253
204 3300005614 Ga0068856_100424993 Ga0068856_1004249932 253
205 3300005616 Ga0068852_100002257 Ga0068852_1000022576 253
206 3300005616 Ga0068852_100002731 Ga0068852_10000273112 253
207 3300013100 Ga0157373_10070909 Ga0157373_100709092 253
208 3300013102 Ga0157371_10059395 Ga0157371_100593952 253
209 3300013102 Ga0157371_10071240 Ga0157371_100712402 253
210 3300013104 Ga0157370_10094249 Ga0157370_100942493 253
211 3300013104 Ga0157370_10138753 Ga0157370_101387531 253
212 3300013105 Ga0157369_10090741 Ga0157369_100907413 253
213 3300013105 Ga0157369_10105177 Ga0157369_101051772 253
214 3300013105 Ga0157369_10241324 Ga0157369_102413242 253
215 3300013307 Ga0157372_10227014 Ga0157372_102270143 253
216 3300014745 Ga0157377_10226230 Ga0157377_102262301 253
217 3300025904 Ga0207647_10087497 Ga0207647_100874972 253
218 3300025904 Ga0207647_10187823 Ga0207647_101878232 253
219 3300025909 Ga0207705_10041836 Ga0207705_100418363 253
220 3300025909 Ga0207705_10150416 Ga0207705_101504162 253
221 3300025917 Ga0207660_10001739 Ga0207660_100017393 253
222 3300025917 Ga0207660_10002691 Ga0207660_100026918 253
223 3300025919 Ga0207657_10214292 Ga0207657_102142922 253
224 3300025921 Ga0207652_10014890 Ga0207652_100148904 253
225 3300025921 Ga0207652_10186599 Ga0207652_101865992 253
226 3300025926 Ga0207659_10236940 Ga0207659_102369402 253
227 3300025932 Ga0207690_10044149 Ga0207690_100441493 253
228 3300025944 Ga0207661_10114602 Ga0207661_101146022 253
229 3300025944 Ga0207661_10166378 Ga0207661_101663782 253
230 3300026067 Ga0207678_10111522 Ga0207678_101115221 253
231 3300026116 Ga0207674_10000655 Ga0207674_1000065511 253
232 3300026142 Ga0207698_10000577 Ga0207698_1000057715 253
233 3300037312 Ga0395899_0025632 Ga0395899_0025632_2802_3674 253
234 3300037312 Ga0395899_0032761 Ga0395899_0032761_1818_2681 253
235 3300037312 Ga0395899_0056827 Ga0395899_0056827_305_1162 253
236 3300037312 Ga0395899_0118139 Ga0395899_0118139_686_1561 253
237 3300037312 Ga0395899_0180675 Ga0395899_0180675_497_1366 253
238 3300037418 Ga0395900_0002159 Ga0395900_0002159_5468_6343 253
239 3300037418 Ga0395900_0011701 Ga0395900_0011701_579_1436 253
240 3300037418 Ga0395900_0052582 Ga0395900_0052582_3154_4017 253
241 3300037418 Ga0395900_0059441 Ga0395900_0059441_1282_2157 253
242 3300037466 Ga0395898_0050973 Ga0395898_0050973_1490_2347 253
243 3300037471 Ga0395905_0000606 Ga0395905_0000606_33003_33860 253
244 3300037471 Ga0395905_0025621 Ga0395905_0025621_4177_5037 253
245 3300037471 Ga0395905_0045146 Ga0395905_0045146_1530_2387 253
246 3300037471 Ga0395905_0046617 Ga0395905_0046617_1883_2746 253
247 3300037471 Ga0395905_0053281 Ga0395905_0053281_673_1521 253
248 3300037471 Ga0395905_0056503 Ga0395905_0056503_2291_3148 253
249 3300037471 Ga0395905_0091425 Ga0395905_0091425_132_1004 253
250 3300037471 Ga0395905_0194564 Ga0395905_0194564_341_1216 253
251 3300038443 Ga0395901_0000086 Ga0395901_0000086_91772_92647 253
252 3300038443 Ga0395901_0006736 Ga0395901_0006736_3144_4001 253
253 3300038443 Ga0395901_0057528 Ga0395901_0057528_2711_3568 253
254 3300038443 Ga0395901_0072973 Ga0395901_0072973_341_1216 253
255 3300042157 Ga0439458_0000578 Ga0439458_0000578_3616_4473 253
256 3300044694 Ga0466963_0067973 Ga0466963_0067973_1044_1928 253
257 3300044842 Ga0466957_0246722 Ga0466957_0246722_219_1097 253
258 3300045049 Ga0466959_0075937 Ga0466959_0075937_582_1463 253
259 3300045836 Ga0466958_0237372 Ga0466958_0237372_33_914 253
260 3300045976 Ga0466967_0018344 Ga0466967_0018344_1863_2735 253
261 3300002741 JGI25157J39369_1000445 JGI25157J39369_10004458 255
262 3300005435 Ga0070714_100017090 Ga0070714_1000170902 255
263 3300005436 Ga0070713_100004013 Ga0070713_1000040132 255
264 3300014497 Ga0182008_10009746 Ga0182008_100097462 255
265 3300015262 Ga0182007_10009620 Ga0182007_100096202 255
266 3300025226 Ga0209674_101628 Ga0209674_1016283 255
267 3300025250 Ga0209026_1000037 Ga0209026_1000037235 255
268 3300025928 Ga0207700_10002136 Ga0207700_100021364 255
269 3300025929 Ga0207664_10080302 Ga0207664_100803022 255
270 3300002067 JGI24735J21928_10002145 JGI24735J21928_100021453 256
271 3300003756 Ga0055533_1002646 Ga0055533_10026462 256
272 3300025226 Ga0209674_100063 Ga0209674_100063208 256
273 3300025242 Ga0209258_100649 Ga0209258_1006492 256
274 3300025904 Ga0207647_10066589 Ga0207647_100665892 256

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lra-assembly1.cif.gz_A nmr structure of signal sequence deleted (ssd) rv0603 protein from mycobacterium tuberculosis without n-terminal his-tag 0.7433 132 179
2v6v-assembly1.cif.gz_A the structure of the bem1p px domain 0.7134 134 168
2v6v-assembly2.cif.gz_B the structure of the bem1p px domain 0.7085 134 168
2czo-assembly1.cif.gz_A solution structure of the px domain of bem1p 0.7049 134 168
6zz4-assembly1.cif.gz_B crystal structure of the ptpn2 c216g mutant 0.671 129 164
ID Description Score Start End Superfamily
2gu3A02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8215 136 177 3.10.450.40
af_A0A1D8PDU5_148_320_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7543 134 164 3.30.1520.10
af_Q9NG60_1_185_3.10.400.20 Alpha Beta;Roll;Sulfate adenylyltransferase; 0.7541 146 178 3.10.400.20
af_Q6AVW0_13_153_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7472 131 175 3.40.420.10
2lraA00 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein; 0.7433 132 179 3.30.505.20
ID Description Score Start End GO Terms
AF-A0A2V6B2T1-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9566 81 242
AF-A0A524JSD8-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.955 22 241
AF-A0A7C1IAK3-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9495 25 242 GO:0016020
AF-A0A7V8RBW6-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9421 21 250
AF-A0A0K8QM02-F1-model_v4 Putative signal peptide protein 0.9406 12 248

Feature Viewer

pLDDT pTM Quality
87.99 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map