F379721
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 141 | 274 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10138753|Ga0157370_101387531 |
| Length | 294 |
| Sequence | MPIRHLVAALLLGSAAIPAAAQDAQSLVAKNLEARGGEAALSAIKNIHFKGRSIAPGGFELTYEETRDRTGPSAAAGRVDLTIQGLDLIQAYDGHGDGWRINPFQGRKDPEKMSSDEARSMADGALIEGPLLASLHDGSRVEYLGRDDFEGTSAYKLRVTQKDGDQFTYWLDPDTYLEIKVDETRKLRGAEVTNETSLGDYEKVAGVYFPMSVESWSQGNDNQRQKTIIATGEANVAIPAGYFDEPGGSSAPAKAAGAEPPDASNKPHSKGATRTKSGXXXXPAAIPSTPAKGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.46 |
| Nodule | 0 |
| Rhizoplane | 1.09 |
| Rhizosphere | 95.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10002145 | 3300002067 | Bacteria | 6948 |
| 2 | JGI25157J39369_1000445 | 3300002741 | Bacteria | 26502 |
| 3 | rootH1_10108422 | 3300003316 | Bacteria | 3711 |
| 4 | rootL2_10339873 | 3300003322 | Bacteria | 1131 |
| 5 | Ga0055533_1002646 | 3300003756 | Bacteria | 3973 |
| 6 | Ga0065715_10228406 | 3300005293 | Bacteria | 1243 |
| 7 | Ga0070658_10002067 | 3300005327 | Bacteria | 16834 |
| 8 | Ga0070658_10024064 | 3300005327 | Bacteria | 4887 |
| 9 | Ga0070658_10024715 | 3300005327 | Bacteria | 4817 |
| 10 | Ga0070658_10090075 | 3300005327 | Bacteria | 2527 |
| 11 | Ga0070683_100091894 | 3300005329 | Bacteria | 2851 |
| 12 | Ga0070683_100130776 | 3300005329 | Bacteria | 2375 |
| 13 | Ga0070683_100151428 | 3300005329 | Bacteria | 2199 |
| 14 | Ga0070670_100191280 | 3300005331 | Bacteria | 1777 |
| 15 | Ga0070680_100003296 | 3300005336 | Bacteria | 12049 |
| 16 | Ga0070680_100011740 | 3300005336 | Bacteria | 6792 |
| 17 | Ga0070680_100116036 | 3300005336 | Bacteria | 2231 |
| 18 | Ga0070660_100011140 | 3300005339 | Bacteria | 6378 |
| 19 | Ga0070660_100019419 | 3300005339 | Bacteria | 4981 |
| 20 | Ga0070660_100423228 | 3300005339 | Bacteria | 1103 |
| 21 | Ga0070689_100360209 | 3300005340 | Unclassified | 1222 |
| 22 | Ga0070661_100156185 | 3300005344 | Bacteria | 1726 |
| 23 | Ga0070692_10043221 | 3300005345 | Bacteria | 2316 |
| 24 | Ga0070692_10085327 | 3300005345 | Unclassified | 1708 |
| 25 | Ga0070669_100050318 | 3300005353 | Bacteria | 3043 |
| 26 | Ga0070669_100230441 | 3300005353 | Bacteria | 1468 |
| 27 | Ga0070671_100345374 | 3300005355 | Unclassified | 1270 |
| 28 | Ga0070671_100487538 | 3300005355 | Bacteria | 1059 |
| 29 | Ga0070659_100010346 | 3300005366 | Bacteria | 6860 |
| 30 | Ga0070659_100020067 | 3300005366 | Bacteria | 5075 |
| 31 | Ga0070659_100156625 | 3300005366 | Bacteria | 1860 |
| 32 | Ga0070667_100472085 | 3300005367 | Bacteria | 1148 |
| 33 | Ga0070709_10050045 | 3300005434 | Unclassified | 2616 |
| 34 | Ga0070714_100016817 | 3300005435 | Bacteria | 5915 |
| 35 | Ga0070714_100017090 | 3300005435 | Bacteria | 5873 |
| 36 | Ga0070713_100004013 | 3300005436 | Bacteria | 9799 |
| 37 | Ga0070713_100020351 | 3300005436 | Bacteria | 5086 |
| 38 | Ga0070701_10022872 | 3300005438 | Bacteria | 3002 |
| 39 | Ga0070663_100006510 | 3300005455 | Bacteria | 7033 |
| 40 | Ga0070663_100551110 | 3300005455 | Unclassified | 964 |
| 41 | Ga0070678_100509758 | 3300005456 | Bacteria | 1063 |
| 42 | Ga0070662_100030504 | 3300005457 | Bacteria | 3774 |
| 43 | Ga0070681_10056531 | 3300005458 | Bacteria | 3905 |
| 44 | Ga0070679_100055393 | 3300005530 | Bacteria | 3949 |
| 45 | Ga0070679_100082312 | 3300005530 | Bacteria | 3208 |
| 46 | Ga0070679_100135636 | 3300005530 | Bacteria | 2443 |
| 47 | Ga0070672_100011908 | 3300005543 | Bacteria | 6080 |
| 48 | Ga0070672_100315514 | 3300005543 | Bacteria | 1328 |
| 49 | Ga0070704_100061036 | 3300005549 | Bacteria | 2696 |
| 50 | Ga0068855_100055350 | 3300005563 | Bacteria | 4660 |
| 51 | Ga0068855_100187243 | 3300005563 | Bacteria | 2337 |
| 52 | Ga0068855_100471383 | 3300005563 | Bacteria | 1368 |
| 53 | Ga0070664_100212117 | 3300005564 | Bacteria | 1731 |
| 54 | Ga0068854_100004122 | 3300005578 | Bacteria | 9133 |
| 55 | Ga0068856_100016446 | 3300005614 | Bacteria | 7159 |
| 56 | Ga0068856_100021630 | 3300005614 | Bacteria | 6251 |
| 57 | Ga0068856_100047513 | 3300005614 | Bacteria | 4228 |
| 58 | Ga0068856_100160046 | 3300005614 | Unclassified | 2262 |
| 59 | Ga0068856_100424993 | 3300005614 | Bacteria | 1349 |
| 60 | Ga0068852_100002257 | 3300005616 | Bacteria | 13226 |
| 61 | Ga0068852_100002731 | 3300005616 | Bacteria | 12209 |
| 62 | Ga0068852_100005304 | 3300005616 | Bacteria | 9200 |
| 63 | Ga0068852_100009472 | 3300005616 | Bacteria | 7236 |
| 64 | Ga0068859_100001609 | 3300005617 | Bacteria | 23072 |
| 65 | Ga0068859_100349812 | 3300005617 | Bacteria | 1573 |
| 66 | Ga0068866_10042248 | 3300005718 | Bacteria | 2268 |
| 67 | Ga0068863_100250377 | 3300005841 | Bacteria | 1711 |
| 68 | Ga0068858_100377299 | 3300005842 | Bacteria | 1360 |
| 69 | Ga0068860_100506861 | 3300005843 | Bacteria | 1205 |
| 70 | Ga0070717_10018791 | 3300006028 | Bacteria | 5405 |
| 71 | Ga0097621_100018232 | 3300006237 | Bacteria | 5354 |
| 72 | Ga0068871_100012064 | 3300006358 | Bacteria | 6358 |
| 73 | Ga0097620_100001609 | 3300006931 | Bacteria | 23072 |
| 74 | Ga0097620_100176525 | 3300006931 | Bacteria | 2218 |
| 75 | Ga0097620_100349813 | 3300006931 | Bacteria | 1573 |
| 76 | Ga0105240_10028642 | 3300009093 | Bacteria | 7270 |
| 77 | Ga0105240_10040644 | 3300009093 | Bacteria | 5945 |
| 78 | Ga0111539_10467633 | 3300009094 | Unclassified | 1468 |
| 79 | Ga0105242_10498689 | 3300009176 | Bacteria | 1158 |
| 80 | Ga0105248_10433725 | 3300009177 | Bacteria | 1480 |
| 81 | Ga0105238_10213043 | 3300009551 | Bacteria | 1908 |
| 82 | Ga0105238_10679311 | 3300009551 | Bacteria | 1041 |
| 83 | Ga0105239_10004411 | 3300010375 | Bacteria | 16846 |
| 84 | Ga0157373_10067281 | 3300013100 | Bacteria | 2534 |
| 85 | Ga0157373_10070909 | 3300013100 | Bacteria | 2462 |
| 86 | Ga0157373_10103221 | 3300013100 | Bacteria | 2006 |
| 87 | Ga0157373_10104909 | 3300013100 | Bacteria | 1988 |
| 88 | Ga0157373_10140197 | 3300013100 | Bacteria | 1700 |
| 89 | Ga0157373_10211526 | 3300013100 | Bacteria | 1367 |
| 90 | Ga0157371_10016916 | 3300013102 | Bacteria | 5430 |
| 91 | Ga0157371_10051595 | 3300013102 | Bacteria | 2922 |
| 92 | Ga0157371_10059395 | 3300013102 | Archaea | 2711 |
| 93 | Ga0157371_10071240 | 3300013102 | Bacteria | 2461 |
| 94 | Ga0157371_10073664 | 3300013102 | Bacteria | 2418 |
| 95 | Ga0157370_10026709 | 3300013104 | Bacteria | 5697 |
| 96 | Ga0157370_10042440 | 3300013104 | Bacteria | 4384 |
| 97 | Ga0157370_10094249 | 3300013104 | Bacteria | 2809 |
| 98 | Ga0157370_10138753 | 3300013104 | Bacteria | 2265 |
| 99 | Ga0157369_10090741 | 3300013105 | Bacteria | 3262 |
| 100 | Ga0157369_10105177 | 3300013105 | Bacteria | 3005 |
| 101 | Ga0157369_10163826 | 3300013105 | Bacteria | 2346 |
| 102 | Ga0157369_10241324 | 3300013105 | Unclassified | 1887 |
| 103 | Ga0157369_10308703 | 3300013105 | Bacteria | 1645 |
| 104 | Ga0157369_10556309 | 3300013105 | Bacteria | 1185 |
| 105 | Ga0157378_10060045 | 3300013297 | Bacteria | 3393 |
| 106 | Ga0157372_10227014 | 3300013307 | Bacteria | 2165 |
| 107 | Ga0157372_10295494 | 3300013307 | Bacteria | 1884 |
| 108 | Ga0157372_10426660 | 3300013307 | Unclassified | 1545 |
| 109 | Ga0157375_10016270 | 3300013308 | Bacteria | 6674 |
| 110 | Ga0157375_10041773 | 3300013308 | Bacteria | 4431 |
| 111 | Ga0157375_10050091 | 3300013308 | Bacteria | 4096 |
| 112 | Ga0163163_10000419 | 3300014325 | Bacteria | 39366 |
| 113 | Ga0157380_10314537 | 3300014326 | Bacteria | 1449 |
| 114 | Ga0182008_10009746 | 3300014497 | Bacteria | 5170 |
| 115 | Ga0182008_10200771 | 3300014497 | Bacteria | 1015 |
| 116 | Ga0157377_10226230 | 3300014745 | Bacteria | 1200 |
| 117 | Ga0182007_10009620 | 3300015262 | Bacteria | 3882 |
| 118 | Ga0206354_10880819 | 3300020081 | Bacteria | 1300 |
| 119 | Ga0209674_100063 | 3300025226 | Bacteria | 275507 |
| 120 | Ga0209674_101628 | 3300025226 | Bacteria | 5624 |
| 121 | Ga0209258_100649 | 3300025242 | Bacteria | 25589 |
| 122 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 123 | Ga0207647_10066589 | 3300025904 | Bacteria | 2184 |
| 124 | Ga0207647_10087497 | 3300025904 | Bacteria | 1861 |
| 125 | Ga0207647_10187823 | 3300025904 | Bacteria | 1198 |
| 126 | Ga0207699_10036059 | 3300025906 | Unclassified | 2817 |
| 127 | Ga0207705_10003141 | 3300025909 | Bacteria | 12576 |
| 128 | Ga0207705_10041836 | 3300025909 | Bacteria | 3287 |
| 129 | Ga0207705_10146487 | 3300025909 | Bacteria | 1767 |
| 130 | Ga0207705_10150416 | 3300025909 | Bacteria | 1744 |
| 131 | Ga0207705_10158111 | 3300025909 | Bacteria | 1701 |
| 132 | Ga0207654_10001095 | 3300025911 | Bacteria | 14674 |
| 133 | Ga0207707_10040281 | 3300025912 | Bacteria | 4080 |
| 134 | Ga0207695_10029303 | 3300025913 | Bacteria | 6087 |
| 135 | Ga0207693_10174906 | 3300025915 | Bacteria | 1689 |
| 136 | Ga0207660_10001739 | 3300025917 | Bacteria | 14597 |
| 137 | Ga0207660_10002691 | 3300025917 | Bacteria | 11659 |
| 138 | Ga0207657_10000993 | 3300025919 | Bacteria | 30099 |
| 139 | Ga0207657_10026986 | 3300025919 | Bacteria | 5266 |
| 140 | Ga0207657_10214292 | 3300025919 | Bacteria | 1544 |
| 141 | Ga0207649_10155835 | 3300025920 | Bacteria | 1578 |
| 142 | Ga0207652_10014890 | 3300025921 | Bacteria | 6306 |
| 143 | Ga0207652_10048990 | 3300025921 | Bacteria | 3614 |
| 144 | Ga0207652_10186599 | 3300025921 | Bacteria | 1865 |
| 145 | Ga0207652_10490013 | 3300025921 | Bacteria | 1107 |
| 146 | Ga0207681_10016549 | 3300025923 | Bacteria | 4615 |
| 147 | Ga0207681_10164453 | 3300025923 | Bacteria | 1676 |
| 148 | Ga0207694_10105010 | 3300025924 | Bacteria | 2242 |
| 149 | Ga0207694_10503909 | 3300025924 | Bacteria | 1014 |
| 150 | Ga0207650_10014457 | 3300025925 | Bacteria | 5487 |
| 151 | Ga0207659_10229751 | 3300025926 | Archaea | 1496 |
| 152 | Ga0207659_10236940 | 3300025926 | Bacteria | 1474 |
| 153 | Ga0207700_10002136 | 3300025928 | Bacteria | 11315 |
| 154 | Ga0207664_10010769 | 3300025929 | Bacteria | 6468 |
| 155 | Ga0207664_10080302 | 3300025929 | Bacteria | 2650 |
| 156 | Ga0207644_10057138 | 3300025931 | Bacteria | 2817 |
| 157 | Ga0207644_10441875 | 3300025931 | Bacteria | 1068 |
| 158 | Ga0207644_10533923 | 3300025931 | Bacteria | 970 |
| 159 | Ga0207690_10017358 | 3300025932 | Bacteria | 4391 |
| 160 | Ga0207690_10044149 | 3300025932 | Bacteria | 2937 |
| 161 | Ga0207690_10086156 | 3300025932 | Bacteria | 2207 |
| 162 | Ga0207690_10521996 | 3300025932 | Unclassified | 963 |
| 163 | Ga0207706_10021151 | 3300025933 | Bacteria | 5846 |
| 164 | Ga0207686_10200541 | 3300025934 | Bacteria | 1429 |
| 165 | Ga0207670_10368411 | 3300025936 | Unclassified | 1141 |
| 166 | Ga0207691_10004995 | 3300025940 | Bacteria | 12799 |
| 167 | Ga0207711_10131136 | 3300025941 | Bacteria | 2248 |
| 168 | Ga0207689_10092941 | 3300025942 | Bacteria | 2478 |
| 169 | Ga0207661_10105635 | 3300025944 | Bacteria | 2373 |
| 170 | Ga0207661_10114602 | 3300025944 | Bacteria | 2285 |
| 171 | Ga0207661_10166378 | 3300025944 | Bacteria | 1917 |
| 172 | Ga0207661_10343884 | 3300025944 | Bacteria | 1345 |
| 173 | Ga0207667_10012878 | 3300025949 | Bacteria | 9608 |
| 174 | Ga0207667_10927591 | 3300025949 | Bacteria | 861 |
| 175 | Ga0207640_10002836 | 3300025981 | Bacteria | 9300 |
| 176 | Ga0207677_10087856 | 3300026023 | Bacteria | 2252 |
| 177 | Ga0207639_10003267 | 3300026041 | Bacteria | 10923 |
| 178 | Ga0207678_10000589 | 3300026067 | Bacteria | 33202 |
| 179 | Ga0207678_10111522 | 3300026067 | Bacteria | 2334 |
| 180 | Ga0207678_10565510 | 3300026067 | Unclassified | 995 |
| 181 | Ga0207702_10014276 | 3300026078 | Bacteria | 6596 |
| 182 | Ga0207641_10219841 | 3300026088 | Bacteria | 1761 |
| 183 | Ga0207648_10132106 | 3300026089 | Bacteria | 2198 |
| 184 | Ga0207676_10504991 | 3300026095 | Bacteria | 1149 |
| 185 | Ga0207674_10000655 | 3300026116 | Bacteria | 45111 |
| 186 | Ga0207674_10072310 | 3300026116 | Bacteria | 3464 |
| 187 | Ga0207698_10000577 | 3300026142 | Bacteria | 21420 |
| 188 | Ga0207698_10096881 | 3300026142 | Bacteria | 2432 |
| 189 | Ga0207698_10312330 | 3300026142 | Bacteria | 1468 |
| 190 | Ga0207698_10618866 | 3300026142 | Bacteria | 1069 |
| 191 | Ga0373956_0010552 | 3300035119 | Bacteria | 3788 |
| 192 | Ga0373937_0018001 | 3300036401 | Bacteria | 6301 |
| 193 | Ga0395899_0000340 | 3300037312 | Bacteria | 58575 |
| 194 | Ga0395899_0025632 | 3300037312 | Bacteria | 4450 |
| 195 | Ga0395899_0032761 | 3300037312 | Bacteria | 3905 |
| 196 | Ga0395899_0056827 | 3300037312 | Bacteria | 2891 |
| 197 | Ga0395899_0063007 | 3300037312 | Bacteria | 2729 |
| 198 | Ga0395899_0079988 | 3300037312 | Bacteria | 2379 |
| 199 | Ga0395899_0118139 | 3300037312 | Bacteria | 1901 |
| 200 | Ga0395899_0180675 | 3300037312 | Bacteria | 1481 |
| 201 | Ga0395900_0000468 | 3300037418 | Bacteria | 57784 |
| 202 | Ga0395900_0001094 | 3300037418 | Bacteria | 34490 |
| 203 | Ga0395900_0002159 | 3300037418 | Bacteria | 21983 |
| 204 | Ga0395900_0004766 | 3300037418 | Bacteria | 14295 |
| 205 | Ga0395900_0011701 | 3300037418 | Bacteria | 8975 |
| 206 | Ga0395900_0015883 | 3300037418 | Bacteria | 7669 |
| 207 | Ga0395900_0035413 | 3300037418 | Bacteria | 5141 |
| 208 | Ga0395900_0052582 | 3300037418 | Bacteria | 4192 |
| 209 | Ga0395900_0059441 | 3300037418 | Bacteria | 3935 |
| 210 | Ga0395900_0169065 | 3300037418 | Bacteria | 2226 |
| 211 | Ga0395900_0226481 | 3300037418 | Bacteria | 1882 |
| 212 | Ga0395898_0006296 | 3300037466 | Bacteria | 12688 |
| 213 | Ga0395898_0050973 | 3300037466 | Bacteria | 4048 |
| 214 | Ga0395898_0139878 | 3300037466 | Bacteria | 2317 |
| 215 | Ga0395898_0176899 | 3300037466 | Bacteria | 2039 |
| 216 | Ga0395898_0221758 | 3300037466 | Bacteria | 1803 |
| 217 | Ga0395905_0000606 | 3300037471 | Bacteria | 48007 |
| 218 | Ga0395905_0000897 | 3300037471 | Bacteria | 38814 |
| 219 | Ga0395905_0005315 | 3300037471 | Bacteria | 13161 |
| 220 | Ga0395905_0013079 | 3300037471 | Bacteria | 7968 |
| 221 | Ga0395905_0025621 | 3300037471 | Bacteria | 5562 |
| 222 | Ga0395905_0040412 | 3300037471 | Bacteria | 4375 |
| 223 | Ga0395905_0045146 | 3300037471 | Bacteria | 4133 |
| 224 | Ga0395905_0046617 | 3300037471 | Bacteria | 4064 |
| 225 | Ga0395905_0053281 | 3300037471 | Bacteria | 3787 |
| 226 | Ga0395905_0056503 | 3300037471 | Bacteria | 3671 |
| 227 | Ga0395905_0091425 | 3300037471 | Bacteria | 2853 |
| 228 | Ga0395905_0161528 | 3300037471 | Bacteria | 2105 |
| 229 | Ga0395905_0194564 | 3300037471 | Bacteria | 1901 |
| 230 | Ga0395905_0223049 | 3300037471 | Bacteria | 1764 |
| 231 | Ga0395901_0000031 | 3300038443 | Bacteria | 241733 |
| 232 | Ga0395901_0000086 | 3300038443 | Bacteria | 125359 |
| 233 | Ga0395901_0006736 | 3300038443 | Bacteria | 11605 |
| 234 | Ga0395901_0018654 | 3300038443 | Bacteria | 7085 |
| 235 | Ga0395901_0031383 | 3300038443 | Bacteria | 5479 |
| 236 | Ga0395901_0041025 | 3300038443 | Bacteria | 4795 |
| 237 | Ga0395901_0057528 | 3300038443 | Bacteria | 4044 |
| 238 | Ga0395901_0061016 | 3300038443 | Bacteria | 3924 |
| 239 | Ga0395901_0072973 | 3300038443 | Bacteria | 3578 |
| 240 | Ga0395901_0125713 | 3300038443 | Bacteria | 2695 |
| 241 | Ga0439458_0000578 | 3300042157 | Bacteria | 9424 |
| 242 | Ga0466963_0067973 | 3300044694 | Bacteria | 2392 |
| 243 | Ga0466957_0246722 | 3300044842 | Unclassified | 1186 |
| 244 | Ga0466959_0075937 | 3300045049 | Bacteria | 2427 |
| 245 | Ga0466958_0237372 | 3300045836 | Bacteria | 1165 |
| 246 | Ga0466967_0018344 | 3300045976 | Bacteria | 5589 |
| 247 | Ga0495629_0000387 | 3300046459 | Bacteria | 36902 |
| 248 | Ga0495641_0043661 | 3300046461 | Bacteria | 2073 |
| 249 | Ga0495639_0002030 | 3300046475 | Bacteria | 8961 |
| 250 | Ga0495594_0002707 | 3300046499 | Bacteria | 9191 |
| 251 | Ga0495635_0001654 | 3300046663 | Bacteria | 15027 |
| 252 | Ga0495658_0000016 | 3300046683 | Bacteria | 94726 |
| 253 | Ga0495581_0000241 | 3300047315 | Bacteria | 25987 |
| 254 | Ga0495680_0001682 | 3300047322 | Bacteria | 23524 |
| 255 | Ga0495593_0015427 | 3300047673 | Bacteria | 4326 |
| 256 | Ga0495602_0170270 | 3300048088 | Bacteria | 1691 |
| 257 | Ga0495614_0004707 | 3300048089 | Bacteria | 6154 |
| 258 | Ga0496108_0435072 | 3300048911 | Bacteria | 1146 |
| 259 | Ga0496115_0000044 | 3300048918 | Bacteria | 115745 |
| 260 | Ga0496115_0360818 | 3300048918 | Bacteria | 1184 |
| 261 | Ga0501036_0127132 | 3300049572 | Bacteria | 2152 |
| 262 | Ga0501037_0209084 | 3300049573 | Unclassified | 1377 |
| 263 | Ga0501043_0004865 | 3300049579 | Bacteria | 10852 |
| 264 | Ga0501068_0054974 | 3300049584 | Bacteria | 2412 |
| 265 | Ga0501070_0170232 | 3300049586 | Bacteria | 1794 |
| 266 | Ga0501073_0043501 | 3300049589 | Bacteria | 3167 |
| 267 | Ga0501073_0328699 | 3300049589 | Bacteria | 1055 |
| 268 | Ga0501074_0126483 | 3300049590 | Bacteria | 1828 |
| 269 | Ga0501076_0635190 | 3300049592 | Unclassified | 881 |
| 270 | Ga0501080_0023646 | 3300049742 | Bacteria | 5693 |
| 271 | Ga0501044_0051305 | 3300049823 | Bacteria | 4254 |
| 272 | Ga0501045_0166281 | 3300049824 | Bacteria | 1643 |
| 273 | Ga0501084_0179964 | 3300054114 | Bacteria | 1785 |
| 274 | Ga0501082_0198471 | 3300060353 | Bacteria | 1745 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026095 | Ga0207676_10504991 | Ga0207676_105049911 | 219 |
| 2 | 3300025942 | Ga0207689_10092941 | Ga0207689_100929412 | 226 |
| 3 | 3300026116 | Ga0207674_10072310 | Ga0207674_100723101 | 226 |
| 4 | 3300005718 | Ga0068866_10042248 | Ga0068866_100422482 | 227 |
| 5 | 3300005293 | Ga0065715_10228406 | Ga0065715_102284061 | 230 |
| 6 | 3300005438 | Ga0070701_10022872 | Ga0070701_100228722 | 231 |
| 7 | 3300005549 | Ga0070704_100061036 | Ga0070704_1000610362 | 231 |
| 8 | 3300005617 | Ga0068859_100001609 | Ga0068859_1000016097 | 231 |
| 9 | 3300005843 | Ga0068860_100506861 | Ga0068860_1005068611 | 231 |
| 10 | 3300006931 | Ga0097620_100001609 | Ga0097620_1000016097 | 231 |
| 11 | 3300009176 | Ga0105242_10498689 | Ga0105242_104986891 | 231 |
| 12 | 3300013100 | Ga0157373_10067281 | Ga0157373_100672812 | 231 |
| 13 | 3300013102 | Ga0157371_10051595 | Ga0157371_100515952 | 231 |
| 14 | 3300013308 | Ga0157375_10041773 | Ga0157375_100417732 | 231 |
| 15 | 3300014326 | Ga0157380_10314537 | Ga0157380_103145371 | 231 |
| 16 | 3300014497 | Ga0182008_10200771 | Ga0182008_102007711 | 231 |
| 17 | 3300025934 | Ga0207686_10200541 | Ga0207686_102005412 | 231 |
| 18 | 3300026023 | Ga0207677_10087856 | Ga0207677_100878563 | 231 |
| 19 | 3300009094 | Ga0111539_10467633 | Ga0111539_104676333 | 232 |
| 20 | 3300037418 | Ga0395900_0226481 | Ga0395900_0226481_697_1404 | 232 |
| 21 | 3300037471 | Ga0395905_0223049 | Ga0395905_0223049_743_1447 | 232 |
| 22 | 3300009093 | Ga0105240_10040644 | Ga0105240_100406442 | 233 |
| 23 | 3300013100 | Ga0157373_10140197 | Ga0157373_101401972 | 233 |
| 24 | 3300013102 | Ga0157371_10073664 | Ga0157371_100736642 | 233 |
| 25 | 3300013105 | Ga0157369_10163826 | Ga0157369_101638262 | 233 |
| 26 | 3300013307 | Ga0157372_10295494 | Ga0157372_102954942 | 233 |
| 27 | 3300013308 | Ga0157375_10016270 | Ga0157375_100162703 | 233 |
| 28 | 3300025913 | Ga0207695_10029303 | Ga0207695_100293032 | 233 |
| 29 | 3300046459 | Ga0495629_0000387 | Ga0495629_0000387_7525_8232 | 233 |
| 30 | 3300046461 | Ga0495641_0043661 | Ga0495641_0043661_99_806 | 233 |
| 31 | 3300046475 | Ga0495639_0002030 | Ga0495639_0002030_6199_6906 | 233 |
| 32 | 3300046499 | Ga0495594_0002707 | Ga0495594_0002707_324_1031 | 233 |
| 33 | 3300046663 | Ga0495635_0001654 | Ga0495635_0001654_12519_13226 | 233 |
| 34 | 3300046683 | Ga0495658_0000016 | Ga0495658_0000016_23235_23942 | 233 |
| 35 | 3300047315 | Ga0495581_0000241 | Ga0495581_0000241_6523_7230 | 233 |
| 36 | 3300047322 | Ga0495680_0001682 | Ga0495680_0001682_3508_4215 | 233 |
| 37 | 3300047673 | Ga0495593_0015427 | Ga0495593_0015427_154_861 | 233 |
| 38 | 3300048089 | Ga0495614_0004707 | Ga0495614_0004707_94_801 | 233 |
| 39 | 3300010375 | Ga0105239_10004411 | Ga0105239_100044112 | 234 |
| 40 | 3300005339 | Ga0070660_100423228 | Ga0070660_1004232282 | 235 |
| 41 | 3300005353 | Ga0070669_100050318 | Ga0070669_1000503182 | 235 |
| 42 | 3300005355 | Ga0070671_100487538 | Ga0070671_1004875382 | 235 |
| 43 | 3300005366 | Ga0070659_100156625 | Ga0070659_1001566252 | 235 |
| 44 | 3300005367 | Ga0070667_100472085 | Ga0070667_1004720851 | 235 |
| 45 | 3300005456 | Ga0070678_100509758 | Ga0070678_1005097581 | 235 |
| 46 | 3300005543 | Ga0070672_100011908 | Ga0070672_1000119083 | 235 |
| 47 | 3300005563 | Ga0068855_100471383 | Ga0068855_1004713831 | 235 |
| 48 | 3300025920 | Ga0207649_10155835 | Ga0207649_101558352 | 235 |
| 49 | 3300025921 | Ga0207652_10490013 | Ga0207652_104900132 | 235 |
| 50 | 3300025923 | Ga0207681_10164453 | Ga0207681_101644532 | 235 |
| 51 | 3300025931 | Ga0207644_10533923 | Ga0207644_105339231 | 235 |
| 52 | 3300025932 | Ga0207690_10086156 | Ga0207690_100861562 | 235 |
| 53 | 3300025940 | Ga0207691_10004995 | Ga0207691_100049952 | 235 |
| 54 | 3300025949 | Ga0207667_10927591 | Ga0207667_109275911 | 235 |
| 55 | 3300026089 | Ga0207648_10132106 | Ga0207648_101321062 | 235 |
| 56 | 3300026142 | Ga0207698_10618866 | Ga0207698_106188661 | 235 |
| 57 | 3300005336 | Ga0070680_100116036 | Ga0070680_1001160361 | 237 |
| 58 | 3300005339 | Ga0070660_100019419 | Ga0070660_1000194192 | 237 |
| 59 | 3300005455 | Ga0070663_100551110 | Ga0070663_1005511101 | 237 |
| 60 | 3300005564 | Ga0070664_100212117 | Ga0070664_1002121172 | 237 |
| 61 | 3300025909 | Ga0207705_10158111 | Ga0207705_101581112 | 237 |
| 62 | 3300025919 | Ga0207657_10026986 | Ga0207657_100269864 | 237 |
| 63 | 3300025931 | Ga0207644_10057138 | Ga0207644_100571382 | 237 |
| 64 | 3300025932 | Ga0207690_10521996 | Ga0207690_105219962 | 237 |
| 65 | 3300025944 | Ga0207661_10343884 | Ga0207661_103438842 | 237 |
| 66 | 3300026067 | Ga0207678_10565510 | Ga0207678_105655102 | 237 |
| 67 | 3300037471 | Ga0395905_0013079 | Ga0395905_0013079_1681_2550 | 237 |
| 68 | 3300003322 | rootL2_10339873 | rootL2_103398732 | 239 |
| 69 | 3300005327 | Ga0070658_10090075 | Ga0070658_100900752 | 239 |
| 70 | 3300005329 | Ga0070683_100091894 | Ga0070683_1000918941 | 239 |
| 71 | 3300005455 | Ga0070663_100006510 | Ga0070663_1000065102 | 239 |
| 72 | 3300005530 | Ga0070679_100055393 | Ga0070679_1000553933 | 239 |
| 73 | 3300025909 | Ga0207705_10146487 | Ga0207705_101464872 | 239 |
| 74 | 3300025921 | Ga0207652_10048990 | Ga0207652_100489903 | 239 |
| 75 | 3300025944 | Ga0207661_10105635 | Ga0207661_101056352 | 239 |
| 76 | 3300026067 | Ga0207678_10000589 | Ga0207678_1000058915 | 239 |
| 77 | 3300037312 | Ga0395899_0079988 | Ga0395899_0079988_582_1454 | 239 |
| 78 | 3300037418 | Ga0395900_0004766 | Ga0395900_0004766_12545_13417 | 239 |
| 79 | 3300037466 | Ga0395898_0139878 | Ga0395898_0139878_1237_2109 | 239 |
| 80 | 3300037471 | Ga0395905_0005315 | Ga0395905_0005315_209_1081 | 239 |
| 81 | 3300038443 | Ga0395901_0041025 | Ga0395901_0041025_2236_3108 | 239 |
| 82 | 3300025931 | Ga0207644_10441875 | Ga0207644_104418752 | 240 |
| 83 | 3300003316 | rootH1_10108422 | rootH1_101084222 | 242 |
| 84 | 3300005434 | Ga0070709_10050045 | Ga0070709_100500452 | 242 |
| 85 | 3300005435 | Ga0070714_100016817 | Ga0070714_1000168172 | 242 |
| 86 | 3300005436 | Ga0070713_100020351 | Ga0070713_1000203513 | 242 |
| 87 | 3300005614 | Ga0068856_100016446 | Ga0068856_1000164464 | 242 |
| 88 | 3300006028 | Ga0070717_10018791 | Ga0070717_100187911 | 242 |
| 89 | 3300025906 | Ga0207699_10036059 | Ga0207699_100360593 | 242 |
| 90 | 3300025915 | Ga0207693_10174906 | Ga0207693_101749062 | 242 |
| 91 | 3300025929 | Ga0207664_10010769 | Ga0207664_100107693 | 242 |
| 92 | 3300026078 | Ga0207702_10014276 | Ga0207702_100142766 | 242 |
| 93 | 3300048911 | Ga0496108_0435072 | Ga0496108_0435072_294_1043 | 242 |
| 94 | 3300048918 | Ga0496115_0360818 | Ga0496115_0360818_249_998 | 242 |
| 95 | 3300005614 | Ga0068856_100047513 | Ga0068856_1000475132 | 244 |
| 96 | 3300005616 | Ga0068852_100009472 | Ga0068852_1000094722 | 244 |
| 97 | 3300005841 | Ga0068863_100250377 | Ga0068863_1002503772 | 244 |
| 98 | 3300006237 | Ga0097621_100018232 | Ga0097621_1000182322 | 244 |
| 99 | 3300006358 | Ga0068871_100012064 | Ga0068871_1000120642 | 244 |
| 100 | 3300006931 | Ga0097620_100176525 | Ga0097620_1001765253 | 244 |
| 101 | 3300009177 | Ga0105248_10433725 | Ga0105248_104337252 | 244 |
| 102 | 3300009551 | Ga0105238_10679311 | Ga0105238_106793112 | 244 |
| 103 | 3300013297 | Ga0157378_10060045 | Ga0157378_100600452 | 244 |
| 104 | 3300013308 | Ga0157375_10050091 | Ga0157375_100500912 | 244 |
| 105 | 3300025924 | Ga0207694_10503909 | Ga0207694_105039091 | 244 |
| 106 | 3300025941 | Ga0207711_10131136 | Ga0207711_101311362 | 244 |
| 107 | 3300026041 | Ga0207639_10003267 | Ga0207639_1000326717 | 244 |
| 108 | 3300026088 | Ga0207641_10219841 | Ga0207641_102198411 | 244 |
| 109 | 3300026142 | Ga0207698_10096881 | Ga0207698_100968813 | 244 |
| 110 | 3300026142 | Ga0207698_10312330 | Ga0207698_103123302 | 244 |
| 111 | 3300005353 | Ga0070669_100230441 | Ga0070669_1002304412 | 245 |
| 112 | 3300005617 | Ga0068859_100349812 | Ga0068859_1003498122 | 245 |
| 113 | 3300005842 | Ga0068858_100377299 | Ga0068858_1003772992 | 245 |
| 114 | 3300006931 | Ga0097620_100349813 | Ga0097620_1003498132 | 245 |
| 115 | 3300005327 | Ga0070658_10002067 | Ga0070658_1000206712 | 246 |
| 116 | 3300005339 | Ga0070660_100011140 | Ga0070660_1000111402 | 246 |
| 117 | 3300005345 | Ga0070692_10085327 | Ga0070692_100853271 | 246 |
| 118 | 3300013102 | Ga0157371_10016916 | Ga0157371_100169162 | 246 |
| 119 | 3300025909 | Ga0207705_10003141 | Ga0207705_100031418 | 246 |
| 120 | 3300025911 | Ga0207654_10001095 | Ga0207654_100010959 | 246 |
| 121 | 3300025919 | Ga0207657_10000993 | Ga0207657_100009933 | 246 |
| 122 | 3300037312 | Ga0395899_0000340 | Ga0395899_0000340_9040_9912 | 246 |
| 123 | 3300037418 | Ga0395900_0000468 | Ga0395900_0000468_8965_9837 | 246 |
| 124 | 3300037466 | Ga0395898_0006296 | Ga0395898_0006296_2771_3643 | 246 |
| 125 | 3300038443 | Ga0395901_0000031 | Ga0395901_0000031_184073_184945 | 246 |
| 126 | 3300049573 | Ga0501037_0209084 | Ga0501037_0209084_386_1141 | 246 |
| 127 | 3300049579 | Ga0501043_0004865 | Ga0501043_0004865_259_1014 | 246 |
| 128 | 3300049586 | Ga0501070_0170232 | Ga0501070_0170232_394_1149 | 246 |
| 129 | 3300049590 | Ga0501074_0126483 | Ga0501074_0126483_934_1689 | 246 |
| 130 | 3300049742 | Ga0501080_0023646 | Ga0501080_0023646_472_1227 | 246 |
| 131 | 3300054114 | Ga0501084_0179964 | Ga0501084_0179964_505_1260 | 246 |
| 132 | 3300060353 | Ga0501082_0198471 | Ga0501082_0198471_390_1145 | 246 |
| 133 | 3300014325 | Ga0163163_10000419 | Ga0163163_100004193 | 247 |
| 134 | 3300035119 | Ga0373956_0010552 | Ga0373956_0010552_824_1657 | 247 |
| 135 | 3300036401 | Ga0373937_0018001 | Ga0373937_0018001_3292_4125 | 247 |
| 136 | 3300037418 | Ga0395900_0015883 | Ga0395900_0015883_4368_5243 | 247 |
| 137 | 3300037418 | Ga0395900_0035413 | Ga0395900_0035413_3737_4606 | 247 |
| 138 | 3300037471 | Ga0395905_0040412 | Ga0395905_0040412_1997_2866 | 247 |
| 139 | 3300038443 | Ga0395901_0031383 | Ga0395901_0031383_1043_1912 | 247 |
| 140 | 3300038443 | Ga0395901_0061016 | Ga0395901_0061016_1947_2822 | 247 |
| 141 | 3300038443 | Ga0395901_0125713 | Ga0395901_0125713_1218_2087 | 247 |
| 142 | 3300048088 | Ga0495602_0170270 | Ga0495602_0170270_712_1545 | 247 |
| 143 | 3300005336 | Ga0070680_100003296 | Ga0070680_1000032962 | 249 |
| 144 | 3300005344 | Ga0070661_100156185 | Ga0070661_1001561852 | 249 |
| 145 | 3300005530 | Ga0070679_100135636 | Ga0070679_1001356361 | 249 |
| 146 | 3300005563 | Ga0068855_100187243 | Ga0068855_1001872432 | 249 |
| 147 | 3300005578 | Ga0068854_100004122 | Ga0068854_1000041223 | 249 |
| 148 | 3300005614 | Ga0068856_100021630 | Ga0068856_1000216304 | 249 |
| 149 | 3300005616 | Ga0068852_100005304 | Ga0068852_1000053046 | 249 |
| 150 | 3300009093 | Ga0105240_10028642 | Ga0105240_100286425 | 249 |
| 151 | 3300009551 | Ga0105238_10213043 | Ga0105238_102130432 | 249 |
| 152 | 3300013100 | Ga0157373_10104909 | Ga0157373_101049091 | 249 |
| 153 | 3300013104 | Ga0157370_10026709 | Ga0157370_100267093 | 249 |
| 154 | 3300013105 | Ga0157369_10308703 | Ga0157369_103087032 | 249 |
| 155 | 3300013105 | Ga0157369_10556309 | Ga0157369_105563092 | 249 |
| 156 | 3300013307 | Ga0157372_10426660 | Ga0157372_104266601 | 249 |
| 157 | 3300020081 | Ga0206354_10880819 | Ga0206354_108808191 | 249 |
| 158 | 3300025924 | Ga0207694_10105010 | Ga0207694_101050102 | 249 |
| 159 | 3300025949 | Ga0207667_10012878 | Ga0207667_100128784 | 249 |
| 160 | 3300025981 | Ga0207640_10002836 | Ga0207640_100028368 | 249 |
| 161 | 3300037312 | Ga0395899_0063007 | Ga0395899_0063007_335_1195 | 250 |
| 162 | 3300037418 | Ga0395900_0001094 | Ga0395900_0001094_19171_20031 | 250 |
| 163 | 3300037466 | Ga0395898_0176899 | Ga0395898_0176899_561_1421 | 250 |
| 164 | 3300037471 | Ga0395905_0000897 | Ga0395905_0000897_17300_18160 | 250 |
| 165 | 3300038443 | Ga0395901_0018654 | Ga0395901_0018654_4894_5754 | 250 |
| 166 | 3300013104 | Ga0157370_10042440 | Ga0157370_100424402 | 251 |
| 167 | 3300048918 | Ga0496115_0000044 | Ga0496115_0000044_88918_89673 | 251 |
| 168 | 3300049572 | Ga0501036_0127132 | Ga0501036_0127132_385_1155 | 251 |
| 169 | 3300049584 | Ga0501068_0054974 | Ga0501068_0054974_1241_2011 | 251 |
| 170 | 3300049589 | Ga0501073_0043501 | Ga0501073_0043501_2152_2922 | 251 |
| 171 | 3300049589 | Ga0501073_0328699 | Ga0501073_0328699_246_1016 | 251 |
| 172 | 3300049592 | Ga0501076_0635190 | Ga0501076_0635190_53_823 | 251 |
| 173 | 3300049823 | Ga0501044_0051305 | Ga0501044_0051305_2407_3177 | 251 |
| 174 | 3300049824 | Ga0501045_0166281 | Ga0501045_0166281_208_978 | 251 |
| 175 | 3300005331 | Ga0070670_100191280 | Ga0070670_1001912802 | 252 |
| 176 | 3300005336 | Ga0070680_100011740 | Ga0070680_1000117402 | 252 |
| 177 | 3300005340 | Ga0070689_100360209 | Ga0070689_1003602092 | 252 |
| 178 | 3300005355 | Ga0070671_100345374 | Ga0070671_1003453741 | 252 |
| 179 | 3300005366 | Ga0070659_100010346 | Ga0070659_1000103465 | 252 |
| 180 | 3300005366 | Ga0070659_100020067 | Ga0070659_1000200674 | 252 |
| 181 | 3300005458 | Ga0070681_10056531 | Ga0070681_100565312 | 252 |
| 182 | 3300005543 | Ga0070672_100315514 | Ga0070672_1003155142 | 252 |
| 183 | 3300005563 | Ga0068855_100055350 | Ga0068855_1000553503 | 252 |
| 184 | 3300013100 | Ga0157373_10103221 | Ga0157373_101032212 | 252 |
| 185 | 3300013100 | Ga0157373_10211526 | Ga0157373_102115262 | 252 |
| 186 | 3300025912 | Ga0207707_10040281 | Ga0207707_100402812 | 252 |
| 187 | 3300025923 | Ga0207681_10016549 | Ga0207681_100165492 | 252 |
| 188 | 3300025925 | Ga0207650_10014457 | Ga0207650_100144572 | 252 |
| 189 | 3300025926 | Ga0207659_10229751 | Ga0207659_102297512 | 252 |
| 190 | 3300025932 | Ga0207690_10017358 | Ga0207690_100173582 | 252 |
| 191 | 3300025933 | Ga0207706_10021151 | Ga0207706_100211512 | 252 |
| 192 | 3300025936 | Ga0207670_10368411 | Ga0207670_103684111 | 252 |
| 193 | 3300037418 | Ga0395900_0169065 | Ga0395900_0169065_836_1711 | 252 |
| 194 | 3300037466 | Ga0395898_0221758 | Ga0395898_0221758_881_1756 | 252 |
| 195 | 3300037471 | Ga0395905_0161528 | Ga0395905_0161528_48_923 | 252 |
| 196 | 3300005327 | Ga0070658_10024064 | Ga0070658_100240644 | 253 |
| 197 | 3300005327 | Ga0070658_10024715 | Ga0070658_100247152 | 253 |
| 198 | 3300005329 | Ga0070683_100130776 | Ga0070683_1001307763 | 253 |
| 199 | 3300005329 | Ga0070683_100151428 | Ga0070683_1001514282 | 253 |
| 200 | 3300005345 | Ga0070692_10043221 | Ga0070692_100432212 | 253 |
| 201 | 3300005457 | Ga0070662_100030504 | Ga0070662_1000305045 | 253 |
| 202 | 3300005530 | Ga0070679_100082312 | Ga0070679_1000823123 | 253 |
| 203 | 3300005614 | Ga0068856_100160046 | Ga0068856_1001600462 | 253 |
| 204 | 3300005614 | Ga0068856_100424993 | Ga0068856_1004249932 | 253 |
| 205 | 3300005616 | Ga0068852_100002257 | Ga0068852_1000022576 | 253 |
| 206 | 3300005616 | Ga0068852_100002731 | Ga0068852_10000273112 | 253 |
| 207 | 3300013100 | Ga0157373_10070909 | Ga0157373_100709092 | 253 |
| 208 | 3300013102 | Ga0157371_10059395 | Ga0157371_100593952 | 253 |
| 209 | 3300013102 | Ga0157371_10071240 | Ga0157371_100712402 | 253 |
| 210 | 3300013104 | Ga0157370_10094249 | Ga0157370_100942493 | 253 |
| 211 | 3300013104 | Ga0157370_10138753 | Ga0157370_101387531 | 253 |
| 212 | 3300013105 | Ga0157369_10090741 | Ga0157369_100907413 | 253 |
| 213 | 3300013105 | Ga0157369_10105177 | Ga0157369_101051772 | 253 |
| 214 | 3300013105 | Ga0157369_10241324 | Ga0157369_102413242 | 253 |
| 215 | 3300013307 | Ga0157372_10227014 | Ga0157372_102270143 | 253 |
| 216 | 3300014745 | Ga0157377_10226230 | Ga0157377_102262301 | 253 |
| 217 | 3300025904 | Ga0207647_10087497 | Ga0207647_100874972 | 253 |
| 218 | 3300025904 | Ga0207647_10187823 | Ga0207647_101878232 | 253 |
| 219 | 3300025909 | Ga0207705_10041836 | Ga0207705_100418363 | 253 |
| 220 | 3300025909 | Ga0207705_10150416 | Ga0207705_101504162 | 253 |
| 221 | 3300025917 | Ga0207660_10001739 | Ga0207660_100017393 | 253 |
| 222 | 3300025917 | Ga0207660_10002691 | Ga0207660_100026918 | 253 |
| 223 | 3300025919 | Ga0207657_10214292 | Ga0207657_102142922 | 253 |
| 224 | 3300025921 | Ga0207652_10014890 | Ga0207652_100148904 | 253 |
| 225 | 3300025921 | Ga0207652_10186599 | Ga0207652_101865992 | 253 |
| 226 | 3300025926 | Ga0207659_10236940 | Ga0207659_102369402 | 253 |
| 227 | 3300025932 | Ga0207690_10044149 | Ga0207690_100441493 | 253 |
| 228 | 3300025944 | Ga0207661_10114602 | Ga0207661_101146022 | 253 |
| 229 | 3300025944 | Ga0207661_10166378 | Ga0207661_101663782 | 253 |
| 230 | 3300026067 | Ga0207678_10111522 | Ga0207678_101115221 | 253 |
| 231 | 3300026116 | Ga0207674_10000655 | Ga0207674_1000065511 | 253 |
| 232 | 3300026142 | Ga0207698_10000577 | Ga0207698_1000057715 | 253 |
| 233 | 3300037312 | Ga0395899_0025632 | Ga0395899_0025632_2802_3674 | 253 |
| 234 | 3300037312 | Ga0395899_0032761 | Ga0395899_0032761_1818_2681 | 253 |
| 235 | 3300037312 | Ga0395899_0056827 | Ga0395899_0056827_305_1162 | 253 |
| 236 | 3300037312 | Ga0395899_0118139 | Ga0395899_0118139_686_1561 | 253 |
| 237 | 3300037312 | Ga0395899_0180675 | Ga0395899_0180675_497_1366 | 253 |
| 238 | 3300037418 | Ga0395900_0002159 | Ga0395900_0002159_5468_6343 | 253 |
| 239 | 3300037418 | Ga0395900_0011701 | Ga0395900_0011701_579_1436 | 253 |
| 240 | 3300037418 | Ga0395900_0052582 | Ga0395900_0052582_3154_4017 | 253 |
| 241 | 3300037418 | Ga0395900_0059441 | Ga0395900_0059441_1282_2157 | 253 |
| 242 | 3300037466 | Ga0395898_0050973 | Ga0395898_0050973_1490_2347 | 253 |
| 243 | 3300037471 | Ga0395905_0000606 | Ga0395905_0000606_33003_33860 | 253 |
| 244 | 3300037471 | Ga0395905_0025621 | Ga0395905_0025621_4177_5037 | 253 |
| 245 | 3300037471 | Ga0395905_0045146 | Ga0395905_0045146_1530_2387 | 253 |
| 246 | 3300037471 | Ga0395905_0046617 | Ga0395905_0046617_1883_2746 | 253 |
| 247 | 3300037471 | Ga0395905_0053281 | Ga0395905_0053281_673_1521 | 253 |
| 248 | 3300037471 | Ga0395905_0056503 | Ga0395905_0056503_2291_3148 | 253 |
| 249 | 3300037471 | Ga0395905_0091425 | Ga0395905_0091425_132_1004 | 253 |
| 250 | 3300037471 | Ga0395905_0194564 | Ga0395905_0194564_341_1216 | 253 |
| 251 | 3300038443 | Ga0395901_0000086 | Ga0395901_0000086_91772_92647 | 253 |
| 252 | 3300038443 | Ga0395901_0006736 | Ga0395901_0006736_3144_4001 | 253 |
| 253 | 3300038443 | Ga0395901_0057528 | Ga0395901_0057528_2711_3568 | 253 |
| 254 | 3300038443 | Ga0395901_0072973 | Ga0395901_0072973_341_1216 | 253 |
| 255 | 3300042157 | Ga0439458_0000578 | Ga0439458_0000578_3616_4473 | 253 |
| 256 | 3300044694 | Ga0466963_0067973 | Ga0466963_0067973_1044_1928 | 253 |
| 257 | 3300044842 | Ga0466957_0246722 | Ga0466957_0246722_219_1097 | 253 |
| 258 | 3300045049 | Ga0466959_0075937 | Ga0466959_0075937_582_1463 | 253 |
| 259 | 3300045836 | Ga0466958_0237372 | Ga0466958_0237372_33_914 | 253 |
| 260 | 3300045976 | Ga0466967_0018344 | Ga0466967_0018344_1863_2735 | 253 |
| 261 | 3300002741 | JGI25157J39369_1000445 | JGI25157J39369_10004458 | 255 |
| 262 | 3300005435 | Ga0070714_100017090 | Ga0070714_1000170902 | 255 |
| 263 | 3300005436 | Ga0070713_100004013 | Ga0070713_1000040132 | 255 |
| 264 | 3300014497 | Ga0182008_10009746 | Ga0182008_100097462 | 255 |
| 265 | 3300015262 | Ga0182007_10009620 | Ga0182007_100096202 | 255 |
| 266 | 3300025226 | Ga0209674_101628 | Ga0209674_1016283 | 255 |
| 267 | 3300025250 | Ga0209026_1000037 | Ga0209026_1000037235 | 255 |
| 268 | 3300025928 | Ga0207700_10002136 | Ga0207700_100021364 | 255 |
| 269 | 3300025929 | Ga0207664_10080302 | Ga0207664_100803022 | 255 |
| 270 | 3300002067 | JGI24735J21928_10002145 | JGI24735J21928_100021453 | 256 |
| 271 | 3300003756 | Ga0055533_1002646 | Ga0055533_10026462 | 256 |
| 272 | 3300025226 | Ga0209674_100063 | Ga0209674_100063208 | 256 |
| 273 | 3300025242 | Ga0209258_100649 | Ga0209258_1006492 | 256 |
| 274 | 3300025904 | Ga0207647_10066589 | Ga0207647_100665892 | 256 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2lra-assembly1.cif.gz_A | nmr structure of signal sequence deleted (ssd) rv0603 protein from mycobacterium tuberculosis without n-terminal his-tag | 0.7433 | 132 | 179 |
| 2v6v-assembly1.cif.gz_A | the structure of the bem1p px domain | 0.7134 | 134 | 168 |
| 2v6v-assembly2.cif.gz_B | the structure of the bem1p px domain | 0.7085 | 134 | 168 |
| 2czo-assembly1.cif.gz_A | solution structure of the px domain of bem1p | 0.7049 | 134 | 168 |
| 6zz4-assembly1.cif.gz_B | crystal structure of the ptpn2 c216g mutant | 0.671 | 129 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gu3A02 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8215 | 136 | 177 | 3.10.450.40 |
| af_A0A1D8PDU5_148_320_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.7543 | 134 | 164 | 3.30.1520.10 |
| af_Q9NG60_1_185_3.10.400.20 | Alpha Beta;Roll;Sulfate adenylyltransferase; | 0.7541 | 146 | 178 | 3.10.400.20 |
| af_Q6AVW0_13_153_3.40.420.10 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.7472 | 131 | 175 | 3.40.420.10 |
| 2lraA00 | Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein; | 0.7433 | 132 | 179 | 3.30.505.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6B2T1-F1-model_v4 | Outer membrane lipoprotein-sorting protein | 0.9566 | 81 | 242 |
|
| AF-A0A524JSD8-F1-model_v4 | Outer membrane lipoprotein-sorting protein | 0.955 | 22 | 241 |
|
| AF-A0A7C1IAK3-F1-model_v4 | Outer membrane lipoprotein-sorting protein | 0.9495 | 25 | 242 |
GO:0016020
|
| AF-A0A7V8RBW6-F1-model_v4 | Outer membrane lipoprotein-sorting protein | 0.9421 | 21 | 250 |
|
| AF-A0A0K8QM02-F1-model_v4 | Putative signal peptide protein | 0.9406 | 12 | 248 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar