F379519

General Info

Members Datasets Scaffolds Average Seq Length
274 153 548 235

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100026547|Ga0070675_1000265473
Length 263
Sequence VRTFLDGCALAGLHSLRSSAGVAVAVIFLSLAGPAGVRAQQRGGAAVRPARDAAPIDLTGYWVSYVTENWRYRMVTPAKGEYRRIPASPAALPLINAWDPAADERAGNQCRSFGAGAIMNVPGRLHITWQDDNTLRIDTDAGMQTRLFRFTSSASASTPPSWQGESLATWERATGPDGGGSLRVVTTNLRAGYLRKNGVPYSERTTMTEHFDITTLPDGSRVLLVTTIIEDPVYLTGPYVISPHFKQEPDESKWEPTPCSSTW

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.01
Rhizosphere 95.99
Stem 0
Stem Tuber 0
Unclassified 28.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100026547 3300005354 Bacteria 4649
2 JGI25406J46586_10002182 3300003203 Bacteria 9236
3 Ga0070676_10173915 3300005328 Bacteria 1395
4 Ga0070683_100264600 3300005329 Bacteria 1636
5 Ga0070690_100058274 3300005330 Bacteria 2480
6 Ga0070670_100003610 3300005331 Bacteria 12874
7 Ga0070670_100043707 3300005331 Unclassified 3851
8 Ga0068869_100284822 3300005334 Bacteria 1330
9 Ga0070666_10012475 3300005335 Bacteria 5361
10 Ga0068868_100044585 3300005338 Unclassified 3467
11 Ga0068868_100066455 3300005338 Unclassified 2866
12 Ga0070689_100059744 3300005340 Bacteria 2963
13 Ga0070689_100106245 3300005340 Bacteria 2227
14 Ga0070689_100420158 3300005340 Bacteria 1133
15 Ga0070669_100470857 3300005353 Bacteria 1038
16 Ga0070675_100000064 3300005354 Bacteria 62850
17 Ga0070675_100000754 3300005354 Bacteria 22571
18 Ga0070675_100019974 3300005354 Bacteria 5345
19 Ga0070675_100264192 3300005354 Unclassified 1509
20 Ga0070671_100011091 3300005355 Bacteria 7236
21 Ga0070671_100110330 3300005355 Bacteria 2310
22 Ga0070671_100132763 3300005355 Bacteria 2097
23 Ga0070671_100555226 3300005355 Unclassified 990
24 Ga0070673_100033515 3300005364 Bacteria 3880
25 Ga0070673_100058576 3300005364 Bacteria 3046
26 Ga0070673_100359210 3300005364 Bacteria 1294
27 Ga0070688_100038588 3300005365 Unclassified 2918
28 Ga0070688_100075028 3300005365 Bacteria 2173
29 Ga0070688_100124476 3300005365 Unclassified 1731
30 Ga0070667_100053299 3300005367 Plasmid 3413
31 Ga0070667_100226393 3300005367 Unclassified 1666
32 Ga0070713_100334946 3300005436 Bacteria 1401
33 Ga0070678_100075878 3300005456 Bacteria 2530
34 Ga0070678_100101176 3300005456 Unclassified 2234
35 Ga0068867_100887091 3300005459 Bacteria 802
36 Ga0070707_100301031 3300005468 Bacteria 1558
37 Ga0070698_100451101 3300005471 Bacteria 1222
38 Ga0070699_100153415 3300005518 Bacteria 2038
39 Ga0070697_100329182 3300005536 Bacteria 1317
40 Ga0070672_100008305 3300005543 Bacteria 7094
41 Ga0070672_100020163 3300005543 Bacteria 4858
42 Ga0070672_100104390 3300005543 Unclassified 2303
43 Ga0070686_100169131 3300005544 Unclassified 1545
44 Ga0070686_100177027 3300005544 Bacteria 1513
45 Ga0070686_100402889 3300005544 Unclassified 1041
46 Ga0070665_100155138 3300005548 Unclassified 2291
47 Ga0070664_100003510 3300005564 Bacteria 12662
48 Ga0070664_100015465 3300005564 Bacteria 6242
49 Ga0068857_100852289 3300005577 Unclassified 872
50 Ga0068859_100014204 3300005617 Bacteria 7985
51 Ga0068859_100233536 3300005617 Bacteria 1928
52 Ga0068864_100037231 3300005618 Bacteria 4151
53 Ga0068861_100106760 3300005719 Bacteria 2237
54 Ga0068861_100320095 3300005719 Bacteria 1350
55 Ga0068870_10093526 3300005840 Bacteria 1686
56 Ga0068870_10305318 3300005840 Unclassified 1006
57 Ga0068863_100001761 3300005841 Bacteria 21473
58 Ga0068863_100049236 3300005841 Bacteria 3995
59 Ga0068863_100294937 3300005841 Unclassified 1572
60 Ga0068863_100826033 3300005841 Unclassified 925
61 Ga0068858_100015896 3300005842 Bacteria 7072
62 Ga0068858_100085915 3300005842 Unclassified 2927
63 Ga0068858_100139938 3300005842 Unclassified 2271
64 Ga0068858_100494170 3300005842 Bacteria 1182
65 Ga0068860_100001473 3300005843 Bacteria 25423
66 Ga0068862_100117468 3300005844 Bacteria 2341
67 Ga0068862_100173078 3300005844 Unclassified 1934
68 Ga0081540_1150060 3300005983 Bacteria 921
69 Ga0070717_10068013 3300006028 Bacteria 2965
70 Ga0097621_100061641 3300006237 Bacteria 3077
71 Ga0097621_100102545 3300006237 Bacteria 2409
72 Ga0097621_100203766 3300006237 Bacteria 1719
73 Ga0068871_100001774 3300006358 Bacteria 14525
74 Ga0068871_100323092 3300006358 Unclassified 1359
75 Ga0075428_100153092 3300006844 Unclassified 2505
76 Ga0075428_100203877 3300006844 Bacteria 2138
77 Ga0075430_100027651 3300006846 Unclassified 4818
78 Ga0075430_100149636 3300006846 Bacteria 1944
79 Ga0075433_10001800 3300006852 Bacteria 16071
80 Ga0075429_100360170 3300006880 Bacteria 1274
81 Ga0068865_100001959 3300006881 Bacteria 12145
82 Ga0068865_100020228 3300006881 Bacteria 4316
83 Ga0097620_100014204 3300006931 Bacteria 7985
84 Ga0097620_100233542 3300006931 Bacteria 1928
85 Ga0075435_100147896 3300007076 Bacteria 1974
86 Ga0111539_10002471 3300009094 Bacteria 24529
87 Ga0105245_10070292 3300009098 Unclassified 3176
88 Ga0105245_11221088 3300009098 Bacteria 800
89 Ga0105247_10023983 3300009101 Unclassified 3675
90 Ga0114129_10132719 3300009147 Bacteria 3419
91 Ga0114129_10807301 3300009147 Bacteria 1196
92 Ga0114129_10865926 3300009147 Bacteria 1147
93 Ga0105243_10268900 3300009148 Bacteria 1529
94 Ga0105242_10042662 3300009176 Unclassified 3665
95 Ga0105242_10483578 3300009176 Bacteria 1174
96 Ga0105248_10000363 3300009177 Bacteria 52947
97 Ga0105248_10026048 3300009177 Bacteria 6506
98 Ga0105248_10099936 3300009177 Bacteria 3269
99 Ga0105238_10050731 3300009551 Unclassified 4176
100 Ga0157378_10033157 3300013297 Unclassified 4564
101 Ga0157378_10042101 3300013297 Bacteria 4052
102 Ga0157378_10073461 3300013297 Bacteria 3075
103 Ga0163162_10010958 3300013306 Bacteria 8830
104 Ga0163162_10078920 3300013306 Bacteria 3358
105 Ga0163162_10122607 3300013306 Unclassified 2704
106 Ga0157375_10002852 3300013308 Bacteria 14967
107 Ga0157375_10343916 3300013308 Unclassified 1657
108 Ga0157375_10430846 3300013308 Bacteria 1485
109 Ga0163163_10001088 3300014325 Bacteria 23052
110 Ga0163163_10006039 3300014325 Bacteria 10535
111 Ga0163163_10059060 3300014325 Unclassified 3793
112 Ga0157380_10962892 3300014326 Unclassified 884
113 Ga0157380_11029152 3300014326 Unclassified 859
114 Ga0157377_10040432 3300014745 Unclassified 2582
115 Ga0157379_10000421 3300014968 Bacteria 34236
116 Ga0157379_10011968 3300014968 Bacteria 7580
117 Ga0157379_10034071 3300014968 Unclassified 4539
118 Ga0157376_10098614 3300014969 Bacteria 2548
119 Ga0157376_10108305 3300014969 Bacteria 2441
120 Ga0157376_10110607 3300014969 Unclassified 2417
121 Ga0163161_10134566 3300017792 Bacteria 1867
122 Ga0163161_10146638 3300017792 Unclassified 1791
123 Ga0207643_10138293 3300025908 Unclassified 1453
124 Ga0207643_10281861 3300025908 Bacteria 1031
125 Ga0207649_10056186 3300025920 Bacteria 2457
126 Ga0207646_10003656 3300025922 Bacteria 17192
127 Ga0207681_10387939 3300025923 Bacteria 1125
128 Ga0207694_10342034 3300025924 Bacteria 1237
129 Ga0207650_10017909 3300025925 Bacteria 4964
130 Ga0207650_10139829 3300025925 Bacteria 1902
131 Ga0207650_10199219 3300025925 Bacteria 1603
132 Ga0207659_10000670 3300025926 Bacteria 20261
133 Ga0207659_10015447 3300025926 Bacteria 4948
134 Ga0207659_10022070 3300025926 Unclassified 4235
135 Ga0207659_10038290 3300025926 Unclassified 3334
136 Ga0207659_10271368 3300025926 Unclassified 1384
137 Ga0207687_10095530 3300025927 Unclassified 2177
138 Ga0207687_10391091 3300025927 Bacteria 1141
139 Ga0207700_10028035 3300025928 Bacteria 3952
140 Ga0207644_10058170 3300025931 Bacteria 2793
141 Ga0207644_10108858 3300025931 Bacteria 2092
142 Ga0207686_10182800 3300025934 Unclassified 1488
143 Ga0207670_10055895 3300025936 Bacteria 2669
144 Ga0207670_10330390 3300025936 Bacteria 1202
145 Ga0207670_10358559 3300025936 Bacteria 1156
146 Ga0207669_10273457 3300025937 Unclassified 1270
147 Ga0207704_10029259 3300025938 Unclassified 3068
148 Ga0207704_10140145 3300025938 Bacteria 1690
149 Ga0207691_10002704 3300025940 Bacteria 17330
150 Ga0207691_10064368 3300025940 Bacteria 3322
151 Ga0207691_10088573 3300025940 Bacteria 2776
152 Ga0207711_10023484 3300025941 Bacteria 5162
153 Ga0207711_10034887 3300025941 Bacteria 4261
154 Ga0207711_10324884 3300025941 Unclassified 1422
155 Ga0207711_10546430 3300025941 Bacteria 1080
156 Ga0207711_10561823 3300025941 Unclassified 1064
157 Ga0207689_10251569 3300025942 Unclassified 1461
158 Ga0207689_10287802 3300025942 Bacteria 1361
159 Ga0207679_10006787 3300025945 Bacteria 7253
160 Ga0207679_10086644 3300025945 Bacteria 2410
161 Ga0207651_10010659 3300025960 Bacteria 5105
162 Ga0207651_10055293 3300025960 Bacteria 2725
163 Ga0207658_10069815 3300025986 Unclassified 2656
164 Ga0207677_10251981 3300026023 Unclassified 1434
165 Ga0207703_10003184 3300026035 Bacteria 13810
166 Ga0207703_10059842 3300026035 Bacteria 3112
167 Ga0207703_10148727 3300026035 Unclassified 2040
168 Ga0207703_10182276 3300026035 Unclassified 1854
169 Ga0207641_10000514 3300026088 Bacteria 43419
170 Ga0207641_10272451 3300026088 Unclassified 1589
171 Ga0207641_10477001 3300026088 Unclassified 1209
172 Ga0207648_10013535 3300026089 Bacteria 7585
173 Ga0207648_10298682 3300026089 Bacteria 1444
174 Ga0207676_10048151 3300026095 Bacteria 3308
175 Ga0207676_10080684 3300026095 Unclassified 2641
176 Ga0207676_10285744 3300026095 Bacteria 1500
177 Ga0207675_100309881 3300026118 Bacteria 1539
178 Ga0207675_100337297 3300026118 Bacteria 1475
179 Ga0207683_10131237 3300026121 Archaea 2254
180 Ga0207698_10919745 3300026142 Unclassified 883
181 Ga0207428_10006404 3300027907 Bacteria 10877
182 Ga0207428_10358800 3300027907 Bacteria 1071
183 Ga0268264_10002843 3300028381 Bacteria 15098
184 Ga0268264_10214185 3300028381 Bacteria 1770
185 Ga0268264_10409164 3300028381 Bacteria 1306
186 Ga0268264_10563654 3300028381 Bacteria 1119
187 Ga0268264_10751153 3300028381 Unclassified 972
188 Ga0373923_0050845 3300035111 Bacteria 1737
189 Ga0373923_0053406 3300035111 Unclassified 1699
190 Ga0373936_0050251 3300035113 Bacteria 1686
191 Ga0373953_0026914 3300035117 Unclassified 2206
192 Ga0373953_0125238 3300035117 Bacteria 1093
193 Ga0373956_0180353 3300035119 Unclassified 998
194 Ga0373956_0262068 3300035119 Bacteria 822
195 Ga0373957_0010389 3300035120 Bacteria 3077
196 Ga0373943_0160073 3300035170 Bacteria 1225
197 Ga0373955_0003056 3300035172 Bacteria 7329
198 Ga0373924_0003600 3300035410 Bacteria 5343
199 Ga0373924_0028504 3300035410 Unclassified 2226
200 Ga0373931_0335966 3300035691 Bacteria 942
201 Ga0373927_0157594 3300035695 Bacteria 1487
202 Ga0373933_0203177 3300035724 Unclassified 1268
203 Ga0373947_0002602 3300035725 Bacteria 10833
204 Ga0373937_0246424 3300036401 Unclassified 1684
205 Ga0373937_0401039 3300036401 Bacteria 1301
206 Ga0373937_0487864 3300036401 Unclassified 1170
207 Ga0373937_0673030 3300036401 Bacteria 981
208 Ga0373937_0803823 3300036401 Bacteria 888
209 Ga0373937_1039636 3300036401 Bacteria 768
210 Ga0373937_1179477 3300036401 Unclassified 714
211 Ga0373925_0060703 3300037068 Bacteria 2839
212 Ga0242420_020864 3300038996 Bacteria 1169
213 Ga0436360_1034560 3300039438 Unclassified 1540
214 Ga0451807_2635135 3300041486 Unclassified 1552
215 Ga0495603_0142302 3300046455 Bacteria 1395
216 Ga0495629_0278540 3300046459 Bacteria 1148
217 Ga0495580_0062526 3300046472 Bacteria 2612
218 Ga0495580_0535968 3300046472 Bacteria 779
219 Ga0495582_0086086 3300046473 Bacteria 1749
220 Ga0495639_0025083 3300046475 Bacteria 2628
221 Ga0495594_0453146 3300046499 Unclassified 729
222 Ga0495608_0002090 3300046511 Bacteria 14397
223 Ga0495608_0027533 3300046511 Bacteria 3868
224 Ga0495618_0226547 3300046514 Unclassified 1178
225 Ga0495618_0381454 3300046514 Unclassified 865
226 Ga0495628_0119205 3300046516 Bacteria 2025
227 Ga0495630_0014098 3300046517 Bacteria 5817
228 Ga0495630_0120602 3300046517 Unclassified 1989
229 Ga0495586_0044507 3300046535 Bacteria 2392
230 Ga0495587_0026341 3300046536 Bacteria 3547
231 Ga0495645_0114002 3300046543 Bacteria 1910
232 Ga0495667_0119464 3300046559 Unclassified 1702
233 Ga0495657_0155161 3300046675 Unclassified 1419
234 Ga0495657_0210578 3300046675 Bacteria 1182
235 Ga0495669_0009915 3300046684 Bacteria 4027
236 Ga0495613_0000397 3300046689 Bacteria 37243
237 Ga0495600_0047884 3300046809 Bacteria 2789
238 Ga0495581_0033732 3300047315 Bacteria 2963
239 Ga0495581_0056448 3300047315 Bacteria 2267
240 Ga0495604_0022208 3300047317 Bacteria 5065
241 Ga0495604_0419453 3300047317 Unclassified 879
242 Ga0495636_0121129 3300047318 Bacteria 1157
243 Ga0495674_0044358 3300047319 Bacteria 3954
244 Ga0495674_0103224 3300047319 Bacteria 2424
245 Ga0495675_0192804 3300047444 Unclassified 1243
246 Ga0495684_0005089 3300047471 Bacteria 10252
247 Ga0495684_0238651 3300047471 Bacteria 1327
248 Ga0496100_0056818 3300048903 Bacteria 2561
249 Ga0496101_0000914 3300048904 Bacteria 17411
250 Ga0496102_0316200 3300048905 Bacteria 1471
251 Ga0496104_0118152 3300048907 Bacteria 2545
252 Ga0496105_0154487 3300048908 Bacteria 1885
253 Ga0496107_0126946 3300048910 Unclassified 1882
254 Ga0496108_0188526 3300048911 Bacteria 1787
255 Ga0496108_0388178 3300048911 Bacteria 1219
256 Ga0496114_0001793 3300048917 Bacteria 16294
257 Ga0496115_0168371 3300048918 Bacteria 1812
258 Ga0501033_0332086 3300049570 Unclassified 1067
259 Ga0501075_0144869 3300049591 Unclassified 1811
260 nmdc:mga05p37_1508_c1 3300050507 Bacteria 27058
261 nmdc:mga05p37_185616_c1 3300050507 Bacteria 2528
262 nmdc:mga05p37_252834_c1 3300050507 Bacteria 2113
263 nmdc:mga05p37_441406_c1 3300050507 Bacteria 1509
264 nmdc:mga08y16_1001_c1 3300050511 Bacteria 27600
265 nmdc:mga08y16_145101_c1 3300050511 Bacteria 2467
266 nmdc:mga08y16_177397_c1 3300050511 Bacteria 2212
267 nmdc:mga0n895_328667_c1 3300050512 Bacteria 1549
268 nmdc:mga0rr50_78230_c1 3300050513 Bacteria 2544
269 nmdc:mga0a205_50282_c1 3300050515 Bacteria 4024
270 nmdc:mga0a205_991_c1 3300050515 Bacteria 23516
271 Ga0495601_0004158 3300053077 Bacteria 8343
272 Ga0495595_0062441 3300053084 Bacteria 1747
273 Ga0495619_0002209 3300053085 Bacteria 12891
274 Ga0495619_0057543 3300053085 Bacteria 2580
275 Ga0070675_100026547
276 JGI25406J46586_10002182
277 Ga0070676_10173915
278 Ga0070683_100264600
279 Ga0070690_100058274
280 Ga0070670_100003610
281 Ga0070670_100043707
282 Ga0068869_100284822
283 Ga0070666_10012475
284 Ga0068868_100044585
285 Ga0068868_100066455
286 Ga0070689_100059744
287 Ga0070689_100106245
288 Ga0070689_100420158
289 Ga0070669_100470857
290 Ga0070675_100000064
291 Ga0070675_100000754
292 Ga0070675_100019974
293 Ga0070675_100264192
294 Ga0070671_100011091
295 Ga0070671_100110330
296 Ga0070671_100132763
297 Ga0070671_100555226
298 Ga0070673_100033515
299 Ga0070673_100058576
300 Ga0070673_100359210
301 Ga0070688_100038588
302 Ga0070688_100075028
303 Ga0070688_100124476
304 Ga0070667_100053299
305 Ga0070667_100226393
306 Ga0070713_100334946
307 Ga0070678_100075878
308 Ga0070678_100101176
309 Ga0068867_100887091
310 Ga0070707_100301031
311 Ga0070698_100451101
312 Ga0070699_100153415
313 Ga0070697_100329182
314 Ga0070672_100008305
315 Ga0070672_100020163
316 Ga0070672_100104390
317 Ga0070686_100169131
318 Ga0070686_100177027
319 Ga0070686_100402889
320 Ga0070665_100155138
321 Ga0070664_100003510
322 Ga0070664_100015465
323 Ga0068857_100852289
324 Ga0068859_100014204
325 Ga0068859_100233536
326 Ga0068864_100037231
327 Ga0068861_100106760
328 Ga0068861_100320095
329 Ga0068870_10093526
330 Ga0068870_10305318
331 Ga0068863_100001761
332 Ga0068863_100049236
333 Ga0068863_100294937
334 Ga0068863_100826033
335 Ga0068858_100015896
336 Ga0068858_100085915
337 Ga0068858_100139938
338 Ga0068858_100494170
339 Ga0068860_100001473
340 Ga0068862_100117468
341 Ga0068862_100173078
342 Ga0081540_1150060
343 Ga0070717_10068013
344 Ga0097621_100061641
345 Ga0097621_100102545
346 Ga0097621_100203766
347 Ga0068871_100001774
348 Ga0068871_100323092
349 Ga0075428_100153092
350 Ga0075428_100203877
351 Ga0075430_100027651
352 Ga0075430_100149636
353 Ga0075433_10001800
354 Ga0075429_100360170
355 Ga0068865_100001959
356 Ga0068865_100020228
357 Ga0097620_100014204
358 Ga0097620_100233542
359 Ga0075435_100147896
360 Ga0111539_10002471
361 Ga0105245_10070292
362 Ga0105245_11221088
363 Ga0105247_10023983
364 Ga0114129_10132719
365 Ga0114129_10807301
366 Ga0114129_10865926
367 Ga0105243_10268900
368 Ga0105242_10042662
369 Ga0105242_10483578
370 Ga0105248_10000363
371 Ga0105248_10026048
372 Ga0105248_10099936
373 Ga0105238_10050731
374 Ga0157378_10033157
375 Ga0157378_10042101
376 Ga0157378_10073461
377 Ga0163162_10010958
378 Ga0163162_10078920
379 Ga0163162_10122607
380 Ga0157375_10002852
381 Ga0157375_10343916
382 Ga0157375_10430846
383 Ga0163163_10001088
384 Ga0163163_10006039
385 Ga0163163_10059060
386 Ga0157380_10962892
387 Ga0157380_11029152
388 Ga0157377_10040432
389 Ga0157379_10000421
390 Ga0157379_10011968
391 Ga0157379_10034071
392 Ga0157376_10098614
393 Ga0157376_10108305
394 Ga0157376_10110607
395 Ga0163161_10134566
396 Ga0163161_10146638
397 Ga0207643_10138293
398 Ga0207643_10281861
399 Ga0207649_10056186
400 Ga0207646_10003656
401 Ga0207681_10387939
402 Ga0207694_10342034
403 Ga0207650_10017909
404 Ga0207650_10139829
405 Ga0207650_10199219
406 Ga0207659_10000670
407 Ga0207659_10015447
408 Ga0207659_10022070
409 Ga0207659_10038290
410 Ga0207659_10271368
411 Ga0207687_10095530
412 Ga0207687_10391091
413 Ga0207700_10028035
414 Ga0207644_10058170
415 Ga0207644_10108858
416 Ga0207686_10182800
417 Ga0207670_10055895
418 Ga0207670_10330390
419 Ga0207670_10358559
420 Ga0207669_10273457
421 Ga0207704_10029259
422 Ga0207704_10140145
423 Ga0207691_10002704
424 Ga0207691_10064368
425 Ga0207691_10088573
426 Ga0207711_10023484
427 Ga0207711_10034887
428 Ga0207711_10324884
429 Ga0207711_10546430
430 Ga0207711_10561823
431 Ga0207689_10251569
432 Ga0207689_10287802
433 Ga0207679_10006787
434 Ga0207679_10086644
435 Ga0207651_10010659
436 Ga0207651_10055293
437 Ga0207658_10069815
438 Ga0207677_10251981
439 Ga0207703_10003184
440 Ga0207703_10059842
441 Ga0207703_10148727
442 Ga0207703_10182276
443 Ga0207641_10000514
444 Ga0207641_10272451
445 Ga0207641_10477001
446 Ga0207648_10013535
447 Ga0207648_10298682
448 Ga0207676_10048151
449 Ga0207676_10080684
450 Ga0207676_10285744
451 Ga0207675_100309881
452 Ga0207675_100337297
453 Ga0207683_10131237
454 Ga0207698_10919745
455 Ga0207428_10006404
456 Ga0207428_10358800
457 Ga0268264_10002843
458 Ga0268264_10214185
459 Ga0268264_10409164
460 Ga0268264_10563654
461 Ga0268264_10751153
462 Ga0373923_0050845
463 Ga0373923_0053406
464 Ga0373936_0050251
465 Ga0373953_0026914
466 Ga0373953_0125238
467 Ga0373956_0180353
468 Ga0373956_0262068
469 Ga0373957_0010389
470 Ga0373943_0160073
471 Ga0373955_0003056
472 Ga0373924_0003600
473 Ga0373924_0028504
474 Ga0373931_0335966
475 Ga0373927_0157594
476 Ga0373933_0203177
477 Ga0373947_0002602
478 Ga0373937_0246424
479 Ga0373937_0401039
480 Ga0373937_0487864
481 Ga0373937_0673030
482 Ga0373937_0803823
483 Ga0373937_1039636
484 Ga0373937_1179477
485 Ga0373925_0060703
486 Ga0242420_020864
487 Ga0436360_1034560
488 Ga0451807_2635135
489 Ga0495603_0142302
490 Ga0495629_0278540
491 Ga0495580_0062526
492 Ga0495580_0535968
493 Ga0495582_0086086
494 Ga0495639_0025083
495 Ga0495594_0453146
496 Ga0495608_0002090
497 Ga0495608_0027533
498 Ga0495618_0226547
499 Ga0495618_0381454
500 Ga0495628_0119205
501 Ga0495630_0014098
502 Ga0495630_0120602
503 Ga0495586_0044507
504 Ga0495587_0026341
505 Ga0495645_0114002
506 Ga0495667_0119464
507 Ga0495657_0155161
508 Ga0495657_0210578
509 Ga0495669_0009915
510 Ga0495613_0000397
511 Ga0495600_0047884
512 Ga0495581_0033732
513 Ga0495581_0056448
514 Ga0495604_0022208
515 Ga0495604_0419453
516 Ga0495636_0121129
517 Ga0495674_0044358
518 Ga0495674_0103224
519 Ga0495675_0192804
520 Ga0495684_0005089
521 Ga0495684_0238651
522 Ga0496100_0056818
523 Ga0496101_0000914
524 Ga0496102_0316200
525 Ga0496104_0118152
526 Ga0496105_0154487
527 Ga0496107_0126946
528 Ga0496108_0188526
529 Ga0496108_0388178
530 Ga0496114_0001793
531 Ga0496115_0168371
532 Ga0501033_0332086
533 Ga0501075_0144869
534 nmdc:mga05p37_1508_c1
535 nmdc:mga05p37_185616_c1
536 nmdc:mga05p37_252834_c1
537 nmdc:mga05p37_441406_c1
538 nmdc:mga08y16_1001_c1
539 nmdc:mga08y16_145101_c1
540 nmdc:mga08y16_177397_c1
541 nmdc:mga0n895_328667_c1
542 nmdc:mga0rr50_78230_c1
543 nmdc:mga0a205_50282_c1
544 nmdc:mga0a205_991_c1
545 Ga0495601_0004158
546 Ga0495595_0062441
547 Ga0495619_0002209
548 Ga0495619_0057543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n8b-assembly1.cif.gz_B crystal structure of borrelia burgdorferi pur-alpha 0.7736 207 246
5dac-assembly1.cif.gz_B atp-gamma-s bound rad50 from chaetomium thermophilum in complex with dna 0.6092 196 253
2zxk-assembly1.cif.gz_A crystal structure of semet-red chlorophyll catabolite reductase 0.6079 169 248
3nm7-assembly2.cif.gz_D crystal structure of borrelia burgdorferi pur-alpha 0.5982 207 242
3nm7-assembly1.cif.gz_A crystal structure of borrelia burgdorferi pur-alpha 0.5972 207 242
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.7818 219 247 3.90.950.10
af_A0A0R0JBA0_1_358_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7708 207 247 3.30.420.10
af_F4IKA7_6_81_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.7382 207 252 3.30.310.10
af_K7UFB2_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7207 205 256 3.40.50.300
af_P12753_3_298_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6956 194 257 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y4U586-F1-model_v4 SMC family ATPase 0.7725 207 261 GO:0006302
GO:0016887
AF-A0A2V8NV67-F1-model_v4 Uncharacterized protein 0.7285 118 259
AF-A0A2V8JDC4-F1-model_v4 Uncharacterized protein 0.7239 124 260
AF-A0A1Q7GHW5-F1-model_v4 Uncharacterized protein 0.7187 194 260
AF-A0A2V8L0G4-F1-model_v4 Uncharacterized protein 0.7183 185 260

Map