F378895

General Info

Members Datasets Scaffolds Average Seq Length
273 162 546 226

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100078369|Ga0070706_1000783692
Length 254
Sequence MASDSTKETGIRAPHETKATGWVPDAQPGSAGGVAAAAVLVSWSGGKDSCVALYEIQQSLDYRVAALLTTVTRDYDRISMHGVRRVLLEKQAASVGLPLYQVFISKEATNEEYEMKMVEAFSVYREHGINSIVFGDLFLADIRTYRDEFLAKHNLRGIYPVWQRNTTEFIQEFIELGFKAVVTCVDSKALDQSFAGRIIDHAFLASLPANVDPCGENGEFHTFVYDGPNFAQPVEFSVGETISRDGFWFCDLVG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 2643221695 Lysobacter sp. Root494 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 0
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 18.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100078369 3300005467 Unclassified 3059
2 JGI25406J46586_10000199 3300003203 Bacteria 26554
3 Ga0065712_10004609 3300005290 Bacteria 5426
4 Ga0065715_10026677 3300005293 Bacteria 1206
5 Ga0070676_10094876 3300005328 Bacteria 1834
6 Ga0068869_100006674 3300005334 Bacteria 7330
7 Ga0070680_100323694 3300005336 Unclassified 1309
8 Ga0070689_100006857 3300005340 Bacteria 7924
9 Ga0070661_100506695 3300005344 Unclassified 967
10 Ga0070669_100025552 3300005353 Unclassified 4242
11 Ga0070675_100443442 3300005354 Unclassified 1163
12 Ga0070671_100251409 3300005355 Unclassified 1502
13 Ga0070673_100006048 3300005364 Bacteria 7837
14 Ga0070659_100031025 3300005366 Bacteria 4138
15 Ga0070703_10014680 3300005406 Bacteria 2234
16 Ga0070703_10083190 3300005406 Archaea 1095
17 Ga0070709_10001653 3300005434 Bacteria 12091
18 Ga0070713_100599669 3300005436 Bacteria 1046
19 Ga0070701_10212108 3300005438 Bacteria 1150
20 Ga0070711_100000063 3300005439 Bacteria 63948
21 Ga0070705_100017017 3300005440 Unclassified 3788
22 Ga0070705_100031205 3300005440 Unclassified 2949
23 Ga0070705_100506337 3300005440 Bacteria 917
24 Ga0070694_100003067 3300005444 Bacteria 9940
25 Ga0070694_100007052 3300005444 Bacteria 6838
26 Ga0070694_100194070 3300005444 Bacteria 1510
27 Ga0070708_100011834 3300005445 Bacteria 7101
28 Ga0070708_100091200 3300005445 Bacteria 2775
29 Ga0070708_100132872 3300005445 Bacteria 2304
30 Ga0070708_100243856 3300005445 Unclassified 1687
31 Ga0070708_100606215 3300005445 Bacteria 1032
32 Ga0070662_100218636 3300005457 Unclassified 1519
33 Ga0070662_100249010 3300005457 Bacteria 1428
34 Ga0070681_10149998 3300005458 Unclassified 2258
35 Ga0070706_100046996 3300005467 Bacteria 3983
36 Ga0070706_100126186 3300005467 Bacteria 2386
37 Ga0070707_100000093 3300005468 Bacteria 80391
38 Ga0070707_100024203 3300005468 Bacteria 5747
39 Ga0070707_100207736 3300005468 Bacteria 1909
40 Ga0070698_100000360 3300005471 Bacteria 47129
41 Ga0070698_100037311 3300005471 Bacteria 5011
42 Ga0070698_100045046 3300005471 Bacteria 4515
43 Ga0070698_100201177 3300005471 Bacteria 1928
44 Ga0070699_100005169 3300005518 Bacteria 11480
45 Ga0070699_100019237 3300005518 Bacteria 5877
46 Ga0070699_100041655 3300005518 Bacteria 3975
47 Ga0070699_100050071 3300005518 Bacteria 3616
48 Ga0070699_100098715 3300005518 Bacteria 2559
49 Ga0070679_100103277 3300005530 Unclassified 2836
50 Ga0070697_100013738 3300005536 Bacteria 6352
51 Ga0070697_100020572 3300005536 Bacteria 5222
52 Ga0070697_100157821 3300005536 Unclassified 1916
53 Ga0070697_100179106 3300005536 Bacteria 1796
54 Ga0070697_100211890 3300005536 Unclassified 1650
55 Ga0070697_100226221 3300005536 Bacteria 1595
56 Ga0070697_100379398 3300005536 Bacteria 1224
57 Ga0070672_100016193 3300005543 Bacteria 5333
58 Ga0070686_100125391 3300005544 Bacteria 1769
59 Ga0070695_100009469 3300005545 Bacteria 5802
60 Ga0070695_100064016 3300005545 Bacteria 2391
61 Ga0070695_100146080 3300005545 Bacteria 1645
62 Ga0070695_100531046 3300005545 Unclassified 914
63 Ga0070696_100061770 3300005546 Bacteria 2621
64 Ga0070696_100135622 3300005546 Bacteria 1794
65 Ga0070704_100022609 3300005549 Bacteria 4094
66 Ga0068855_100093226 3300005563 Unclassified 3473
67 Ga0068855_100319740 3300005563 Bacteria 1716
68 Ga0070664_100006631 3300005564 Bacteria 9335
69 Ga0068857_100007229 3300005577 Bacteria 9562
70 Ga0070702_100067817 3300005615 Bacteria 2097
71 Ga0070702_100177783 3300005615 Bacteria 1390
72 Ga0068859_100001869 3300005617 Bacteria 21435
73 Ga0068859_100245623 3300005617 Bacteria 1880
74 Ga0068864_100008026 3300005618 Bacteria 8709
75 Ga0068864_100009175 3300005618 Bacteria 8155
76 Ga0068864_100276019 3300005618 Bacteria 1567
77 Ga0068864_100314334 3300005618 Unclassified 1469
78 Ga0068870_10035339 3300005840 Bacteria 2563
79 Ga0068863_100027830 3300005841 Bacteria 5396
80 Ga0068860_100355645 3300005843 Bacteria 1442
81 Ga0068862_100035489 3300005844 Unclassified 4223
82 Ga0068862_100043402 3300005844 Bacteria 3833
83 Ga0081455_10001626 3300005937 Bacteria 27421
84 Ga0081540_1041984 3300005983 Bacteria 2364
85 Ga0081539_10000820 3300005985 Bacteria 60109
86 Ga0075364_10000094 3300006051 Bacteria 36136
87 Ga0070716_100002961 3300006173 Bacteria 7918
88 Ga0068871_100025390 3300006358 Bacteria 4610
89 Ga0075431_100359551 3300006847 Unclassified 1462
90 Ga0075433_10000099 3300006852 Bacteria 41634
91 Ga0075433_10010226 3300006852 Bacteria 7524
92 Ga0075433_10107736 3300006852 Bacteria 2471
93 Ga0075433_10531253 3300006852 Bacteria 1034
94 Ga0075433_11010653 3300006852 Unclassified 724
95 Ga0075434_100004284 3300006871 Bacteria 12811
96 Ga0075434_100054086 3300006871 Bacteria 3988
97 Ga0075434_100110977 3300006871 Bacteria 2753
98 Ga0075434_100176649 3300006871 Bacteria 2155
99 Ga0075434_100185962 3300006871 Unclassified 2098
100 Ga0075434_100324306 3300006871 Bacteria 1560
101 Ga0075434_100673410 3300006871 Bacteria 1052
102 Ga0075429_100114348 3300006880 Bacteria 2359
103 Ga0068865_100365081 3300006881 Bacteria 1173
104 Ga0075436_100002701 3300006914 Bacteria 12202
105 Ga0075436_100003969 3300006914 Bacteria 10143
106 Ga0075436_100007570 3300006914 Bacteria 7418
107 Ga0075436_100012966 3300006914 Bacteria 5714
108 Ga0097620_100001869 3300006931 Bacteria 21435
109 Ga0097620_100245622 3300006931 Bacteria 1880
110 Ga0075435_100098813 3300007076 Unclassified 2416
111 Ga0075435_100232273 3300007076 Bacteria 1567
112 Ga0075435_100300436 3300007076 Unclassified 1373
113 Ga0099794_10003461 3300007265 Bacteria 6027
114 Ga0099794_10008173 3300007265 Bacteria 4336
115 Ga0105240_10657694 3300009093 Bacteria 1148
116 Ga0105245_10189997 3300009098 Bacteria 1967
117 Ga0105247_10240255 3300009101 Bacteria 1234
118 Ga0114129_10048035 3300009147 Bacteria 5997
119 Ga0114129_10052240 3300009147 Bacteria 5736
120 Ga0114129_10260615 3300009147 Unclassified 2324
121 Ga0105243_10112131 3300009148 Bacteria 2284
122 Ga0105242_10060146 3300009176 Unclassified 3120
123 Ga0105248_10062916 3300009177 Unclassified 4165
124 Ga0105248_10067929 3300009177 Unclassified 4002
125 Ga0105248_10376370 3300009177 Bacteria 1598
126 Ga0105249_10025073 3300009553 Bacteria 5366
127 Ga0105249_10331072 3300009553 Bacteria 1537
128 Ga0105249_10814227 3300009553 Bacteria 998
129 Ga0105249_10932804 3300009553 Bacteria 936
130 Ga0105239_10234105 3300010375 Bacteria 2061
131 Ga0105239_10385550 3300010375 Bacteria 1585
132 Ga0157373_10011134 3300013100 Bacteria 6618
133 Ga0157373_10297099 3300013100 Bacteria 1146
134 Ga0157374_10421899 3300013296 Bacteria 1333
135 Ga0157378_10621620 3300013297 Unclassified 1093
136 Ga0163162_10005068 3300013306 Bacteria 12694
137 Ga0163162_10039678 3300013306 Bacteria 4706
138 Ga0163162_10421028 3300013306 Bacteria 1468
139 Ga0157372_10350943 3300013307 Bacteria 1719
140 Ga0157372_10595018 3300013307 Bacteria 1289
141 Ga0157375_10149911 3300013308 Bacteria 2467
142 Ga0157375_10516243 3300013308 Unclassified 1358
143 Ga0163163_10013027 3300014325 Bacteria 7594
144 Ga0163163_10035669 3300014325 Bacteria 4826
145 Ga0163163_10037925 3300014325 Bacteria 4691
146 Ga0163163_10516749 3300014325 Unclassified 1256
147 Ga0157380_10692691 3300014326 Bacteria 1023
148 Ga0157380_11242613 3300014326 Bacteria 790
149 Ga0182008_10059510 3300014497 Bacteria 1885
150 Ga0157379_10156500 3300014968 Bacteria 2056
151 Ga0157379_10355594 3300014968 Bacteria 1342
152 Ga0157376_10011909 3300014969 Bacteria 6432
153 Ga0163161_10023173 3300017792 Unclassified 4377
154 Ga0213876_10000024 3300021384 Bacteria 237488
155 Ga0207653_10001193 3300025885 Bacteria 8489
156 Ga0207643_10001018 3300025908 Bacteria 16661
157 Ga0207684_10012204 3300025910 Bacteria 7478
158 Ga0207684_10016960 3300025910 Bacteria 6256
159 Ga0207684_10032008 3300025910 Bacteria 4473
160 Ga0207684_10035830 3300025910 Bacteria 4212
161 Ga0207684_10214528 3300025910 Bacteria 1660
162 Ga0207684_10355781 3300025910 Bacteria 1260
163 Ga0207684_10882471 3300025910 Bacteria 753
164 Ga0207707_10214433 3300025912 Unclassified 1676
165 Ga0207695_10028051 3300025913 Bacteria 6252
166 Ga0207663_10000066 3300025916 Bacteria 51628
167 Ga0207662_10072417 3300025918 Unclassified 2088
168 Ga0207652_10525776 3300025921 Unclassified 1064
169 Ga0207646_10000177 3300025922 Bacteria 86754
170 Ga0207646_10001261 3300025922 Bacteria 31711
171 Ga0207646_10017718 3300025922 Bacteria 6654
172 Ga0207646_10019170 3300025922 Bacteria 6361
173 Ga0207646_10019366 3300025922 Bacteria 6326
174 Ga0207646_10048182 3300025922 Bacteria 3820
175 Ga0207646_10251315 3300025922 Bacteria 1597
176 Ga0207646_10657293 3300025922 Bacteria 939
177 Ga0207650_10021990 3300025925 Bacteria 4513
178 Ga0207700_10310183 3300025928 Bacteria 1365
179 Ga0207690_10163530 3300025932 Unclassified 1661
180 Ga0207706_10302618 3300025933 Unclassified 1393
181 Ga0207670_10000879 3300025936 Bacteria 15851
182 Ga0207665_10001549 3300025939 Bacteria 15468
183 Ga0207691_10012596 3300025940 Bacteria 8107
184 Ga0207711_10058888 3300025941 Unclassified 3307
185 Ga0207711_10766384 3300025941 Unclassified 899
186 Ga0207689_10020149 3300025942 Bacteria 5618
187 Ga0207689_10617359 3300025942 Unclassified 913
188 Ga0207651_10012927 3300025960 Bacteria 4750
189 Ga0207712_10084831 3300025961 Bacteria 2316
190 Ga0207658_10377287 3300025986 Bacteria 1241
191 Ga0207708_10000145 3300026075 Bacteria 56405
192 Ga0207676_10009711 3300026095 Bacteria 6841
193 Ga0207676_10293942 3300026095 Bacteria 1480
194 Ga0207674_10013009 3300026116 Bacteria 9272
195 Ga0207675_100026498 3300026118 Bacteria 5397
196 Ga0207683_10033710 3300026121 Bacteria 4449
197 Ga0209588_1013005 3300027671 Bacteria 2534
198 Ga0268266_10056019 3300028379 Bacteria 3391
199 Ga0268264_10460288 3300028381 Bacteria 1234
200 Ga0265319_1003625 3300028563 Bacteria 7988
201 Ga0265334_10059631 3300028573 Bacteria 1442
202 Ga0265318_10000719 3300028577 Bacteria 22221
203 Ga0265323_10018133 3300028653 Bacteria 2728
204 Ga0265322_10002033 3300028654 Bacteria 6377
205 Ga0265332_10004873 3300031238 Bacteria 6241
206 Ga0265332_10016793 3300031238 Bacteria 3229
207 Ga0265328_10024074 3300031239 Unclassified 2303
208 Ga0265320_10000609 3300031240 Bacteria 27424
209 Ga0265325_10016124 3300031241 Unclassified 4181
210 Ga0265329_10000269 3300031242 Bacteria 27442
211 Ga0265329_10029384 3300031242 Unclassified 1796
212 Ga0265340_10000857 3300031247 Bacteria 17288
213 Ga0265331_10000745 3300031250 Bacteria 27434
214 Ga0265316_10001438 3300031344 Bacteria 25622
215 Ga0265316_10005642 3300031344 Bacteria 12115
216 Ga0265313_10001696 3300031595 Bacteria 20320
217 Ga0265314_10006124 3300031711 Bacteria 10687
218 Ga0265342_10000107 3300031712 Bacteria 92548
219 Ga0265342_10001605 3300031712 Bacteria 20863
220 Ga0307413_10532931 3300031824 Bacteria 949
221 Ga0307416_100138068 3300032002 Bacteria 2210
222 Ga0373936_0002108 3300035113 Bacteria 7393
223 Ga0436365_0861406 3300039437 Bacteria 61112
224 Ga0451577_0124055 3300042876 Bacteria 2314
225 Ga0451577_0532525 3300042876 Bacteria 1067
226 Ga0466972_0136876 3300044658 Bacteria 1153
227 Ga0453683_0000021 3300044673 Bacteria 284502
228 Ga0453683_0632084 3300044673 Bacteria 699
229 Ga0466963_0100165 3300044694 Bacteria 1983
230 Ga0453684_0046555 3300044712 Bacteria 5767
231 Ga0453684_0522822 3300044712 Bacteria 1311
232 Ga0453684_1105506 3300044712 Bacteria 837
233 Ga0466970_0010167 3300044765 Bacteria 4769
234 Ga0466959_0311669 3300045049 Unclassified 1077
235 Ga0451576_0018829 3300045051 Bacteria 7549
236 Ga0495605_0075094 3300046474 Bacteria 1590
237 Ga0495607_0118421 3300046501 Bacteria 1394
238 Ga0495656_0010004 3300046615 Bacteria 3432
239 Ga0495589_0030840 3300046794 Bacteria 2700
240 Ga0495636_0000842 3300047318 Bacteria 11314
241 Ga0495685_011258 3300047447 Bacteria 3015
242 Ga0501033_0172739 3300049570 Unclassified 1552
243 Ga0501037_0093766 3300049573 Bacteria 2171
244 Ga0501043_0118272 3300049579 Bacteria 2079
245 Ga0501046_0110855 3300049580 Bacteria 2096
246 Ga0501047_0087479 3300049581 Bacteria 2993
247 Ga0501077_0144721 3300049593 Bacteria 1508
248 Ga0501083_0053889 3300049744 Bacteria 2700
249 Ga0501035_0023396 3300049822 Bacteria 5667
250 Ga0501035_0639124 3300049822 Bacteria 864
251 Ga0501044_0102280 3300049823 Unclassified 2881
252 Ga0501044_0136922 3300049823 Bacteria 2440
253 Ga0501044_0337580 3300049823 Bacteria 1428
254 nmdc:mga05p37_165027_c2 3300050507 Unclassified 2340
255 nmdc:mga05p37_917988_c1 3300050507 Unclassified 942
256 nmdc:mga0n895_15672_c1 3300050512 Unclassified 2964
257 nmdc:mga0n895_23019_c1 3300050512 Bacteria 5850
258 nmdc:mga0n895_278959_c1 3300050512 Bacteria 1695
259 nmdc:mga0n895_492368_c1 3300050512 Bacteria 1236
260 nmdc:mga0n895_82413_c1 3300050512 Unclassified 3207
261 nmdc:mga0rr50_247780_c1 3300050513 Bacteria 1478
262 nmdc:mga0rr50_2642_c1 3300050513 Bacteria 10148
263 nmdc:mga0rr50_51329_c1 3300050513 Bacteria 3059
264 nmdc:mga0rr50_98120_c1 3300050513 Bacteria 2296
265 nmdc:mga08x19_74591_c1 3300050514 Unclassified 2217
266 nmdc:mga0a205_115946_c1 3300050515 Bacteria 2577
267 nmdc:mga0a205_20710_c1 3300050515 Bacteria 6211
268 nmdc:mga0a205_283070_c1 3300050515 Bacteria 1533
269 nmdc:mga0a205_511_c1 3300050515 Bacteria 30432
270 Ga0500616_0003910 3300053153 Bacteria 10955
271 Ga0501084_0214634 3300054114 Bacteria 1623
272 Ga0501082_0000554 3300060353 Bacteria 33234
273 2644530334 2643221695 Bacteria 3441323
274 Ga0070706_100078369
275 JGI25406J46586_10000199
276 Ga0065712_10004609
277 Ga0065715_10026677
278 Ga0070676_10094876
279 Ga0068869_100006674
280 Ga0070680_100323694
281 Ga0070689_100006857
282 Ga0070661_100506695
283 Ga0070669_100025552
284 Ga0070675_100443442
285 Ga0070671_100251409
286 Ga0070673_100006048
287 Ga0070659_100031025
288 Ga0070703_10014680
289 Ga0070703_10083190
290 Ga0070709_10001653
291 Ga0070713_100599669
292 Ga0070701_10212108
293 Ga0070711_100000063
294 Ga0070705_100017017
295 Ga0070705_100031205
296 Ga0070705_100506337
297 Ga0070694_100003067
298 Ga0070694_100007052
299 Ga0070694_100194070
300 Ga0070708_100011834
301 Ga0070708_100091200
302 Ga0070708_100132872
303 Ga0070708_100243856
304 Ga0070708_100606215
305 Ga0070662_100218636
306 Ga0070662_100249010
307 Ga0070681_10149998
308 Ga0070706_100046996
309 Ga0070706_100126186
310 Ga0070707_100000093
311 Ga0070707_100024203
312 Ga0070707_100207736
313 Ga0070698_100000360
314 Ga0070698_100037311
315 Ga0070698_100045046
316 Ga0070698_100201177
317 Ga0070699_100005169
318 Ga0070699_100019237
319 Ga0070699_100041655
320 Ga0070699_100050071
321 Ga0070699_100098715
322 Ga0070679_100103277
323 Ga0070697_100013738
324 Ga0070697_100020572
325 Ga0070697_100157821
326 Ga0070697_100179106
327 Ga0070697_100211890
328 Ga0070697_100226221
329 Ga0070697_100379398
330 Ga0070672_100016193
331 Ga0070686_100125391
332 Ga0070695_100009469
333 Ga0070695_100064016
334 Ga0070695_100146080
335 Ga0070695_100531046
336 Ga0070696_100061770
337 Ga0070696_100135622
338 Ga0070704_100022609
339 Ga0068855_100093226
340 Ga0068855_100319740
341 Ga0070664_100006631
342 Ga0068857_100007229
343 Ga0070702_100067817
344 Ga0070702_100177783
345 Ga0068859_100001869
346 Ga0068859_100245623
347 Ga0068864_100008026
348 Ga0068864_100009175
349 Ga0068864_100276019
350 Ga0068864_100314334
351 Ga0068870_10035339
352 Ga0068863_100027830
353 Ga0068860_100355645
354 Ga0068862_100035489
355 Ga0068862_100043402
356 Ga0081455_10001626
357 Ga0081540_1041984
358 Ga0081539_10000820
359 Ga0075364_10000094
360 Ga0070716_100002961
361 Ga0068871_100025390
362 Ga0075431_100359551
363 Ga0075433_10000099
364 Ga0075433_10010226
365 Ga0075433_10107736
366 Ga0075433_10531253
367 Ga0075433_11010653
368 Ga0075434_100004284
369 Ga0075434_100054086
370 Ga0075434_100110977
371 Ga0075434_100176649
372 Ga0075434_100185962
373 Ga0075434_100324306
374 Ga0075434_100673410
375 Ga0075429_100114348
376 Ga0068865_100365081
377 Ga0075436_100002701
378 Ga0075436_100003969
379 Ga0075436_100007570
380 Ga0075436_100012966
381 Ga0097620_100001869
382 Ga0097620_100245622
383 Ga0075435_100098813
384 Ga0075435_100232273
385 Ga0075435_100300436
386 Ga0099794_10003461
387 Ga0099794_10008173
388 Ga0105240_10657694
389 Ga0105245_10189997
390 Ga0105247_10240255
391 Ga0114129_10048035
392 Ga0114129_10052240
393 Ga0114129_10260615
394 Ga0105243_10112131
395 Ga0105242_10060146
396 Ga0105248_10062916
397 Ga0105248_10067929
398 Ga0105248_10376370
399 Ga0105249_10025073
400 Ga0105249_10331072
401 Ga0105249_10814227
402 Ga0105249_10932804
403 Ga0105239_10234105
404 Ga0105239_10385550
405 Ga0157373_10011134
406 Ga0157373_10297099
407 Ga0157374_10421899
408 Ga0157378_10621620
409 Ga0163162_10005068
410 Ga0163162_10039678
411 Ga0163162_10421028
412 Ga0157372_10350943
413 Ga0157372_10595018
414 Ga0157375_10149911
415 Ga0157375_10516243
416 Ga0163163_10013027
417 Ga0163163_10035669
418 Ga0163163_10037925
419 Ga0163163_10516749
420 Ga0157380_10692691
421 Ga0157380_11242613
422 Ga0182008_10059510
423 Ga0157379_10156500
424 Ga0157379_10355594
425 Ga0157376_10011909
426 Ga0163161_10023173
427 Ga0213876_10000024
428 Ga0207653_10001193
429 Ga0207643_10001018
430 Ga0207684_10012204
431 Ga0207684_10016960
432 Ga0207684_10032008
433 Ga0207684_10035830
434 Ga0207684_10214528
435 Ga0207684_10355781
436 Ga0207684_10882471
437 Ga0207707_10214433
438 Ga0207695_10028051
439 Ga0207663_10000066
440 Ga0207662_10072417
441 Ga0207652_10525776
442 Ga0207646_10000177
443 Ga0207646_10001261
444 Ga0207646_10017718
445 Ga0207646_10019170
446 Ga0207646_10019366
447 Ga0207646_10048182
448 Ga0207646_10251315
449 Ga0207646_10657293
450 Ga0207650_10021990
451 Ga0207700_10310183
452 Ga0207690_10163530
453 Ga0207706_10302618
454 Ga0207670_10000879
455 Ga0207665_10001549
456 Ga0207691_10012596
457 Ga0207711_10058888
458 Ga0207711_10766384
459 Ga0207689_10020149
460 Ga0207689_10617359
461 Ga0207651_10012927
462 Ga0207712_10084831
463 Ga0207658_10377287
464 Ga0207708_10000145
465 Ga0207676_10009711
466 Ga0207676_10293942
467 Ga0207674_10013009
468 Ga0207675_100026498
469 Ga0207683_10033710
470 Ga0209588_1013005
471 Ga0268266_10056019
472 Ga0268264_10460288
473 Ga0265319_1003625
474 Ga0265334_10059631
475 Ga0265318_10000719
476 Ga0265323_10018133
477 Ga0265322_10002033
478 Ga0265332_10004873
479 Ga0265332_10016793
480 Ga0265328_10024074
481 Ga0265320_10000609
482 Ga0265325_10016124
483 Ga0265329_10000269
484 Ga0265329_10029384
485 Ga0265340_10000857
486 Ga0265331_10000745
487 Ga0265316_10001438
488 Ga0265316_10005642
489 Ga0265313_10001696
490 Ga0265314_10006124
491 Ga0265342_10000107
492 Ga0265342_10001605
493 Ga0307413_10532931
494 Ga0307416_100138068
495 Ga0373936_0002108
496 Ga0436365_0861406
497 Ga0451577_0124055
498 Ga0451577_0532525
499 Ga0466972_0136876
500 Ga0453683_0000021
501 Ga0453683_0632084
502 Ga0466963_0100165
503 Ga0453684_0046555
504 Ga0453684_0522822
505 Ga0453684_1105506
506 Ga0466970_0010167
507 Ga0466959_0311669
508 Ga0451576_0018829
509 Ga0495605_0075094
510 Ga0495607_0118421
511 Ga0495656_0010004
512 Ga0495589_0030840
513 Ga0495636_0000842
514 Ga0495685_011258
515 Ga0501033_0172739
516 Ga0501037_0093766
517 Ga0501043_0118272
518 Ga0501046_0110855
519 Ga0501047_0087479
520 Ga0501077_0144721
521 Ga0501083_0053889
522 Ga0501035_0023396
523 Ga0501035_0639124
524 Ga0501044_0102280
525 Ga0501044_0136922
526 Ga0501044_0337580
527 nmdc:mga05p37_165027_c2
528 nmdc:mga05p37_917988_c1
529 nmdc:mga0n895_15672_c1
530 nmdc:mga0n895_23019_c1
531 nmdc:mga0n895_278959_c1
532 nmdc:mga0n895_492368_c1
533 nmdc:mga0n895_82413_c1
534 nmdc:mga0rr50_247780_c1
535 nmdc:mga0rr50_2642_c1
536 nmdc:mga0rr50_51329_c1
537 nmdc:mga0rr50_98120_c1
538 nmdc:mga08x19_74591_c1
539 nmdc:mga0a205_115946_c1
540 nmdc:mga0a205_20710_c1
541 nmdc:mga0a205_283070_c1
542 nmdc:mga0a205_511_c1
543 Ga0500616_0003910
544 Ga0501084_0214634
545 Ga0501082_0000554
546 2644530334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01902

Diphthami_syn_2

Diphthamide synthase

37

253

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rk1-assembly1.cif.gz_A 'x-ray crystal structure of the putative n-type atp pyrophosphatase (pf0828) in complex with atp from pyrococcus furiosus, northeast structural genomics consortium target pfr23 0.8318 2 215
2d13-assembly1.cif.gz_A crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8279 2 215
3rk1-assembly1.cif.gz_A 'x-ray crystal structure of the putative n-type atp pyrophosphatase (pf0828) in complex with atp from pyrococcus furiosus, northeast structural genomics consortium target pfr23 0.8245 2 215
2d13-assembly2.cif.gz_D crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8181 2 215
2d13-assembly1.cif.gz_C crystal structure of ph1257 from pyrococcus horikoshii ot3 0.8117 2 215
ID Description Score Start End Superfamily
2d13C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8508 2 124 3.40.50.620
2d13D02 Alpha Beta;Alpha-Beta Complex;putative n-type atp pyrophosphatase, domain 2;putative n-type atp pyrophosphatase, domain 2 0.8356 125 215 3.90.1490.10
af_Q12429_1_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8066 3 137 3.40.50.620
2d13C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7953 2 124 3.40.50.620
af_Q8I5J0_1_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7881 1 137 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A359CM52-F1-model_v4 ATP-binding protein 0.999 133 213 GO:0005524
AF-A0A5C7U765-F1-model_v4 deleted 0.9954 1 215
AF-A0A1F9Y264-F1-model_v4 Diphthamide synthase domain-containing protein 0.995 12 215
AF-A0A2V5X1M4-F1-model_v4 Diphthine--ammonia ligase 0.9949 2 215 GO:0016874
AF-A0A0S8HMJ5-F1-model_v4 ATP-binding protein 0.9943 2 215 GO:0005524

Map