F378101

General Info

Members Datasets Scaffolds Average Seq Length
272 160 272 116

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10113764|Ga0065715_101137643
Length 114
Sequence MTRENTSSTEYAEQLATQLRKGFLAYCVLKACSHKPKYTSDIITQLRDAELVVVEGTIYPLLSRLQKDGLLSHEWQESEQGPPRKYYKTTEFGNEVVEQTGEKIAELTATLKKL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
54 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
121 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
152 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
155 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
156 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
157 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.24
Nodule 0
Rhizoplane 1.84
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001357 3300001979 Bacteria 11170
2 JGI24739J22299_10001573 3300001989 Bacteria 8634
3 JGI24737J22298_10000814 3300001990 Bacteria 11066
4 JGI24743J22301_10016816 3300001991 Bacteria 1368
5 JGI24735J21928_10000026 3300002067 Bacteria 88519
6 JGI24735J21928_10000107 3300002067 Bacteria 30612
7 JGI24738J21930_10001247 3300002075 Bacteria 7156
8 rootH1_10150932 3300003316 Bacteria 1411
9 rootH2_10057059 3300003320 Bacteria 1599
10 Ga0065715_10113764 3300005293 Bacteria 2476
11 Ga0070658_10000035 3300005327 Bacteria 145828
12 Ga0070658_10002562 3300005327 Bacteria 15147
13 Ga0070683_100001508 3300005329 Bacteria 17978
14 Ga0070683_100699649 3300005329 Bacteria 971
15 Ga0070690_100000917 3300005330 Bacteria 15004
16 Ga0070680_100009912 3300005336 Bacteria 7336
17 Ga0070680_101083815 3300005336 Bacteria 692
18 Ga0070660_100000099 3300005339 Bacteria 52371
19 Ga0070660_100001520 3300005339 Bacteria 15911
20 Ga0070660_100026546 3300005339 Bacteria 4313
21 Ga0070660_100539655 3300005339 Bacteria 972
22 Ga0070691_10022285 3300005341 Unclassified 2938
23 Ga0070661_100004816 3300005344 Bacteria 9291
24 Ga0070675_100086683 3300005354 Bacteria 2617
25 Ga0070659_100004402 3300005366 Bacteria 10064
26 Ga0070659_100027403 3300005366 Bacteria 4390
27 Ga0070659_100249918 3300005366 Unclassified 1469
28 Ga0070659_101132460 3300005366 Bacteria 690
29 Ga0070667_100006003 3300005367 Bacteria 10094
30 Ga0070662_100090784 3300005457 Bacteria 2293
31 Ga0070685_10016708 3300005466 Unclassified 3914
32 Ga0070679_100000233 3300005530 Bacteria 45952
33 Ga0070679_100092321 3300005530 Unclassified 3015
34 Ga0070679_100328400 3300005530 Bacteria 1478
35 Ga0070679_100488683 3300005530 Unclassified 1175
36 Ga0070684_100000544 3300005535 Bacteria 25908
37 Ga0070686_100747103 3300005544 Unclassified 784
38 Ga0070665_101434537 3300005548 Bacteria 699
39 Ga0070665_102477874 3300005548 Bacteria 520
40 Ga0068855_100000136 3300005563 Bacteria 93608
41 Ga0068855_100852548 3300005563 Bacteria 965
42 Ga0068855_101249978 3300005563 Bacteria 770
43 Ga0068855_101456363 3300005563 Bacteria 704
44 Ga0068855_102355190 3300005563 Unclassified 532
45 Ga0070664_101696093 3300005564 Bacteria 599
46 Ga0068857_100000002 3300005577 Bacteria 241401
47 Ga0068857_102497664 3300005577 Bacteria 507
48 Ga0068857_102556545 3300005577 Unclassified 501
49 Ga0068859_100813082 3300005617 Bacteria 1022
50 Ga0068859_101200722 3300005617 Bacteria 835
51 Ga0068864_100986667 3300005618 Unclassified 835
52 Ga0068863_100090713 3300005841 Unclassified 2898
53 Ga0068858_100003279 3300005842 Bacteria 16119
54 Ga0068862_100213544 3300005844 Bacteria 1744
55 Ga0075365_10312537 3300006038 Unclassified 1106
56 Ga0075363_100531478 3300006048 Bacteria 700
57 Ga0075364_10007536 3300006051 Bacteria 6470
58 Ga0075364_10040858 3300006051 Unclassified 3009
59 Ga0075369_10099533 3300006186 Bacteria 1303
60 Ga0075366_10000943 3300006195 Bacteria 14152
61 Ga0075366_10116304 3300006195 Unclassified 1610
62 Ga0097621_100000009 3300006237 Bacteria 114089
63 Ga0097621_100301495 3300006237 Unclassified 1415
64 Ga0075370_10014998 3300006353 Unclassified 4141
65 Ga0075370_10055779 3300006353 Bacteria 2245
66 Ga0068871_100000232 3300006358 Bacteria 39467
67 Ga0068871_100147397 3300006358 Bacteria 2005
68 Ga0068871_100268378 3300006358 Bacteria 1490
69 Ga0097620_100813074 3300006931 Bacteria 1022
70 Ga0097620_101200935 3300006931 Bacteria 835
71 Ga0105240_10000003 3300009093 Bacteria 1183681
72 Ga0105240_10000004 3300009093 Bacteria 708156
73 Ga0105240_10048657 3300009093 Bacteria 5357
74 Ga0105240_10207222 3300009093 Bacteria 2294
75 Ga0105240_10641448 3300009093 Unclassified 1165
76 Ga0105245_10000002 3300009098 Bacteria 634374
77 Ga0105245_10000122 3300009098 Bacteria 75415
78 Ga0105245_10015278 3300009098 Bacteria 6690
79 Ga0105245_10021590 3300009098 Bacteria 5649
80 Ga0105247_10391983 3300009101 Bacteria 987
81 Ga0105243_10000001 3300009148 Bacteria 1156578
82 Ga0105241_10088299 3300009174 Bacteria 2441
83 Ga0105242_10000064 3300009176 Bacteria 74150
84 Ga0105242_11879962 3300009176 Bacteria 639
85 Ga0105248_10209593 3300009177 Bacteria 2195
86 Ga0105248_10715292 3300009177 Bacteria 1130
87 Ga0105248_10735353 3300009177 Bacteria 1113
88 Ga0105237_10000001 3300009545 Bacteria 1009213
89 Ga0105237_10006795 3300009545 Bacteria 12615
90 Ga0105238_10027520 3300009551 Bacteria 5795
91 Ga0105238_11025451 3300009551 Bacteria 846
92 Ga0105238_12883832 3300009551 Unclassified 517
93 Ga0105249_10366569 3300009553 Bacteria 1463
94 Ga0105032_102276 3300009979 Bacteria 1725
95 Ga0105028_100177 3300009993 Bacteria 6854
96 Ga0105239_10043331 3300010375 Bacteria 4932
97 Ga0105239_10923451 3300010375 Unclassified 1002
98 Ga0105239_11053335 3300010375 Unclassified 936
99 Ga0105239_11274733 3300010375 Bacteria 847
100 Ga0105239_11886523 3300010375 Unclassified 693
101 Ga0105246_10001117 3300011119 Bacteria 15600
102 Ga0105246_12094602 3300011119 Unclassified 548
103 Ga0157373_10025344 3300013100 Bacteria 4291
104 Ga0157373_10085227 3300013100 Bacteria 2227
105 Ga0157371_10006358 3300013102 Bacteria 9770
106 Ga0157370_10000924 3300013104 Bacteria 37267
107 Ga0157370_10001253 3300013104 Bacteria 31691
108 Ga0157369_10000444 3300013105 Bacteria 54827
109 Ga0157374_10000073 3300013296 Bacteria 100517
110 Ga0157374_10000501 3300013296 Bacteria 35418
111 Ga0157374_10000971 3300013296 Bacteria 24893
112 Ga0157374_10013818 3300013296 Bacteria 7053
113 Ga0157374_10634566 3300013296 Bacteria 1079
114 Ga0157374_11403014 3300013296 Bacteria 721
115 Ga0157378_10031715 3300013297 Unclassified 4668
116 Ga0157378_10186873 3300013297 Unclassified 1952
117 Ga0163162_11425007 3300013306 Unclassified 788
118 Ga0157372_10000002 3300013307 Bacteria 687862
119 Ga0157372_10084932 3300013307 Bacteria 3589
120 Ga0157372_10631239 3300013307 Bacteria 1248
121 Ga0157372_10771294 3300013307 Bacteria 1118
122 Ga0157372_11315799 3300013307 Unclassified 834
123 Ga0157372_12332915 3300013307 Bacteria 614
124 Ga0157372_13207084 3300013307 Unclassified 522
125 Ga0157375_11419106 3300013308 Bacteria 818
126 Ga0163163_10008799 3300014325 Bacteria 8986
127 Ga0163163_10142778 3300014325 Bacteria 2437
128 Ga0163163_10175038 3300014325 Bacteria 2192
129 Ga0157377_10000455 3300014745 Bacteria 17633
130 Ga0157376_10000001 3300014969 Bacteria 842910
131 Ga0157376_10895159 3300014969 Bacteria 905
132 Ga0157376_11051616 3300014969 Bacteria 838
133 Ga0207688_10260662 3300025901 Bacteria 1052
134 Ga0207647_10000315 3300025904 Bacteria 40274
135 Ga0207705_10000010 3300025909 Bacteria 518023
136 Ga0207705_10829880 3300025909 Unclassified 717
137 Ga0207654_10005195 3300025911 Bacteria 6570
138 Ga0207654_10083929 3300025911 Bacteria 1925
139 Ga0207695_10000009 3300025913 Bacteria 1034276
140 Ga0207695_10328705 3300025913 Unclassified 1417
141 Ga0207695_10452691 3300025913 Bacteria 1166
142 Ga0207695_10829779 3300025913 Bacteria 804
143 Ga0207695_11075750 3300025913 Unclassified 684
144 Ga0207671_10000003 3300025914 Bacteria 1065461
145 Ga0207671_10075186 3300025914 Bacteria 2526
146 Ga0207660_10144975 3300025917 Bacteria 1819
147 Ga0207657_10001204 3300025919 Bacteria 27540
148 Ga0207657_10001496 3300025919 Bacteria 24997
149 Ga0207657_10007088 3300025919 Bacteria 11519
150 Ga0207649_10366779 3300025920 Bacteria 1070
151 Ga0207652_10005764 3300025921 Bacteria 10050
152 Ga0207652_10027796 3300025921 Unclassified 4717
153 Ga0207652_10127908 3300025921 Bacteria 2264
154 Ga0207652_10793224 3300025921 Bacteria 841
155 Ga0207694_10857547 3300025924 Bacteria 768
156 Ga0207694_11259617 3300025924 Bacteria 626
157 Ga0207650_11487263 3300025925 Unclassified 576
158 Ga0207659_11023470 3300025926 Bacteria 711
159 Ga0207687_10000001 3300025927 Bacteria 1130810
160 Ga0207687_10012068 3300025927 Bacteria 5649
161 Ga0207687_10045482 3300025927 Bacteria 3034
162 Ga0207687_10745069 3300025927 Bacteria 833
163 Ga0207644_10039120 3300025931 Bacteria 3346
164 Ga0207644_10057039 3300025931 Unclassified 2819
165 Ga0207644_10350682 3300025931 Unclassified 1198
166 Ga0207690_10003265 3300025932 Bacteria 9727
167 Ga0207690_10045555 3300025932 Bacteria 2898
168 Ga0207690_10909987 3300025932 Bacteria 730
169 Ga0207706_10000053 3300025933 Bacteria 114286
170 Ga0207686_10002049 3300025934 Bacteria 11116
171 Ga0207686_10131017 3300025934 Bacteria 1720
172 Ga0207704_10038246 3300025938 Bacteria 2781
173 Ga0207711_11171435 3300025941 Bacteria 710
174 Ga0207661_10000021 3300025944 Bacteria 205381
175 Ga0207661_10001144 3300025944 Bacteria 17701
176 Ga0207679_10351478 3300025945 Bacteria 1285
177 Ga0207667_10000060 3300025949 Bacteria 192320
178 Ga0207667_10707100 3300025949 Bacteria 1010
179 Ga0207667_11121917 3300025949 Bacteria 769
180 Ga0207712_10003648 3300025961 Bacteria 9701
181 Ga0207712_10490648 3300025961 Bacteria 1048
182 Ga0207668_10038165 3300025972 Unclassified 3221
183 Ga0207658_10020917 3300025986 Unclassified 4534
184 Ga0207703_10001971 3300026035 Bacteria 18124
185 Ga0207678_10180838 3300026067 Bacteria 1801
186 Ga0207702_10443163 3300026078 Bacteria 1259
187 Ga0207641_10074393 3300026088 Unclassified 2930
188 Ga0207674_10000001 3300026116 Bacteria 616581
189 Ga0207674_10132181 3300026116 Unclassified 2458
190 Ga0207674_11813128 3300026116 Unclassified 577
191 Ga0207683_10034394 3300026121 Unclassified 4404
192 Ga0268265_10431243 3300028380 Bacteria 1226
193 Ga0265337_1012360 3300028556 Bacteria 2905
194 Ga0265326_10018003 3300028558 Bacteria 2034
195 Ga0265334_10000115 3300028573 Bacteria 52649
196 Ga0265334_10005038 3300028573 Bacteria 5797
197 Ga0265322_10005194 3300028654 Bacteria 3852
198 Ga0265338_10000003 3300028800 Bacteria 733923
199 Ga0265338_10000189 3300028800 Bacteria 115979
200 Ga0265338_10000655 3300028800 Bacteria 59919
201 Ga0265338_10000758 3300028800 Bacteria 55090
202 Ga0265324_10002012 3300029957 Bacteria 10837
203 Ga0265324_10073493 3300029957 Unclassified 1164
204 Ga0316179_1023884 3300030734 Viruses 795
205 Ga0265329_10075976 3300031242 Unclassified 1063
206 Ga0265327_10006196 3300031251 Bacteria 9647
207 Ga0265327_10144360 3300031251 Unclassified 1110
208 Ga0265316_10004729 3300031344 Bacteria 13478
209 Ga0265314_10037767 3300031711 Bacteria 3497
210 Ga0265342_10226400 3300031712 Bacteria 1006
211 Ga0307406_10000002 3300031901 Bacteria 255753
212 Ga0395899_0042689 3300037312 Unclassified 3384
213 Ga0395900_0065367 3300037418 Unclassified 3736
214 Ga0395900_0195899 3300037418 Bacteria 2047
215 Ga0395898_0012911 3300037466 Bacteria 8616
216 Ga0395905_0000965 3300037471 Bacteria 36917
217 Ga0395905_0022787 3300037471 Bacteria 5921
218 Ga0395901_0054706 3300038443 Unclassified 4148
219 Ga0439455_0182062 3300042012 Bacteria 605
220 Ga0439463_002224 3300042016 Bacteria 5000
221 Ga0439464_0000002 3300042439 Bacteria 79371
222 Ga0495609_0056490 3300046538 Bacteria 1739
223 Ga0496104_0952348 3300048907 Bacteria 763
224 Ga0496105_0108665 3300048908 Bacteria 2290
225 Ga0496109_0198588 3300048912 Bacteria 1886
226 Ga0496112_0005791 3300048915 Bacteria 10750
227 Ga0496113_0412859 3300048916 Bacteria 1084
228 Ga0496126_1015485 3300048929 Unclassified 621
229 Ga0501032_0259353 3300049569 Unclassified 1127
230 Ga0501033_0182661 3300049570 Unclassified 1503
231 Ga0501034_0006871 3300049571 Bacteria 12167
232 Ga0501034_0008381 3300049571 Bacteria 10927
233 Ga0501036_0102882 3300049572 Unclassified 2416
234 Ga0501037_0002478 3300049573 Bacteria 13335
235 Ga0501037_0075942 3300049573 Bacteria 2440
236 Ga0501039_0096432 3300049575 Unclassified 2306
237 Ga0501040_0352017 3300049576 Unclassified 1055
238 Ga0501047_0007187 3300049581 Bacteria 10466
239 Ga0501048_0008817 3300049582 Bacteria 7597
240 Ga0501070_0014237 3300049586 Bacteria 6694
241 Ga0501070_1139323 3300049586 Unclassified 600
242 Ga0501234_011126 3300049707 Unclassified 1406
243 Ga0501035_0000005 3300049822 Bacteria 392980
244 Ga0501044_0031629 3300049823 Bacteria 5569
245 nmdc:mga00v17_11407_c1 3300050491 Bacteria 3828
246 nmdc:mga00v17_34704_c1 3300050491 Unclassified 2998
247 nmdc:mga0yw44_201596_c1 3300050492 Unclassified 1314
248 nmdc:mga0yw44_794140_c1 3300050492 Bacteria 643
249 nmdc:mga0k408_154_c2 3300050493 Bacteria 25786
250 nmdc:mga0k408_21449_c1 3300050493 Unclassified 3628
251 nmdc:mga06z11_207206_c1 3300050494 Bacteria 1141
252 nmdc:mga06z11_2_c1 3300050494 Bacteria 169056
253 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
254 nmdc:mga04h51_78452_c1 3300050495 Bacteria 1167
255 nmdc:mga07m45_15581_c1 3300050496 Unclassified 4059
256 nmdc:mga07m45_17871_c1 3300050496 Bacteria 3816
257 nmdc:mga07m45_31674_c1 3300050496 Bacteria 2931
258 nmdc:mga0qj67_34327_c1 3300050509 Unclassified 3962
259 nmdc:mga0sz30_128961_c1 3300050516 Bacteria 1114
260 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
261 Ga0500643_000022 3300053087 Bacteria 277519
262 Ga0500644_0000006 3300053088 Bacteria 143304
263 Ga0500644_0000347 3300053088 Bacteria 23270
264 Ga0500644_0001400 3300053088 Bacteria 6419
265 Ga0500583_0023102 3300053092 Unclassified 2616
266 Ga0500555_000001 3300053103 Bacteria 1353713
267 Ga0500594_0026600 3300053118 Bacteria 1491
268 Ga0500628_000015 3300053129 Bacteria 101037
269 Ga0500652_000020 3300053131 Bacteria 119198
270 Ga0500568_0002562 3300053139 Bacteria 10590
271 Ga0500577_0000308 3300053142 Bacteria 12590
272 Ga0500589_010943 3300053147 Unclassified 3902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100531478 Ga0075363_1005314781 101
2 3300050495 nmdc:mga04h51_78452_c1 nmdc:mga04h51_78452_c1_634_987 101
3 3300005617 Ga0068859_100813082 Ga0068859_1008130822 103
4 3300006931 Ga0097620_100813074 Ga0097620_1008130742 103
5 3300011119 Ga0105246_12094602 Ga0105246_120946022 104
6 3300037312 Ga0395899_0042689 Ga0395899_0042689_2649_2990 104
7 3300037418 Ga0395900_0065367 Ga0395900_0065367_1588_1929 104
8 3300037466 Ga0395898_0012911 Ga0395898_0012911_607_948 104
9 3300037471 Ga0395905_0022787 Ga0395905_0022787_3791_4132 104
10 3300038443 Ga0395901_0054706 Ga0395901_0054706_394_735 104
11 3300005618 Ga0068864_100986667 Ga0068864_1009866672 105
12 3300050494 nmdc:mga06z11_2_c1 nmdc:mga06z11_2_c1_165057_165407 105
13 3300050495 nmdc:mga04h51_3_c1 nmdc:mga04h51_3_c1_203079_203429 105
14 3300050496 nmdc:mga07m45_17871_c1 nmdc:mga07m45_17871_c1_3450_3800 105
15 3300006353 Ga0075370_10055779 Ga0075370_100557792 107
16 3300009093 Ga0105240_10207222 Ga0105240_102072223 107
17 3300025913 Ga0207695_11075750 Ga0207695_110757502 107
18 3300025927 Ga0207687_10745069 Ga0207687_107450692 107
19 3300037471 Ga0395905_0000965 Ga0395905_0000965_12968_13318 107
20 3300050496 nmdc:mga07m45_15581_c1 nmdc:mga07m45_15581_c1_750_1097 107
21 3300005327 Ga0070658_10002562 Ga0070658_1000256215 108
22 3300005339 Ga0070660_100001520 Ga0070660_10000152012 108
23 3300005341 Ga0070691_10022285 Ga0070691_100222852 108
24 3300005366 Ga0070659_100004402 Ga0070659_10000440213 108
25 3300005530 Ga0070679_100092321 Ga0070679_1000923212 108
26 3300005530 Ga0070679_100488683 Ga0070679_1004886832 108
27 3300005563 Ga0068855_100000136 Ga0068855_10000013692 108
28 3300005577 Ga0068857_100000002 Ga0068857_100000002176 108
29 3300010375 Ga0105239_11053335 Ga0105239_110533352 108
30 3300013307 Ga0157372_10631239 Ga0157372_106312392 108
31 3300013307 Ga0157372_11315799 Ga0157372_113157992 108
32 3300025909 Ga0207705_10829880 Ga0207705_108298802 108
33 3300025919 Ga0207657_10007088 Ga0207657_100070882 108
34 3300025921 Ga0207652_10027796 Ga0207652_100277964 108
35 3300025921 Ga0207652_10793224 Ga0207652_107932242 108
36 3300025932 Ga0207690_10003265 Ga0207690_100032652 108
37 3300025949 Ga0207667_10000060 Ga0207667_10000060147 108
38 3300026116 Ga0207674_10000001 Ga0207674_10000001599 108
39 3300049569 Ga0501032_0259353 Ga0501032_0259353_584_937 108
40 3300049570 Ga0501033_0182661 Ga0501033_0182661_434_787 108
41 3300049571 Ga0501034_0008381 Ga0501034_0008381_9517_9870 108
42 3300049572 Ga0501036_0102882 Ga0501036_0102882_1997_2350 108
43 3300049573 Ga0501037_0002478 Ga0501037_0002478_10564_10917 108
44 3300049575 Ga0501039_0096432 Ga0501039_0096432_968_1321 108
45 3300049576 Ga0501040_0352017 Ga0501040_0352017_454_807 108
46 3300049581 Ga0501047_0007187 Ga0501047_0007187_9199_9552 108
47 3300049582 Ga0501048_0008817 Ga0501048_0008817_5382_5735 108
48 3300049586 Ga0501070_1139323 Ga0501070_1139323_30_383 108
49 3300049822 Ga0501035_0000005 Ga0501035_0000005_243585_243938 108
50 3300049823 Ga0501044_0031629 Ga0501044_0031629_3736_4089 108
51 3300003320 rootH2_10057059 rootH2_100570592 109
52 3300005339 Ga0070660_100539655 Ga0070660_1005396552 109
53 3300005366 Ga0070659_101132460 Ga0070659_1011324602 109
54 3300005530 Ga0070679_100328400 Ga0070679_1003284002 109
55 3300005563 Ga0068855_101249978 Ga0068855_1012499782 109
56 3300006237 Ga0097621_100000009 Ga0097621_10000000993 109
57 3300006358 Ga0068871_100000232 Ga0068871_10000023226 109
58 3300006358 Ga0068871_100268378 Ga0068871_1002683783 109
59 3300009093 Ga0105240_10641448 Ga0105240_106414482 109
60 3300009098 Ga0105245_10000002 Ga0105245_1000000227 109
61 3300009979 Ga0105032_102276 Ga0105032_1022762 109
62 3300013296 Ga0157374_10000073 Ga0157374_1000007375 109
63 3300013297 Ga0157378_10186873 Ga0157378_101868733 109
64 3300014325 Ga0163163_10175038 Ga0163163_101750382 109
65 3300025911 Ga0207654_10005195 Ga0207654_100051951 109
66 3300025913 Ga0207695_10452691 Ga0207695_104526911 109
67 3300025921 Ga0207652_10127908 Ga0207652_101279083 109
68 3300025924 Ga0207694_11259617 Ga0207694_112596172 109
69 3300025927 Ga0207687_10000001 Ga0207687_100000011183 109
70 3300025932 Ga0207690_10909987 Ga0207690_109099871 109
71 3300025949 Ga0207667_11121917 Ga0207667_111219172 109
72 3300028556 Ga0265337_1012360 Ga0265337_10123602 109
73 3300028558 Ga0265326_10018003 Ga0265326_100180032 109
74 3300028573 Ga0265334_10000115 Ga0265334_1000011531 109
75 3300028800 Ga0265338_10000003 Ga0265338_10000003330 109
76 3300028800 Ga0265338_10000189 Ga0265338_10000189134 109
77 3300029957 Ga0265324_10073493 Ga0265324_100734932 109
78 3300031242 Ga0265329_10075976 Ga0265329_100759762 109
79 3300031251 Ga0265327_10144360 Ga0265327_101443602 109
80 3300037418 Ga0395900_0195899 Ga0395900_0195899_1338_1694 109
81 3300049573 Ga0501037_0075942 Ga0501037_0075942_606_962 109
82 3300049586 Ga0501070_0014237 Ga0501070_0014237_6219_6575 109
83 3300049707 Ga0501234_011126 Ga0501234_011126_451_801 109
84 3300050509 nmdc:mga0qj67_34327_c1 nmdc:mga0qj67_34327_c1_1885_2238 109
85 3300001979 JGI24740J21852_10001357 JGI24740J21852_100013574 110
86 3300001989 JGI24739J22299_10001573 JGI24739J22299_100015739 110
87 3300001990 JGI24737J22298_10000814 JGI24737J22298_100008143 110
88 3300001991 JGI24743J22301_10016816 JGI24743J22301_100168162 110
89 3300002067 JGI24735J21928_10000026 JGI24735J21928_100000262 110
90 3300002067 JGI24735J21928_10000107 JGI24735J21928_1000010712 110
91 3300002075 JGI24738J21930_10001247 JGI24738J21930_100012472 110
92 3300003316 rootH1_10150932 rootH1_101509322 110
93 3300005293 Ga0065715_10113764 Ga0065715_101137643 110
94 3300005327 Ga0070658_10000035 Ga0070658_10000035111 110
95 3300005329 Ga0070683_100001508 Ga0070683_10000150812 110
96 3300005329 Ga0070683_100699649 Ga0070683_1006996492 110
97 3300005330 Ga0070690_100000917 Ga0070690_1000009172 110
98 3300005336 Ga0070680_100009912 Ga0070680_10000991211 110
99 3300005336 Ga0070680_101083815 Ga0070680_1010838151 110
100 3300005339 Ga0070660_100000099 Ga0070660_10000009918 110
101 3300005339 Ga0070660_100026546 Ga0070660_1000265462 110
102 3300005344 Ga0070661_100004816 Ga0070661_1000048166 110
103 3300005354 Ga0070675_100086683 Ga0070675_1000866832 110
104 3300005366 Ga0070659_100027403 Ga0070659_1000274032 110
105 3300005366 Ga0070659_100249918 Ga0070659_1002499182 110
106 3300005367 Ga0070667_100006003 Ga0070667_1000060034 110
107 3300005457 Ga0070662_100090784 Ga0070662_1000907842 110
108 3300005466 Ga0070685_10016708 Ga0070685_100167084 110
109 3300005530 Ga0070679_100000233 Ga0070679_1000002332 110
110 3300005535 Ga0070684_100000544 Ga0070684_1000005443 110
111 3300005544 Ga0070686_100747103 Ga0070686_1007471032 110
112 3300005548 Ga0070665_101434537 Ga0070665_1014345371 110
113 3300005548 Ga0070665_102477874 Ga0070665_1024778742 110
114 3300005563 Ga0068855_100852548 Ga0068855_1008525481 110
115 3300005563 Ga0068855_101456363 Ga0068855_1014563632 110
116 3300005563 Ga0068855_102355190 Ga0068855_1023551901 110
117 3300005564 Ga0070664_101696093 Ga0070664_1016960931 110
118 3300005577 Ga0068857_102497664 Ga0068857_1024976641 110
119 3300005577 Ga0068857_102556545 Ga0068857_1025565451 110
120 3300005617 Ga0068859_101200722 Ga0068859_1012007221 110
121 3300005841 Ga0068863_100090713 Ga0068863_1000907132 110
122 3300005842 Ga0068858_100003279 Ga0068858_10000327923 110
123 3300005844 Ga0068862_100213544 Ga0068862_1002135442 110
124 3300006038 Ga0075365_10312537 Ga0075365_103125372 110
125 3300006051 Ga0075364_10007536 Ga0075364_100075367 110
126 3300006051 Ga0075364_10040858 Ga0075364_100408584 110
127 3300006186 Ga0075369_10099533 Ga0075369_100995332 110
128 3300006195 Ga0075366_10000943 Ga0075366_100009432 110
129 3300006195 Ga0075366_10116304 Ga0075366_101163042 110
130 3300006237 Ga0097621_100301495 Ga0097621_1003014951 110
131 3300006353 Ga0075370_10014998 Ga0075370_100149983 110
132 3300006358 Ga0068871_100147397 Ga0068871_1001473972 110
133 3300006931 Ga0097620_101200935 Ga0097620_1012009351 110
134 3300009093 Ga0105240_10000003 Ga0105240_10000003751 110
135 3300009093 Ga0105240_10000004 Ga0105240_10000004716 110
136 3300009093 Ga0105240_10048657 Ga0105240_100486572 110
137 3300009098 Ga0105245_10000122 Ga0105245_1000012249 110
138 3300009098 Ga0105245_10015278 Ga0105245_100152782 110
139 3300009098 Ga0105245_10021590 Ga0105245_100215902 110
140 3300009101 Ga0105247_10391983 Ga0105247_103919831 110
141 3300009148 Ga0105243_10000001 Ga0105243_10000001541 110
142 3300009174 Ga0105241_10088299 Ga0105241_100882992 110
143 3300009176 Ga0105242_10000064 Ga0105242_1000006443 110
144 3300009176 Ga0105242_11879962 Ga0105242_118799621 110
145 3300009177 Ga0105248_10209593 Ga0105248_102095932 110
146 3300009177 Ga0105248_10715292 Ga0105248_107152922 110
147 3300009177 Ga0105248_10735353 Ga0105248_107353532 110
148 3300009545 Ga0105237_10000001 Ga0105237_100000011148 110
149 3300009545 Ga0105237_10006795 Ga0105237_100067959 110
150 3300009551 Ga0105238_10027520 Ga0105238_100275208 110
151 3300009551 Ga0105238_11025451 Ga0105238_110254511 110
152 3300009551 Ga0105238_12883832 Ga0105238_128838322 110
153 3300009553 Ga0105249_10366569 Ga0105249_103665692 110
154 3300009993 Ga0105028_100177 Ga0105028_1001772 110
155 3300010375 Ga0105239_10043331 Ga0105239_100433315 110
156 3300010375 Ga0105239_10923451 Ga0105239_109234512 110
157 3300010375 Ga0105239_11274733 Ga0105239_112747332 110
158 3300010375 Ga0105239_11886523 Ga0105239_118865232 110
159 3300011119 Ga0105246_10001117 Ga0105246_1000111712 110
160 3300013100 Ga0157373_10025344 Ga0157373_100253445 110
161 3300013100 Ga0157373_10085227 Ga0157373_100852272 110
162 3300013102 Ga0157371_10006358 Ga0157371_100063585 110
163 3300013104 Ga0157370_10000924 Ga0157370_100009242 110
164 3300013104 Ga0157370_10001253 Ga0157370_1000125313 110
165 3300013105 Ga0157369_10000444 Ga0157369_1000044433 110
166 3300013296 Ga0157374_10000501 Ga0157374_1000050110 110
167 3300013296 Ga0157374_10000971 Ga0157374_1000097110 110
168 3300013296 Ga0157374_10013818 Ga0157374_100138182 110
169 3300013296 Ga0157374_10634566 Ga0157374_106345662 110
170 3300013296 Ga0157374_11403014 Ga0157374_114030141 110
171 3300013297 Ga0157378_10031715 Ga0157378_100317152 110
172 3300013306 Ga0163162_11425007 Ga0163162_114250072 110
173 3300013307 Ga0157372_10000002 Ga0157372_10000002693 110
174 3300013307 Ga0157372_10084932 Ga0157372_100849322 110
175 3300013307 Ga0157372_10771294 Ga0157372_107712942 110
176 3300013307 Ga0157372_12332915 Ga0157372_123329152 110
177 3300013307 Ga0157372_13207084 Ga0157372_132070842 110
178 3300013308 Ga0157375_11419106 Ga0157375_114191062 110
179 3300014325 Ga0163163_10008799 Ga0163163_1000879911 110
180 3300014325 Ga0163163_10142778 Ga0163163_101427782 110
181 3300014745 Ga0157377_10000455 Ga0157377_100004555 110
182 3300014969 Ga0157376_10000001 Ga0157376_10000001194 110
183 3300014969 Ga0157376_10895159 Ga0157376_108951592 110
184 3300014969 Ga0157376_11051616 Ga0157376_110516162 110
185 3300025901 Ga0207688_10260662 Ga0207688_102606622 110
186 3300025904 Ga0207647_10000315 Ga0207647_1000031520 110
187 3300025909 Ga0207705_10000010 Ga0207705_10000010115 110
188 3300025911 Ga0207654_10083929 Ga0207654_100839292 110
189 3300025913 Ga0207695_10000009 Ga0207695_100000091098 110
190 3300025913 Ga0207695_10328705 Ga0207695_103287052 110
191 3300025913 Ga0207695_10829779 Ga0207695_108297792 110
192 3300025914 Ga0207671_10000003 Ga0207671_100000031154 110
193 3300025914 Ga0207671_10075186 Ga0207671_100751862 110
194 3300025917 Ga0207660_10144975 Ga0207660_101449752 110
195 3300025919 Ga0207657_10001204 Ga0207657_1000120414 110
196 3300025919 Ga0207657_10001496 Ga0207657_100014969 110
197 3300025920 Ga0207649_10366779 Ga0207649_103667792 110
198 3300025921 Ga0207652_10005764 Ga0207652_100057642 110
199 3300025924 Ga0207694_10857547 Ga0207694_108575471 110
200 3300025925 Ga0207650_11487263 Ga0207650_114872631 110
201 3300025926 Ga0207659_11023470 Ga0207659_110234702 110
202 3300025927 Ga0207687_10012068 Ga0207687_100120682 110
203 3300025927 Ga0207687_10045482 Ga0207687_100454822 110
204 3300025931 Ga0207644_10039120 Ga0207644_100391201 110
205 3300025931 Ga0207644_10057039 Ga0207644_100570393 110
206 3300025931 Ga0207644_10350682 Ga0207644_103506821 110
207 3300025932 Ga0207690_10045555 Ga0207690_100455551 110
208 3300025933 Ga0207706_10000053 Ga0207706_1000005389 110
209 3300025934 Ga0207686_10002049 Ga0207686_1000204913 110
210 3300025934 Ga0207686_10131017 Ga0207686_101310172 110
211 3300025938 Ga0207704_10038246 Ga0207704_100382462 110
212 3300025941 Ga0207711_11171435 Ga0207711_111714352 110
213 3300025944 Ga0207661_10000021 Ga0207661_1000002140 110
214 3300025944 Ga0207661_10001144 Ga0207661_100011448 110
215 3300025945 Ga0207679_10351478 Ga0207679_103514781 110
216 3300025949 Ga0207667_10707100 Ga0207667_107071002 110
217 3300025961 Ga0207712_10003648 Ga0207712_100036486 110
218 3300025961 Ga0207712_10490648 Ga0207712_104906482 110
219 3300025972 Ga0207668_10038165 Ga0207668_100381653 110
220 3300025986 Ga0207658_10020917 Ga0207658_100209175 110
221 3300026035 Ga0207703_10001971 Ga0207703_1000197123 110
222 3300026067 Ga0207678_10180838 Ga0207678_101808382 110
223 3300026078 Ga0207702_10443163 Ga0207702_104431632 110
224 3300026088 Ga0207641_10074393 Ga0207641_100743933 110
225 3300026116 Ga0207674_10132181 Ga0207674_101321812 110
226 3300026116 Ga0207674_11813128 Ga0207674_118131281 110
227 3300026121 Ga0207683_10034394 Ga0207683_100343945 110
228 3300028380 Ga0268265_10431243 Ga0268265_104312432 110
229 3300028573 Ga0265334_10005038 Ga0265334_100050386 110
230 3300028654 Ga0265322_10005194 Ga0265322_100051944 110
231 3300028800 Ga0265338_10000655 Ga0265338_1000065558 110
232 3300028800 Ga0265338_10000758 Ga0265338_1000075856 110
233 3300029957 Ga0265324_10002012 Ga0265324_1000201214 110
234 3300030734 Ga0316179_1023884 Ga0316179_10238841 110
235 3300031251 Ga0265327_10006196 Ga0265327_1000619613 110
236 3300031344 Ga0265316_10004729 Ga0265316_1000472913 110
237 3300031711 Ga0265314_10037767 Ga0265314_100377676 110
238 3300031712 Ga0265342_10226400 Ga0265342_102264002 110
239 3300031901 Ga0307406_10000002 Ga0307406_1000000286 110
240 3300042012 Ga0439455_0182062 Ga0439455_0182062_55_387 110
241 3300042016 Ga0439463_002224 Ga0439463_002224_353_685 110
242 3300042439 Ga0439464_0000002 Ga0439464_0000002_32345_32677 110
243 3300046538 Ga0495609_0056490 Ga0495609_0056490_1156_1512 110
244 3300048907 Ga0496104_0952348 Ga0496104_0952348_272_628 110
245 3300048908 Ga0496105_0108665 Ga0496105_0108665_208_564 110
246 3300048912 Ga0496109_0198588 Ga0496109_0198588_934_1290 110
247 3300048915 Ga0496112_0005791 Ga0496112_0005791_3286_3642 110
248 3300048916 Ga0496113_0412859 Ga0496113_0412859_230_586 110
249 3300048929 Ga0496126_1015485 Ga0496126_1015485_30_386 110
250 3300049571 Ga0501034_0006871 Ga0501034_0006871_2869_3249 110
251 3300050491 nmdc:mga00v17_11407_c1 nmdc:mga00v17_11407_c1_3011_3343 110
252 3300050491 nmdc:mga00v17_34704_c1 nmdc:mga00v17_34704_c1_2604_2960 110
253 3300050492 nmdc:mga0yw44_201596_c1 nmdc:mga0yw44_201596_c1_327_683 110
254 3300050492 nmdc:mga0yw44_794140_c1 nmdc:mga0yw44_794140_c1_245_577 110
255 3300050493 nmdc:mga0k408_154_c2 nmdc:mga0k408_154_c2_629_985 110
256 3300050493 nmdc:mga0k408_21449_c1 nmdc:mga0k408_21449_c1_2419_2751 110
257 3300050494 nmdc:mga06z11_207206_c1 nmdc:mga06z11_207206_c1_245_577 110
258 3300050496 nmdc:mga07m45_31674_c1 nmdc:mga07m45_31674_c1_2241_2573 110
259 3300050516 nmdc:mga0sz30_128961_c1 nmdc:mga0sz30_128961_c1_121_453 110
260 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_164686_165087 110
261 3300053087 Ga0500643_000022 Ga0500643_000022_40474_40839 110
262 3300053088 Ga0500644_0000006 Ga0500644_0000006_78153_78521 110
263 3300053088 Ga0500644_0000347 Ga0500644_0000347_10951_11322 110
264 3300053088 Ga0500644_0001400 Ga0500644_0001400_5376_5732 110
265 3300053092 Ga0500583_0023102 Ga0500583_0023102_61_426 110
266 3300053103 Ga0500555_000001 Ga0500555_000001_655646_656005 110
267 3300053118 Ga0500594_0026600 Ga0500594_0026600_750_1106 110
268 3300053129 Ga0500628_000015 Ga0500628_000015_100160_100516 110
269 3300053131 Ga0500652_000020 Ga0500652_000020_68125_68493 110
270 3300053139 Ga0500568_0002562 Ga0500568_0002562_9070_9438 110
271 3300053142 Ga0500577_0000308 Ga0500577_0000308_3929_4300 110
272 3300053147 Ga0500589_010943 Ga0500589_010943_3153_3518 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

28

99

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.9491 9 106
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.9347 19 109
6abt-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9314 17 109
5x11-assembly2.cif.gz_E crystal structure of bacillus subtilis padr in complex with operator dna 0.9232 19 97
5x11-assembly1.cif.gz_B crystal structure of bacillus subtilis padr in complex with operator dna 0.9225 19 97
ID Description Score Start End Superfamily
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9346 19 109 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9223 12 107 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9142 19 97 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9125 20 97 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9076 14 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q5NDT2-F1-model_v4 deleted 0.9932 1 110
AF-A0A2N1SYA6-F1-model_v4 PadR family transcriptional regulator 0.9893 12 110
AF-A0A563CQ46-F1-model_v4 PadR family transcriptional regulator 0.9858 2 108
AF-A0A389LUE8-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9834 31 108 GO:0005737
AF-A0A2G6C3F7-F1-model_v4 PadR family transcriptional regulator 0.9797 1 109

Feature Viewer

pLDDT pTM Quality
93.35 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map