F378089

General Info

Members Datasets Scaffolds Average Seq Length
272 143 231 72

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1000186|Ga0055536_100018643
Length 79
Sequence MSNLRRILLSVFILLLVLAILAFVLENQQSVSLLFLGWAGPQLPVSVITVGALLTGMLVGPVFGWFLGRTSRASRKRLV

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231008 Pseudomonas sp. GM21 Isolate Nodule
4 2511231010 Pseudomonas sp. GM25 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231016 Pseudomonas sp. GM50 Isolate Nodule
7 2511231019 Pseudomonas sp. GM67 Isolate Nodule
8 2511231020 Pseudomonas sp. GM74 Isolate Nodule
9 2511231021 Pseudomonas sp. GM78 Isolate Nodule
10 2511231022 Pseudomonas sp. GM79 Isolate Nodule
11 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
12 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
13 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
14 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
15 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
16 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
17 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
18 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
19 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
20 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
21 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
22 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
23 2773857670 Pseudomonas sp. 478 Isolate Unclassified
24 2784132072 Pseudomonas sp. 460 Isolate Unclassified
25 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
26 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
27 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
28 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
29 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
30 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
31 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
32 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
33 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
34 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
35 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
36 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
37 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
73 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
74 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
137 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
141 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
142 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
143 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.56
Metatranscriptomes 0.37
Isolates 15.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 4.41
Rhizoplane 2.94
Rhizosphere 80.88
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000186 3300003781 Bacteria 50837
2 Ga0055530_10004549 3300003791 Bacteria 7085
3 Ga0055540_1000205 3300003792 Bacteria 57359
4 Ga0055531_10000155 3300003794 Bacteria 79002
5 Ga0065714_10078768 3300005288 Bacteria 2559
6 Ga0065714_10375575 3300005288 Bacteria 606
7 Ga0065712_10669082 3300005290 Bacteria 559
8 Ga0070669_100104990 3300005353 Bacteria 2137
9 Ga0075362_10143658 3300006177 Bacteria 1141
10 Ga0079104_1000955 3300006946 Bacteria 22753
11 Ga0105244_10052244 3300009036 Bacteria 2081
12 Ga0105250_10000476 3300009092 Bacteria 28300
13 Ga0105246_10011359 3300011119 Bacteria 5528
14 Ga0157373_10000589 3300013100 Bacteria 28284
15 Ga0157373_10003694 3300013100 Bacteria 11580
16 Ga0157373_11431861 3300013100 Bacteria 526
17 Ga0157371_10001656 3300013102 Bacteria 22716
18 Ga0157371_11180832 3300013102 Bacteria 589
19 Ga0157370_10001726 3300013104 Bacteria 26910
20 Ga0157370_10162712 3300013104 Bacteria 2076
21 Ga0163162_12149417 3300013306 Bacteria 640
22 Ga0182008_10000650 3300014497 Bacteria 25384
23 Ga0182006_1001509 3300015261 Bacteria 13942
24 Ga0182006_1022146 3300015261 Bacteria 2644
25 Ga0182005_1000401 3300015265 Bacteria 23672
26 Ga0182005_1021141 3300015265 Bacteria 1787
27 Ga0182005_1112861 3300015265 Bacteria 769
28 Ga0182005_1203516 3300015265 Bacteria 596
29 Ga0163161_10002080 3300017792 Bacteria 14504
30 Ga0163161_10214203 3300017792 Bacteria 1489
31 Ga0209676_1000010 3300025292 Bacteria 954025
32 Ga0209050_1000081 3300025298 Bacteria 267533
33 Ga0209051_1000104 3300025303 Bacteria 161001
34 Ga0209257_1000040 3300025304 Bacteria 538759
35 Ga0207696_1000513 3300025711 Bacteria 32169
36 Ga0207696_1142209 3300025711 Bacteria 643
37 Ga0207655_1040872 3300025728 Bacteria 1994
38 Ga0207713_1000899 3300025735 Bacteria 26952
39 Ga0207681_10095012 3300025923 Bacteria 2137
40 Ga0209281_1000902 3300027111 Bacteria 24860
41 Ga0307408_100374351 3300031548 Bacteria 1215
42 Ga0307414_10674973 3300032004 Bacteria 933
43 Ga0439438_000141 3300041405 Bacteria 32709
44 Ga0439438_000207 3300041405 Bacteria 26979
45 Ga0439438_137314 3300041405 Bacteria 585
46 Ga0439447_000098 3300041407 Bacteria 30413
47 Ga0439447_044110 3300041407 Bacteria 1079
48 Ga0439466_0056261 3300041411 Bacteria 1276
49 Ga0439452_000154 3300042010 Bacteria 51036
50 Ga0450902_054205 3300042137 Bacteria 690
51 Ga0450905_000007 3300042142 Bacteria 28289
52 Ga0495617_000357 3300046452 Bacteria 25206
53 Ga0495617_034587 3300046452 Bacteria 1696
54 Ga0495627_000586 3300046453 Bacteria 29130
55 Ga0495627_022454 3300046453 Bacteria 2077
56 Ga0495590_0000508 3300046457 Bacteria 19111
57 Ga0495590_0004135 3300046457 Bacteria 5881
58 Ga0495590_0013583 3300046457 Bacteria 2989
59 Ga0495591_000310 3300046458 Bacteria 44305
60 Ga0495591_000468 3300046458 Bacteria 32179
61 Ga0495591_020944 3300046458 Bacteria 2146
62 Ga0495638_0001209 3300046460 Bacteria 24630
63 Ga0495638_0043510 3300046460 Bacteria 2832
64 Ga0495638_0477815 3300046460 Bacteria 632
65 Ga0495653_0109330 3300046463 Bacteria 1989
66 Ga0495650_0001799 3300046471 Bacteria 19344
67 Ga0495650_0009450 3300046471 Bacteria 5541
68 Ga0495650_0011274 3300046471 Bacteria 4911
69 Ga0495650_0020744 3300046471 Bacteria 3195
70 Ga0495650_0026820 3300046471 Bacteria 2671
71 Ga0495605_0000645 3300046474 Bacteria 26693
72 Ga0495664_0881330 3300046477 Bacteria 524
73 Ga0495584_0000210 3300046491 Bacteria 42003
74 Ga0495584_0000279 3300046491 Bacteria 36315
75 Ga0495584_0019141 3300046491 Bacteria 3477
76 Ga0495584_0035109 3300046491 Bacteria 2534
77 Ga0495585_0000121 3300046492 Bacteria 84876
78 Ga0495585_0000356 3300046492 Bacteria 44409
79 Ga0495585_0000810 3300046492 Bacteria 27246
80 Ga0495585_0000981 3300046492 Bacteria 23904
81 Ga0495585_0010050 3300046492 Bacteria 5653
82 Ga0495596_0000820 3300046500 Bacteria 18787
83 Ga0495607_0001640 3300046501 Bacteria 19395
84 Ga0495607_0009839 3300046501 Bacteria 6453
85 Ga0495607_0012934 3300046501 Bacteria 5488
86 Ga0495583_0156417 3300046506 Bacteria 942
87 Ga0495606_0000771 3300046507 Bacteria 49120
88 Ga0495606_0001476 3300046507 Bacteria 31356
89 Ga0495606_0046968 3300046507 Bacteria 2850
90 Ga0495606_0067341 3300046507 Bacteria 2267
91 Ga0495610_0004010 3300046512 Bacteria 11112
92 Ga0495610_0025535 3300046512 Bacteria 3168
93 Ga0495610_0035354 3300046512 Bacteria 2566
94 Ga0495616_0000598 3300046513 Bacteria 27217
95 Ga0495616_0001079 3300046513 Bacteria 19379
96 Ga0495616_0003336 3300046513 Bacteria 10311
97 Ga0495616_0120889 3300046513 Bacteria 1209
98 Ga0495620_0000327 3300046515 Bacteria 33465
99 Ga0495620_0013217 3300046515 Bacteria 4234
100 Ga0495620_0143869 3300046515 Bacteria 931
101 Ga0495631_0007947 3300046518 Bacteria 5365
102 Ga0495631_0022911 3300046518 Bacteria 2901
103 Ga0495631_0039752 3300046518 Bacteria 2085
104 Ga0495631_0060041 3300046518 Bacteria 1650
105 Ga0495632_0000481 3300046519 Bacteria 37903
106 Ga0495632_0003678 3300046519 Bacteria 10761
107 Ga0495632_0021152 3300046519 Bacteria 3509
108 Ga0495632_0038639 3300046519 Bacteria 2415
109 Ga0495637_0000169 3300046520 Bacteria 50531
110 Ga0495637_0000415 3300046520 Bacteria 31323
111 Ga0495637_0000623 3300046520 Bacteria 25024
112 Ga0495637_0000650 3300046520 Bacteria 24221
113 Ga0495637_0001828 3300046520 Bacteria 12175
114 Ga0495637_0008360 3300046520 Bacteria 5087
115 Ga0495637_0015668 3300046520 Bacteria 3555
116 Ga0495637_0096902 3300046520 Bacteria 1157
117 Ga0495643_0025368 3300046522 Bacteria 3354
118 Ga0495643_0052835 3300046522 Bacteria 2180
119 Ga0495643_0054131 3300046522 Bacteria 2149
120 Ga0495644_0015146 3300046523 Bacteria 2953
121 Ga0495644_0029010 3300046523 Bacteria 2092
122 Ga0495648_0011351 3300046524 Bacteria 6714
123 Ga0495648_0030219 3300046524 Bacteria 3585
124 Ga0495648_0044309 3300046524 Bacteria 2778
125 Ga0495648_0157294 3300046524 Bacteria 1178
126 Ga0495648_0212624 3300046524 Bacteria 959
127 Ga0495654_0000499 3300046530 Bacteria 32120
128 Ga0495654_0006515 3300046530 Bacteria 6623
129 Ga0495654_0014191 3300046530 Bacteria 4246
130 Ga0495654_0062989 3300046530 Bacteria 1776
131 Ga0495654_0118343 3300046530 Bacteria 1201
132 Ga0495654_0178448 3300046530 Bacteria 921
133 Ga0495609_0000454 3300046538 Bacteria 33468
134 Ga0495609_0019244 3300046538 Bacteria 3162
135 Ga0495621_0304632 3300046539 Bacteria 661
136 Ga0495597_0000450 3300046542 Bacteria 35268
137 Ga0495597_0001065 3300046542 Bacteria 20919
138 Ga0495597_0013058 3300046542 Bacteria 3987
139 Ga0495597_0020561 3300046542 Bacteria 3072
140 Ga0495597_0080266 3300046542 Bacteria 1396
141 Ga0495645_0152767 3300046543 Bacteria 1602
142 Ga0495656_0069447 3300046615 Bacteria 1560
143 Ga0495668_0000195 3300046616 Bacteria 89153
144 Ga0495668_0044028 3300046616 Bacteria 2481
145 Ga0495611_0151011 3300046648 Bacteria 1084
146 Ga0495625_0001948 3300046660 Bacteria 23351
147 Ga0495625_0024763 3300046660 Bacteria 4561
148 Ga0495625_0041010 3300046660 Bacteria 3371
149 Ga0495625_0152841 3300046660 Bacteria 1550
150 Ga0495661_0062471 3300046665 Bacteria 2206
151 Ga0495661_0263567 3300046665 Bacteria 874
152 Ga0495646_0003293 3300046680 Bacteria 10055
153 Ga0495669_0011280 3300046684 Bacteria 3792
154 Ga0495670_0160674 3300046691 Bacteria 1180
155 Ga0495670_0249044 3300046691 Bacteria 947
156 Ga0495671_0000199 3300046692 Bacteria 52734
157 Ga0495671_0000667 3300046692 Bacteria 24862
158 Ga0495671_0000673 3300046692 Bacteria 24670
159 Ga0495671_0003934 3300046692 Bacteria 9008
160 Ga0495671_0010046 3300046692 Bacteria 5265
161 Ga0495671_0250708 3300046692 Bacteria 854
162 Ga0495671_0384282 3300046692 Bacteria 672
163 Ga0495649_0000720 3300046694 Bacteria 26910
164 Ga0495649_0002698 3300046694 Bacteria 12365
165 Ga0495649_0015216 3300046694 Bacteria 4379
166 Ga0495649_0019468 3300046694 Bacteria 3813
167 Ga0495649_0101733 3300046694 Bacteria 1527
168 Ga0495589_0000423 3300046794 Bacteria 31362
169 Ga0495589_0020660 3300046794 Bacteria 3366
170 Ga0495589_0022925 3300046794 Bacteria 3182
171 Ga0495600_0181446 3300046809 Bacteria 1356
172 Ga0495660_0000547 3300046810 Bacteria 30853
173 Ga0495660_0000634 3300046810 Bacteria 27391
174 Ga0495660_0005088 3300046810 Bacteria 7898
175 Ga0495660_0053226 3300046810 Bacteria 2198
176 Ga0495660_0072315 3300046810 Bacteria 1826
177 Ga0495660_0503389 3300046810 Bacteria 517
178 Ga0495604_0030328 3300047317 Bacteria 4295
179 Ga0495636_0064638 3300047318 Bacteria 1552
180 Ga0495672_0016427 3300047320 Bacteria 4988
181 Ga0495680_0001764 3300047322 Bacteria 22915
182 Ga0495680_0002747 3300047322 Bacteria 17767
183 Ga0495680_0474601 3300047322 Bacteria 852
184 Ga0495683_0173521 3300047323 Bacteria 989
185 Ga0495683_0233535 3300047323 Bacteria 814
186 Ga0495675_0000435 3300047444 Bacteria 27849
187 Ga0495675_0007945 3300047444 Bacteria 6558
188 Ga0495677_0014689 3300047445 Bacteria 2848
189 Ga0495679_000560 3300047446 Bacteria 26013
190 Ga0495679_013227 3300047446 Bacteria 3107
191 Ga0495685_013795 3300047447 Bacteria 2741
192 Ga0495673_0000745 3300047469 Bacteria 30985
193 Ga0495673_0045354 3300047469 Bacteria 1954
194 Ga0495673_0061642 3300047469 Bacteria 1604
195 Ga0495681_0000125 3300047470 Bacteria 67542
196 Ga0495681_0000465 3300047470 Bacteria 31006
197 Ga0495681_0000485 3300047470 Bacteria 30536
198 Ga0495681_0001243 3300047470 Bacteria 19346
199 Ga0495681_0002876 3300047470 Bacteria 12170
200 Ga0495681_0277447 3300047470 Bacteria 654
201 Ga0495684_0573145 3300047471 Bacteria 765
202 Ga0495686_0004096 3300047472 Bacteria 12142
203 Ga0495686_0012331 3300047472 Bacteria 5983
204 Ga0495686_0161756 3300047472 Bacteria 1307
205 Ga0495626_0000191 3300048091 Bacteria 74236
206 Ga0495626_0000819 3300048091 Bacteria 27987
207 Ga0495626_0002836 3300048091 Bacteria 11585
208 Ga0495626_0003128 3300048091 Bacteria 10837
209 Ga0495626_0017455 3300048091 Bacteria 3621
210 Ga0496116_0001453 3300048919 Bacteria 26579
211 Ga0496116_0040564 3300048919 Bacteria 3205
212 Ga0496117_0002049 3300048920 Bacteria 26674
213 Ga0496117_0003964 3300048920 Bacteria 16735
214 Ga0496117_0045882 3300048920 Bacteria 3150
215 Ga0496117_0451499 3300048920 Bacteria 635
216 Ga0496118_0002460 3300048921 Bacteria 24906
217 Ga0496118_0033039 3300048921 Bacteria 4253
218 Ga0496118_0234557 3300048921 Bacteria 1056
219 Ga0496121_0001685 3300048924 Bacteria 36349
220 Ga0496121_0002454 3300048924 Bacteria 28322
221 Ga0496121_0002987 3300048924 Bacteria 24569
222 Ga0496125_0054865 3300048928 Bacteria 3253
223 Ga0495678_000928 3300049459 Bacteria 25623
224 Ga0495678_002395 3300049459 Bacteria 12813
225 Ga0495678_013487 3300049459 Bacteria 3837
226 Ga0495678_148039 3300049459 Bacteria 761
227 Ga0495682_0000536 3300049460 Bacteria 26226
228 Ga0495682_0000878 3300049460 Bacteria 18647
229 Ga0495682_0153309 3300049460 Bacteria 821
230 Ga0500568_0030109 3300053139 Bacteria 2249
231 Ga0587072_022397 3300059643 Bacteria 1128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006946 Ga0079104_1000955 Ga0079104_10009551 62
2 3300013102 Ga0157371_10001656 Ga0157371_1000165618 62
3 3300027111 Ga0209281_1000902 Ga0209281_100090220 62
4 3300042010 Ga0439452_000154 Ga0439452_000154_49372_49611 62
5 3300005288 Ga0065714_10375575 Ga0065714_103755752 64
6 3300013102 Ga0157371_11180832 Ga0157371_111808321 64
7 3300015261 Ga0182006_1022146 Ga0182006_10221461 64
8 3300046457 Ga0495590_0004135 Ga0495590_0004135_1006_1245 64
9 3300046458 Ga0495591_020944 Ga0495591_020944_328_567 64
10 3300046460 Ga0495638_0001209 Ga0495638_0001209_1200_1439 64
11 3300046471 Ga0495650_0011274 Ga0495650_0011274_4363_4602 64
12 3300046491 Ga0495584_0000210 Ga0495584_0000210_41179_41418 64
13 3300046492 Ga0495585_0000356 Ga0495585_0000356_1154_1393 64
14 3300046492 Ga0495585_0010050 Ga0495585_0010050_5083_5322 64
15 3300046506 Ga0495583_0156417 Ga0495583_0156417_646_885 64
16 3300046507 Ga0495606_0046968 Ga0495606_0046968_1966_2205 64
17 3300046512 Ga0495610_0035354 Ga0495610_0035354_331_570 64
18 3300046513 Ga0495616_0003336 Ga0495616_0003336_336_575 64
19 3300046518 Ga0495631_0060041 Ga0495631_0060041_371_610 64
20 3300046519 Ga0495632_0000481 Ga0495632_0000481_37342_37581 64
21 3300046520 Ga0495637_0000169 Ga0495637_0000169_836_1075 64
22 3300046520 Ga0495637_0000623 Ga0495637_0000623_275_511 64
23 3300046520 Ga0495637_0008360 Ga0495637_0008360_4801_5040 64
24 3300046522 Ga0495643_0025368 Ga0495643_0025368_209_445 64
25 3300046522 Ga0495643_0054131 Ga0495643_0054131_858_1097 64
26 3300046523 Ga0495644_0015146 Ga0495644_0015146_471_710 64
27 3300046524 Ga0495648_0212624 Ga0495648_0212624_573_812 64
28 3300046530 Ga0495654_0062989 Ga0495654_0062989_573_812 64
29 3300046530 Ga0495654_0178448 Ga0495654_0178448_505_744 64
30 3300046539 Ga0495621_0304632 Ga0495621_0304632_101_340 64
31 3300046542 Ga0495597_0013058 Ga0495597_0013058_3650_3889 64
32 3300046542 Ga0495597_0080266 Ga0495597_0080266_901_1140 64
33 3300046615 Ga0495656_0069447 Ga0495656_0069447_588_827 64
34 3300046660 Ga0495625_0152841 Ga0495625_0152841_985_1224 64
35 3300046665 Ga0495661_0062471 Ga0495661_0062471_217_456 64
36 3300046665 Ga0495661_0263567 Ga0495661_0263567_344_583 64
37 3300046684 Ga0495669_0011280 Ga0495669_0011280_1045_1284 64
38 3300046692 Ga0495671_0003934 Ga0495671_0003934_7721_7960 64
39 3300046694 Ga0495649_0002698 Ga0495649_0002698_11863_12099 64
40 3300046694 Ga0495649_0101733 Ga0495649_0101733_274_513 64
41 3300046794 Ga0495589_0020660 Ga0495589_0020660_363_602 64
42 3300046810 Ga0495660_0503389 Ga0495660_0503389_136_375 64
43 3300047318 Ga0495636_0064638 Ga0495636_0064638_815_1054 64
44 3300047445 Ga0495677_0014689 Ga0495677_0014689_1050_1289 64
45 3300047446 Ga0495679_013227 Ga0495679_013227_2409_2648 64
46 3300047447 Ga0495685_013795 Ga0495685_013795_2214_2453 64
47 3300047469 Ga0495673_0045354 Ga0495673_0045354_782_1021 64
48 3300047470 Ga0495681_0277447 Ga0495681_0277447_281_520 64
49 3300047472 Ga0495686_0004096 Ga0495686_0004096_1161_1400 64
50 3300047472 Ga0495686_0161756 Ga0495686_0161756_408_647 64
51 3300048091 Ga0495626_0002836 Ga0495626_0002836_10288_10527 64
52 3300049460 Ga0495682_0000536 Ga0495682_0000536_25543_25782 64
53 3300053139 Ga0500568_0030109 Ga0500568_0030109_1658_1897 64
54 3300041407 Ga0439447_000098 Ga0439447_000098_29140_29379 65
55 3300041411 Ga0439466_0056261 Ga0439466_0056261_608_847 65
56 3300046452 Ga0495617_000357 Ga0495617_000357_24168_24407 65
57 3300046507 Ga0495606_0000771 Ga0495606_0000771_1183_1422 65
58 3300046512 Ga0495610_0004010 Ga0495610_0004010_1202_1441 65
59 3300046524 Ga0495648_0011351 Ga0495648_0011351_295_534 65
60 3300046542 Ga0495597_0001065 Ga0495597_0001065_20393_20632 65
61 3300046692 Ga0495671_0000667 Ga0495671_0000667_966_1205 65
62 3300046810 Ga0495660_0000634 Ga0495660_0000634_858_1097 65
63 3300047322 Ga0495680_0002747 Ga0495680_0002747_11635_11874 65
64 3300047470 Ga0495681_0000485 Ga0495681_0000485_1223_1462 65
65 3300047470 Ga0495681_0002876 Ga0495681_0002876_395_634 65
66 3300048091 Ga0495626_0000191 Ga0495626_0000191_72812_73051 65
67 3300048928 Ga0496125_0054865 Ga0496125_0054865_1136_1375 65
68 3300049459 Ga0495678_013487 Ga0495678_013487_1841_2080 65
69 3300049459 Ga0495678_148039 Ga0495678_148039_394_633 65
70 iso_pu_bacteria 2599185257 2599804048 65
71 iso_pu_bacteria 2671180172 2671770384 65
72 3300046492 Ga0495585_0000121 Ga0495585_0000121_327_566 66
73 3300046810 Ga0495660_0053226 Ga0495660_0053226_94_336 66
74 3300047469 Ga0495673_0000745 Ga0495673_0000745_29540_29782 66
75 3300013100 Ga0157373_10003694 Ga0157373_100036942 67
76 3300013100 Ga0157373_11431861 Ga0157373_114318612 67
77 3300015265 Ga0182005_1000401 Ga0182005_10004014 67
78 3300025711 Ga0207696_1142209 Ga0207696_11422092 67
79 3300031548 Ga0307408_100374351 Ga0307408_1003743512 67
80 3300032004 Ga0307414_10674973 Ga0307414_106749732 67
81 3300046530 Ga0495654_0014191 Ga0495654_0014191_1090_1329 67
82 3300048920 Ga0496117_0003964 Ga0496117_0003964_392_631 67
83 3300048921 Ga0496118_0033039 Ga0496118_0033039_392_631 67
84 3300009092 Ga0105250_10000476 Ga0105250_1000047623 68
85 3300013100 Ga0157373_10000589 Ga0157373_1000058925 68
86 3300013104 Ga0157370_10001726 Ga0157370_1000172624 68
87 3300013104 Ga0157370_10162712 Ga0157370_101627122 68
88 3300017792 Ga0163161_10214203 Ga0163161_102142032 68
89 3300025711 Ga0207696_1000513 Ga0207696_10005134 68
90 3300048919 Ga0496116_0001453 Ga0496116_0001453_25127_25366 68
91 3300048920 Ga0496117_0002049 Ga0496117_0002049_1161_1400 68
92 3300048921 Ga0496118_0002460 Ga0496118_0002460_387_626 68
93 3300041405 Ga0439438_137314 Ga0439438_137314_194_433 69
94 3300046452 Ga0495617_034587 Ga0495617_034587_1103_1363 69
95 3300046453 Ga0495627_022454 Ga0495627_022454_269_529 69
96 3300046457 Ga0495590_0013583 Ga0495590_0013583_1113_1373 69
97 3300046458 Ga0495591_000310 Ga0495591_000310_42921_43181 69
98 3300046460 Ga0495638_0043510 Ga0495638_0043510_1035_1295 69
99 3300046463 Ga0495653_0109330 Ga0495653_0109330_567_803 69
100 3300046471 Ga0495650_0020744 Ga0495650_0020744_1805_2065 69
101 3300046477 Ga0495664_0881330 Ga0495664_0881330_80_316 69
102 3300046491 Ga0495584_0035109 Ga0495584_0035109_1019_1279 69
103 3300046500 Ga0495596_0000820 Ga0495596_0000820_1145_1405 69
104 3300046501 Ga0495607_0012934 Ga0495607_0012934_4345_4605 69
105 3300046507 Ga0495606_0067341 Ga0495606_0067341_884_1144 69
106 3300046512 Ga0495610_0025535 Ga0495610_0025535_1116_1376 69
107 3300046515 Ga0495620_0013217 Ga0495620_0013217_1117_1377 69
108 3300046518 Ga0495631_0039752 Ga0495631_0039752_289_549 69
109 3300046519 Ga0495632_0038639 Ga0495632_0038639_1051_1311 69
110 3300046520 Ga0495637_0015668 Ga0495637_0015668_1134_1394 69
111 3300046522 Ga0495643_0052835 Ga0495643_0052835_1387_1647 69
112 3300046523 Ga0495644_0029010 Ga0495644_0029010_876_1136 69
113 3300046524 Ga0495648_0044309 Ga0495648_0044309_1936_2196 69
114 3300046530 Ga0495654_0006515 Ga0495654_0006515_312_572 69
115 3300046542 Ga0495597_0020561 Ga0495597_0020561_2546_2806 69
116 3300046543 Ga0495645_0152767 Ga0495645_0152767_112_348 69
117 3300046616 Ga0495668_0000195 Ga0495668_0000195_87770_88030 69
118 3300046660 Ga0495625_0024763 Ga0495625_0024763_341_601 69
119 3300046680 Ga0495646_0003293 Ga0495646_0003293_221_457 69
120 3300046691 Ga0495670_0249044 Ga0495670_0249044_230_490 69
121 3300046692 Ga0495671_0384282 Ga0495671_0384282_309_569 69
122 3300046694 Ga0495649_0019468 Ga0495649_0019468_1008_1268 69
123 3300046794 Ga0495589_0022925 Ga0495589_0022925_1120_1380 69
124 3300046809 Ga0495600_0181446 Ga0495600_0181446_813_1049 69
125 3300046810 Ga0495660_0072315 Ga0495660_0072315_1256_1516 69
126 3300047317 Ga0495604_0030328 Ga0495604_0030328_2718_2954 69
127 3300047322 Ga0495680_0474601 Ga0495680_0474601_295_531 69
128 3300047323 Ga0495683_0173521 Ga0495683_0173521_456_716 69
129 3300047444 Ga0495675_0007945 Ga0495675_0007945_1187_1423 69
130 3300047469 Ga0495673_0061642 Ga0495673_0061642_1004_1264 69
131 3300047470 Ga0495681_0000125 Ga0495681_0000125_1006_1266 69
132 3300047472 Ga0495686_0012331 Ga0495686_0012331_4615_4875 69
133 3300048091 Ga0495626_0003128 Ga0495626_0003128_1129_1389 69
134 3300049460 Ga0495682_0153309 Ga0495682_0153309_500_760 69
135 iso_pu_bacteria 3007395558 3007397319 69
136 3300011119 Ga0105246_10011359 Ga0105246_100113596 70
137 3300017792 Ga0163161_10002080 Ga0163161_1000208013 70
138 iso_pu_bacteria 2919481497 2919481811 70
139 3300005288 Ga0065714_10078768 Ga0065714_100787682 73
140 3300005353 Ga0070669_100104990 Ga0070669_1001049904 73
141 3300006177 Ga0075362_10143658 Ga0075362_101436583 73
142 3300009036 Ga0105244_10052244 Ga0105244_100522442 73
143 3300014497 Ga0182008_10000650 Ga0182008_1000065022 73
144 3300015265 Ga0182005_1021141 Ga0182005_10211411 73
145 3300025728 Ga0207655_1040872 Ga0207655_10408722 73
146 3300025735 Ga0207713_1000899 Ga0207713_10008994 73
147 3300025923 Ga0207681_10095012 Ga0207681_100950122 73
148 3300042142 Ga0450905_000007 Ga0450905_000007_26875_27114 73
149 3300048919 Ga0496116_0040564 Ga0496116_0040564_2652_2891 73
150 3300048920 Ga0496117_0045882 Ga0496117_0045882_174_413 73
151 3300048920 Ga0496117_0451499 Ga0496117_0451499_143_382 73
152 3300048921 Ga0496118_0234557 Ga0496118_0234557_200_439 73
153 3300048924 Ga0496121_0002454 Ga0496121_0002454_1177_1416 73
154 3300048924 Ga0496121_0002987 Ga0496121_0002987_24277_24516 73
155 3300046453 Ga0495627_000586 Ga0495627_000586_1189_1434 74
156 3300046458 Ga0495591_000468 Ga0495591_000468_30701_30946 74
157 3300046471 Ga0495650_0026820 Ga0495650_0026820_1978_2223 74
158 3300046474 Ga0495605_0000645 Ga0495605_0000645_1050_1295 74
159 3300046492 Ga0495585_0000981 Ga0495585_0000981_23596_23841 74
160 3300046501 Ga0495607_0009839 Ga0495607_0009839_29_274 74
161 3300046513 Ga0495616_0000598 Ga0495616_0000598_26554_26799 74
162 3300046515 Ga0495620_0143869 Ga0495620_0143869_330_575 74
163 3300046519 Ga0495632_0003678 Ga0495632_0003678_1013_1258 74
164 3300046520 Ga0495637_0096902 Ga0495637_0096902_315_560 74
165 3300046524 Ga0495648_0157294 Ga0495648_0157294_360_605 74
166 3300046530 Ga0495654_0000499 Ga0495654_0000499_30653_30898 74
167 3300046648 Ga0495611_0151011 Ga0495611_0151011_592_837 74
168 3300046660 Ga0495625_0001948 Ga0495625_0001948_360_605 74
169 3300046691 Ga0495670_0160674 Ga0495670_0160674_356_601 74
170 3300046692 Ga0495671_0000673 Ga0495671_0000673_330_575 74
171 3300046694 Ga0495649_0000720 Ga0495649_0000720_25435_25680 74
172 3300046810 Ga0495660_0000547 Ga0495660_0000547_844_1089 74
173 3300047320 Ga0495672_0016427 Ga0495672_0016427_113_352 74
174 3300047323 Ga0495683_0233535 Ga0495683_0233535_282_527 74
175 3300047446 Ga0495679_000560 Ga0495679_000560_25350_25595 74
176 3300048091 Ga0495626_0000819 Ga0495626_0000819_1242_1487 74
177 3300049459 Ga0495678_000928 Ga0495678_000928_25046_25291 74
178 iso_pu_bacteria 2511231004 2511254981 75
179 iso_pu_bacteria 2511231007 2511273002 75
180 iso_pu_bacteria 2511231008 2511277830 75
181 iso_pu_bacteria 2511231010 2511287708 75
182 iso_pu_bacteria 2511231012 2511301163 75
183 iso_pu_bacteria 2511231016 2511324131 75
184 iso_pu_bacteria 2511231019 2511345889 75
185 iso_pu_bacteria 2511231020 2511349767 75
186 iso_pu_bacteria 2511231021 2511359412 75
187 iso_pu_bacteria 2511231022 2511362926 75
188 iso_pu_bacteria 2599185317 2600027692 75
189 iso_pu_bacteria 2600254930 2600356599 75
190 iso_pu_bacteria 2600255318 2601796323 75
191 iso_pu_bacteria 2603880185 2606073473 75
192 iso_pu_bacteria 2603880199 2606126883 75
193 iso_pu_bacteria 2623620443 2624481966 75
194 iso_pu_bacteria 2623620446 2624490945 75
195 iso_pu_bacteria 2643221633 2644188632 75
196 iso_pu_bacteria 2667528176 2671125956 75
197 iso_pu_bacteria 2713897149 2715758276 75
198 iso_pu_bacteria 2773857670 2774121247 75
199 iso_pu_bacteria 2784132072 2784316561 75
200 iso_pu_bacteria 2818991456 2819655712 75
201 iso_pu_bacteria 2860339153 2860340876 75
202 iso_pu_bacteria 2878029506 2878033956 75
203 iso_pu_bacteria 2919063839 2919068941 75
204 iso_pu_bacteria 2919456309 2919461023 75
205 iso_pu_bacteria 2919697872 2919701937 75
206 iso_pu_bacteria 2931396565 2931396619 75
207 iso_pu_bacteria 2969304461 2969308728 75
208 iso_pu_bacteria 3007614139 3007615590 75
209 iso_pu_bacteria 3007619802 3007624860 75
210 iso_pu_bacteria 3007718800 3007718962 75
211 iso_pu_bacteria 8015687852 8015692108 75
212 iso_pu_bacteria 8019775933 8019779328 75
213 iso_pu_bacteria 8056155041 8056155084 75
214 iso_pu_bacteria 8056177738 8056179410 75
215 3300047322 Ga0495680_0001764 Ga0495680_0001764_22414_22644 76
216 3300041405 Ga0439438_000207 Ga0439438_000207_26576_26812 78
217 3300041407 Ga0439447_044110 Ga0439447_044110_759_995 78
218 3300003781 Ga0055536_1000186 Ga0055536_100018643 79
219 3300003791 Ga0055530_10004549 Ga0055530_100045494 79
220 3300003792 Ga0055540_1000205 Ga0055540_100020549 79
221 3300003794 Ga0055531_10000155 Ga0055531_100001556 79
222 3300005290 Ga0065712_10669082 Ga0065712_106690821 79
223 3300013306 Ga0163162_12149417 Ga0163162_121494171 79
224 3300015261 Ga0182006_1001509 Ga0182006_10015092 79
225 3300015265 Ga0182005_1112861 Ga0182005_11128611 79
226 3300015265 Ga0182005_1203516 Ga0182005_12035161 79
227 3300025292 Ga0209676_1000010 Ga0209676_1000010164 79
228 3300025298 Ga0209050_1000081 Ga0209050_100008186 79
229 3300025303 Ga0209051_1000104 Ga0209051_100010491 79
230 3300025304 Ga0209257_1000040 Ga0209257_1000040361 79
231 3300041405 Ga0439438_000141 Ga0439438_000141_2201_2440 79
232 3300042137 Ga0450902_054205 Ga0450902_054205_42_281 79
233 3300046457 Ga0495590_0000508 Ga0495590_0000508_1149_1388 79
234 3300046460 Ga0495638_0477815 Ga0495638_0477815_383_622 79
235 3300046471 Ga0495650_0001799 Ga0495650_0001799_17934_18173 79
236 3300046471 Ga0495650_0009450 Ga0495650_0009450_307_546 79
237 3300046491 Ga0495584_0000279 Ga0495584_0000279_34877_35116 79
238 3300046491 Ga0495584_0019141 Ga0495584_0019141_316_555 79
239 3300046492 Ga0495585_0000810 Ga0495585_0000810_1093_1332 79
240 3300046501 Ga0495607_0001640 Ga0495607_0001640_17976_18215 79
241 3300046507 Ga0495606_0001476 Ga0495606_0001476_1944_2183 79
242 3300046513 Ga0495616_0001079 Ga0495616_0001079_1158_1397 79
243 3300046513 Ga0495616_0120889 Ga0495616_0120889_664_903 79
244 3300046515 Ga0495620_0000327 Ga0495620_0000327_31257_31496 79
245 3300046518 Ga0495631_0007947 Ga0495631_0007947_2434_2673 79
246 3300046518 Ga0495631_0022911 Ga0495631_0022911_327_566 79
247 3300046519 Ga0495632_0021152 Ga0495632_0021152_413_652 79
248 3300046520 Ga0495637_0000415 Ga0495637_0000415_29161_29400 79
249 3300046520 Ga0495637_0000650 Ga0495637_0000650_6153_6392 79
250 3300046520 Ga0495637_0001828 Ga0495637_0001828_11604_11843 79
251 3300046524 Ga0495648_0030219 Ga0495648_0030219_2143_2382 79
252 3300046530 Ga0495654_0118343 Ga0495654_0118343_628_867 79
253 3300046538 Ga0495609_0000454 Ga0495609_0000454_31267_31506 79
254 3300046538 Ga0495609_0019244 Ga0495609_0019244_361_600 79
255 3300046542 Ga0495597_0000450 Ga0495597_0000450_288_527 79
256 3300046616 Ga0495668_0044028 Ga0495668_0044028_1572_1811 79
257 3300046660 Ga0495625_0041010 Ga0495625_0041010_1210_1449 79
258 3300046692 Ga0495671_0000199 Ga0495671_0000199_51281_51520 79
259 3300046692 Ga0495671_0010046 Ga0495671_0010046_1004_1243 79
260 3300046692 Ga0495671_0250708 Ga0495671_0250708_349_588 79
261 3300046694 Ga0495649_0015216 Ga0495649_0015216_2522_2761 79
262 3300046794 Ga0495589_0000423 Ga0495589_0000423_29183_29422 79
263 3300046810 Ga0495660_0005088 Ga0495660_0005088_5906_6145 79
264 3300047444 Ga0495675_0000435 Ga0495675_0000435_204_443 79
265 3300047470 Ga0495681_0000465 Ga0495681_0000465_29174_29413 79
266 3300047470 Ga0495681_0001243 Ga0495681_0001243_17945_18184 79
267 3300047471 Ga0495684_0573145 Ga0495684_0573145_110_349 79
268 3300048091 Ga0495626_0017455 Ga0495626_0017455_2327_2566 79
269 3300048924 Ga0496121_0001685 Ga0496121_0001685_34888_35127 79
270 3300049459 Ga0495678_002395 Ga0495678_002395_1631_1870 79
271 3300049460 Ga0495682_0000878 Ga0495682_0000878_17752_17991 79
272 3300059643 Ga0587072_022397 Ga0587072_022397_814_1053 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06305

LapA_dom

Lipopolysaccharide assembly protein A domain

26

79

0.87

Feature Viewer

pLDDT pTM Quality
72.93 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map