F377730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 140 | 542 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300030879|Ga0265765_1004419|Ga0265765_10044191 |
| Length | 193 |
| Sequence | LSLSLSGWKQKIIAFASGLGAPGLFLISFLDSSVLSFPIINDLLLINLSMRNHARMPLYALMAATGSVLGCVLLYFLARMGGEAYFHRKAGARAHAIRHWVERNGFGGMLIAALLPPPTPFKIFVFAAGVFEAPLFGRYFGVGYLAVRYGADAMPYLAAHKLQVTAIVIALVVVSYGLSRWILRHQPHQEIPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 3 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 35 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 36 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 52 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 53 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 83 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 84 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 85 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 86 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 87 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 90 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 91 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 92 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 93 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 94 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 95 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 99 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 133 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 134 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 135 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 136 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 137 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 138 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.15 |
| Metatranscriptomes | 1.85 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 95.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 36.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265765_1004419 | 3300030879 | Unclassified | 1446 |
| 2 | Ga0070709_10005144 | 3300005434 | Bacteria | 7077 |
| 3 | Ga0070709_10111887 | 3300005434 | Bacteria | 1836 |
| 4 | Ga0070709_10211727 | 3300005434 | Unclassified | 1378 |
| 5 | Ga0070714_100053349 | 3300005435 | Unclassified | 3451 |
| 6 | Ga0070713_100064904 | 3300005436 | Bacteria | 3065 |
| 7 | Ga0070713_100283772 | 3300005436 | Unclassified | 1520 |
| 8 | Ga0070710_10029304 | 3300005437 | Bacteria | 2953 |
| 9 | Ga0070710_10263214 | 3300005437 | Unclassified | 1113 |
| 10 | Ga0070711_100017469 | 3300005439 | Bacteria | 4569 |
| 11 | Ga0070711_100648639 | 3300005439 | Unclassified | 885 |
| 12 | Ga0070705_100156200 | 3300005440 | Unclassified | 1519 |
| 13 | Ga0070705_100653644 | 3300005440 | Unclassified | 820 |
| 14 | Ga0070708_100001728 | 3300005445 | Bacteria | 16788 |
| 15 | Ga0070708_100047173 | 3300005445 | Unclassified | 3804 |
| 16 | Ga0070708_100060288 | 3300005445 | Bacteria | 3386 |
| 17 | Ga0070708_100124696 | 3300005445 | Bacteria | 2379 |
| 18 | Ga0070685_10188548 | 3300005466 | Bacteria | 1332 |
| 19 | Ga0070706_100165273 | 3300005467 | Bacteria | 2067 |
| 20 | Ga0070706_100182901 | 3300005467 | Unclassified | 1957 |
| 21 | Ga0070706_100326699 | 3300005467 | Unclassified | 1430 |
| 22 | Ga0070706_100716830 | 3300005467 | Unclassified | 927 |
| 23 | Ga0070706_100773582 | 3300005467 | Bacteria | 889 |
| 24 | Ga0070707_100000208 | 3300005468 | Bacteria | 58895 |
| 25 | Ga0070707_100106345 | 3300005468 | Bacteria | 2721 |
| 26 | Ga0070707_100123709 | 3300005468 | Bacteria | 2512 |
| 27 | Ga0070707_100227995 | 3300005468 | Bacteria | 1814 |
| 28 | Ga0070707_100260765 | 3300005468 | Bacteria | 1686 |
| 29 | Ga0070707_100432143 | 3300005468 | Unclassified | 1277 |
| 30 | Ga0070707_100892829 | 3300005468 | Bacteria | 853 |
| 31 | Ga0070699_100118733 | 3300005518 | Bacteria | 2325 |
| 32 | Ga0070679_100100128 | 3300005530 | Bacteria | 2885 |
| 33 | Ga0070697_100000132 | 3300005536 | Bacteria | 59826 |
| 34 | Ga0070697_100016483 | 3300005536 | Bacteria | 5813 |
| 35 | Ga0070697_100052290 | 3300005536 | Unclassified | 3319 |
| 36 | Ga0070697_100194070 | 3300005536 | Bacteria | 1724 |
| 37 | Ga0070697_100263449 | 3300005536 | Unclassified | 1476 |
| 38 | Ga0070697_100291217 | 3300005536 | Unclassified | 1402 |
| 39 | Ga0070697_100431791 | 3300005536 | Bacteria | 1146 |
| 40 | Ga0070697_100750304 | 3300005536 | Unclassified | 862 |
| 41 | Ga0070686_100159728 | 3300005544 | Bacteria | 1586 |
| 42 | Ga0070695_100024189 | 3300005545 | Bacteria | 3740 |
| 43 | Ga0070696_100006012 | 3300005546 | Bacteria | 8099 |
| 44 | Ga0070665_100007185 | 3300005548 | Bacteria | 11320 |
| 45 | Ga0070704_100104781 | 3300005549 | Bacteria | 2140 |
| 46 | Ga0068866_10352820 | 3300005718 | Unclassified | 935 |
| 47 | Ga0068863_100003171 | 3300005841 | Bacteria | 16256 |
| 48 | Ga0068860_100007420 | 3300005843 | Bacteria | 10967 |
| 49 | Ga0068860_100346735 | 3300005843 | Unclassified | 1461 |
| 50 | Ga0068862_100609167 | 3300005844 | Bacteria | 1049 |
| 51 | Ga0081540_1108655 | 3300005983 | Bacteria | 1178 |
| 52 | Ga0070717_10401144 | 3300006028 | Unclassified | 1232 |
| 53 | Ga0070717_10470801 | 3300006028 | Unclassified | 1134 |
| 54 | Ga0070715_10117154 | 3300006163 | Unclassified | 1265 |
| 55 | Ga0070715_10152038 | 3300006163 | Unclassified | 1135 |
| 56 | Ga0070715_10357886 | 3300006163 | Unclassified | 799 |
| 57 | Ga0070715_10571168 | 3300006163 | Unclassified | 659 |
| 58 | Ga0070716_100002680 | 3300006173 | Bacteria | 8236 |
| 59 | Ga0070716_100006003 | 3300006173 | Bacteria | 5914 |
| 60 | Ga0070716_100031132 | 3300006173 | Bacteria | 2900 |
| 61 | Ga0070716_100067263 | 3300006173 | Bacteria | 2093 |
| 62 | Ga0070716_100121392 | 3300006173 | Unclassified | 1636 |
| 63 | Ga0070712_100037508 | 3300006175 | Unclassified | 3305 |
| 64 | Ga0070712_100047243 | 3300006175 | Bacteria | 2978 |
| 65 | Ga0097621_100002044 | 3300006237 | Bacteria | 13803 |
| 66 | Ga0068871_100030116 | 3300006358 | Bacteria | 4271 |
| 67 | Ga0075434_100150082 | 3300006871 | Unclassified | 2351 |
| 68 | Ga0068865_100756358 | 3300006881 | Unclassified | 835 |
| 69 | Ga0075436_100000280 | 3300006914 | Bacteria | 32243 |
| 70 | Ga0075436_100329242 | 3300006914 | Bacteria | 1098 |
| 71 | Ga0075435_100078736 | 3300007076 | Bacteria | 2703 |
| 72 | Ga0075435_100089205 | 3300007076 | Bacteria | 2542 |
| 73 | Ga0099794_10002221 | 3300007265 | Bacteria | 7093 |
| 74 | Ga0099794_10006506 | 3300007265 | Bacteria | 4738 |
| 75 | Ga0099794_10009472 | 3300007265 | Unclassified | 4097 |
| 76 | Ga0099794_10013716 | 3300007265 | Bacteria | 3535 |
| 77 | Ga0099794_10016621 | 3300007265 | Unclassified | 3265 |
| 78 | Ga0099794_10031590 | 3300007265 | Bacteria | 2480 |
| 79 | Ga0099794_10045821 | 3300007265 | Unclassified | 2093 |
| 80 | Ga0099794_10056845 | 3300007265 | Bacteria | 1894 |
| 81 | Ga0099794_10056849 | 3300007265 | Bacteria | 1894 |
| 82 | Ga0099794_10062451 | 3300007265 | Unclassified | 1811 |
| 83 | Ga0099794_10080561 | 3300007265 | Bacteria | 1606 |
| 84 | Ga0099794_10178216 | 3300007265 | Bacteria | 1084 |
| 85 | Ga0099795_10016584 | 3300007788 | Eukaryota | 2332 |
| 86 | Ga0099795_10041481 | 3300007788 | Unclassified | 1639 |
| 87 | Ga0105240_10098443 | 3300009093 | Unclassified | 3562 |
| 88 | Ga0105245_10035006 | 3300009098 | Bacteria | 4455 |
| 89 | Ga0105243_10070684 | 3300009148 | Unclassified | 2819 |
| 90 | Ga0105241_10984298 | 3300009174 | Unclassified | 788 |
| 91 | Ga0105237_10014789 | 3300009545 | Bacteria | 8144 |
| 92 | Ga0105237_10643769 | 3300009545 | Unclassified | 1067 |
| 93 | Ga0105249_10196353 | 3300009553 | Unclassified | 1972 |
| 94 | Ga0099796_10001986 | 3300010159 | Bacteria | 4353 |
| 95 | Ga0099796_10022046 | 3300010159 | Unclassified | 1971 |
| 96 | Ga0099796_10274072 | 3300010159 | Unclassified | 708 |
| 97 | Ga0105239_10283319 | 3300010375 | Bacteria | 1866 |
| 98 | Ga0157374_10005993 | 3300013296 | Bacteria | 10286 |
| 99 | Ga0157374_10684516 | 3300013296 | Bacteria | 1038 |
| 100 | Ga0157378_10000198 | 3300013297 | Bacteria | 58644 |
| 101 | Ga0157378_10003225 | 3300013297 | Bacteria | 14512 |
| 102 | Ga0157378_10009498 | 3300013297 | Bacteria | 8471 |
| 103 | Ga0157378_10288127 | 3300013297 | Unclassified | 1585 |
| 104 | Ga0157378_10603656 | 3300013297 | Bacteria | 1109 |
| 105 | Ga0157372_10007582 | 3300013307 | Bacteria | 11538 |
| 106 | Ga0157375_10446243 | 3300013308 | Bacteria | 1459 |
| 107 | Ga0157375_11093208 | 3300013308 | Unclassified | 933 |
| 108 | Ga0157379_10033226 | 3300014968 | Bacteria | 4601 |
| 109 | Ga0157379_10517508 | 3300014968 | Unclassified | 1107 |
| 110 | Ga0157376_10000016 | 3300014969 | Bacteria | 271570 |
| 111 | Ga0157376_10042328 | 3300014969 | Bacteria | 3733 |
| 112 | Ga0213876_10060366 | 3300021384 | Bacteria | 2000 |
| 113 | Ga0228598_1008648 | 3300024227 | Unclassified | 2051 |
| 114 | Ga0207692_10032525 | 3300025898 | Bacteria | 2508 |
| 115 | Ga0207692_10042174 | 3300025898 | Unclassified | 2263 |
| 116 | Ga0207642_10152820 | 3300025899 | Unclassified | 1231 |
| 117 | Ga0207642_10568095 | 3300025899 | Unclassified | 702 |
| 118 | Ga0207685_10021892 | 3300025905 | Bacteria | 2151 |
| 119 | Ga0207685_10112692 | 3300025905 | Unclassified | 1181 |
| 120 | Ga0207685_10269124 | 3300025905 | Unclassified | 831 |
| 121 | Ga0207699_10003245 | 3300025906 | Bacteria | 7749 |
| 122 | Ga0207699_10044363 | 3300025906 | Bacteria | 2588 |
| 123 | Ga0207699_10215905 | 3300025906 | Unclassified | 1307 |
| 124 | Ga0207684_10025806 | 3300025910 | Bacteria | 5008 |
| 125 | Ga0207707_10159113 | 3300025912 | Bacteria | 1975 |
| 126 | Ga0207695_10474009 | 3300025913 | Unclassified | 1134 |
| 127 | Ga0207671_10337129 | 3300025914 | Bacteria | 1195 |
| 128 | Ga0207663_10127487 | 3300025916 | Bacteria | 1753 |
| 129 | Ga0207663_10592122 | 3300025916 | Unclassified | 871 |
| 130 | Ga0207652_10115049 | 3300025921 | Bacteria | 2389 |
| 131 | Ga0207646_10000016 | 3300025922 | Bacteria | 337048 |
| 132 | Ga0207646_10018417 | 3300025922 | Bacteria | 6514 |
| 133 | Ga0207646_10218066 | 3300025922 | Unclassified | 1724 |
| 134 | Ga0207646_10343991 | 3300025922 | Unclassified | 1348 |
| 135 | Ga0207646_10451527 | 3300025922 | Unclassified | 1160 |
| 136 | Ga0207687_10050497 | 3300025927 | Bacteria | 2895 |
| 137 | Ga0207700_10069665 | 3300025928 | Bacteria | 2700 |
| 138 | Ga0207700_10306497 | 3300025928 | Unclassified | 1372 |
| 139 | Ga0207664_10081292 | 3300025929 | Unclassified | 2636 |
| 140 | Ga0207704_10673638 | 3300025938 | Unclassified | 854 |
| 141 | Ga0207665_10000021 | 3300025939 | Bacteria | 111867 |
| 142 | Ga0207665_10006464 | 3300025939 | Bacteria | 7774 |
| 143 | Ga0207665_10008415 | 3300025939 | Bacteria | 6801 |
| 144 | Ga0207665_10009837 | 3300025939 | Bacteria | 6276 |
| 145 | Ga0207665_10051812 | 3300025939 | Unclassified | 2764 |
| 146 | Ga0207665_10074614 | 3300025939 | Bacteria | 2321 |
| 147 | Ga0207665_10329636 | 3300025939 | Unclassified | 1148 |
| 148 | Ga0207711_10304324 | 3300025941 | Unclassified | 1471 |
| 149 | Ga0207712_10037460 | 3300025961 | Bacteria | 3309 |
| 150 | Ga0207703_10135764 | 3300026035 | Unclassified | 2129 |
| 151 | Ga0207639_10598736 | 3300026041 | Unclassified | 1016 |
| 152 | Ga0207641_10062756 | 3300026088 | Unclassified | 3172 |
| 153 | Ga0209588_1004018 | 3300027671 | Bacteria | 4119 |
| 154 | Ga0209588_1009291 | 3300027671 | Unclassified | 2936 |
| 155 | Ga0209588_1018126 | 3300027671 | Unclassified | 2190 |
| 156 | Ga0209588_1027355 | 3300027671 | Unclassified | 1815 |
| 157 | Ga0209588_1044359 | 3300027671 | Bacteria | 1438 |
| 158 | Ga0209588_1053464 | 3300027671 | Unclassified | 1306 |
| 159 | Ga0209588_1057936 | 3300027671 | Unclassified | 1252 |
| 160 | Ga0209588_1092203 | 3300027671 | Unclassified | 976 |
| 161 | Ga0265354_1001811 | 3300028016 | Bacteria | 2899 |
| 162 | Ga0268266_10003263 | 3300028379 | Bacteria | 16350 |
| 163 | Ga0265338_10199072 | 3300028800 | Bacteria | 1512 |
| 164 | Ga0265338_10483147 | 3300028800 | Unclassified | 874 |
| 165 | Ga0265770_1000935 | 3300030878 | Unclassified | 4045 |
| 166 | Ga0265770_1001865 | 3300030878 | Bacteria | 2872 |
| 167 | Ga0265765_1004490 | 3300030879 | Bacteria | 1438 |
| 168 | Ga0265760_10042121 | 3300031090 | Bacteria | 1363 |
| 169 | Ga0265329_10036282 | 3300031242 | Bacteria | 1590 |
| 170 | Ga0265331_10005974 | 3300031250 | Bacteria | 7264 |
| 171 | Ga0265316_10016670 | 3300031344 | Bacteria | 6368 |
| 172 | Ga0316212_1002122 | 3300033547 | Bacteria | 2802 |
| 173 | Ga0373926_0000849 | 3300035083 | Bacteria | 8709 |
| 174 | Ga0373944_0069004 | 3300035089 | Unclassified | 1148 |
| 175 | Ga0373923_0088859 | 3300035111 | Unclassified | 1349 |
| 176 | Ga0373954_0005215 | 3300035118 | Bacteria | 5617 |
| 177 | Ga0373954_0107850 | 3300035118 | Bacteria | 1346 |
| 178 | Ga0373956_0001668 | 3300035119 | Bacteria | 9136 |
| 179 | Ga0373946_0082334 | 3300035171 | Bacteria | 1411 |
| 180 | Ga0373946_0133033 | 3300035171 | Bacteria | 1146 |
| 181 | Ga0373955_0001802 | 3300035172 | Bacteria | 9198 |
| 182 | Ga0373924_0319703 | 3300035410 | Unclassified | 690 |
| 183 | Ga0373931_0015943 | 3300035691 | Bacteria | 3693 |
| 184 | Ga0373927_0003574 | 3300035695 | Bacteria | 11096 |
| 185 | Ga0373933_0000917 | 3300035724 | Bacteria | 17999 |
| 186 | Ga0373947_0005373 | 3300035725 | Bacteria | 7479 |
| 187 | Ga0373947_0772415 | 3300035725 | Bacteria | 656 |
| 188 | Ga0373937_0001340 | 3300036401 | Bacteria | 20595 |
| 189 | Ga0373937_0077719 | 3300036401 | Unclassified | 3067 |
| 190 | Ga0373925_0004769 | 3300037068 | Bacteria | 10213 |
| 191 | Ga0373925_0102004 | 3300037068 | Bacteria | 2207 |
| 192 | Ga0436365_0964789 | 3300039437 | Bacteria | 2162 |
| 193 | Ga0495592_0004606 | 3300046454 | Bacteria | 10098 |
| 194 | Ga0495592_0023728 | 3300046454 | Bacteria | 4666 |
| 195 | Ga0495592_0154219 | 3300046454 | Bacteria | 1585 |
| 196 | Ga0495603_0048374 | 3300046455 | Bacteria | 2532 |
| 197 | Ga0495629_0570378 | 3300046459 | Unclassified | 758 |
| 198 | Ga0495651_0003427 | 3300046462 | Bacteria | 12166 |
| 199 | Ga0495653_0051035 | 3300046463 | Bacteria | 3178 |
| 200 | Ga0495580_0001299 | 3300046472 | Bacteria | 22058 |
| 201 | Ga0495580_0016104 | 3300046472 | Bacteria | 5620 |
| 202 | Ga0495580_0034860 | 3300046472 | Bacteria | 3621 |
| 203 | Ga0495580_0108652 | 3300046472 | Bacteria | 1926 |
| 204 | Ga0495580_0490639 | 3300046472 | Bacteria | 821 |
| 205 | Ga0495582_0002411 | 3300046473 | Bacteria | 10439 |
| 206 | Ga0495582_0080356 | 3300046473 | Bacteria | 1810 |
| 207 | Ga0495664_0344253 | 3300046477 | Unclassified | 898 |
| 208 | Ga0495608_0024656 | 3300046511 | Bacteria | 4110 |
| 209 | Ga0495618_0311854 | 3300046514 | Unclassified | 976 |
| 210 | Ga0495628_0006224 | 3300046516 | Bacteria | 10435 |
| 211 | Ga0495628_0025018 | 3300046516 | Bacteria | 4881 |
| 212 | Ga0495628_0092891 | 3300046516 | Unclassified | 2334 |
| 213 | Ga0495628_0573462 | 3300046516 | Unclassified | 808 |
| 214 | Ga0495630_0007168 | 3300046517 | Bacteria | 7947 |
| 215 | Ga0495630_0019533 | 3300046517 | Bacteria | 4982 |
| 216 | Ga0495630_0820772 | 3300046517 | Unclassified | 710 |
| 217 | Ga0495652_0002423 | 3300046529 | Bacteria | 19233 |
| 218 | Ga0495640_0066004 | 3300046533 | Bacteria | 2441 |
| 219 | Ga0495586_0161916 | 3300046535 | Bacteria | 1262 |
| 220 | Ga0495586_0201466 | 3300046535 | Unclassified | 1128 |
| 221 | Ga0495587_0002796 | 3300046536 | Bacteria | 11662 |
| 222 | Ga0495587_0010885 | 3300046536 | Bacteria | 5773 |
| 223 | Ga0495645_0002527 | 3300046543 | Bacteria | 12421 |
| 224 | Ga0495645_0437505 | 3300046543 | Unclassified | 827 |
| 225 | Ga0495667_0007047 | 3300046559 | Bacteria | 7629 |
| 226 | Ga0495667_0630429 | 3300046559 | Unclassified | 667 |
| 227 | Ga0495635_0449605 | 3300046663 | Unclassified | 852 |
| 228 | Ga0495657_0279479 | 3300046675 | Unclassified | 999 |
| 229 | Ga0495599_0018302 | 3300046678 | Bacteria | 4365 |
| 230 | Ga0495623_0119428 | 3300046679 | Bacteria | 1588 |
| 231 | Ga0495658_0012449 | 3300046683 | Bacteria | 4308 |
| 232 | Ga0495613_0122842 | 3300046689 | Bacteria | 1863 |
| 233 | Ga0495624_0299475 | 3300046690 | Unclassified | 970 |
| 234 | Ga0495600_0006869 | 3300046809 | Bacteria | 6939 |
| 235 | Ga0495600_0323044 | 3300046809 | Unclassified | 970 |
| 236 | Ga0495604_0000316 | 3300047317 | Bacteria | 43437 |
| 237 | Ga0495604_0016599 | 3300047317 | Bacteria | 5887 |
| 238 | Ga0495604_0178933 | 3300047317 | Bacteria | 1485 |
| 239 | Ga0495674_0018036 | 3300047319 | Bacteria | 6571 |
| 240 | Ga0495674_0032723 | 3300047319 | Unclassified | 4714 |
| 241 | Ga0495674_0059376 | 3300047319 | Bacteria | 3340 |
| 242 | Ga0495674_0178397 | 3300047319 | Bacteria | 1770 |
| 243 | Ga0495676_0066621 | 3300047321 | Bacteria | 2790 |
| 244 | Ga0495680_0000656 | 3300047322 | Bacteria | 38851 |
| 245 | Ga0495675_0000393 | 3300047444 | Bacteria | 30249 |
| 246 | Ga0495675_0059215 | 3300047444 | Unclassified | 2428 |
| 247 | Ga0495675_0133101 | 3300047444 | Unclassified | 1545 |
| 248 | Ga0495684_0003953 | 3300047471 | Bacteria | 11554 |
| 249 | Ga0495684_0006074 | 3300047471 | Bacteria | 9391 |
| 250 | Ga0495684_0019139 | 3300047471 | Bacteria | 5272 |
| 251 | Ga0495684_0056813 | 3300047471 | Bacteria | 2983 |
| 252 | Ga0495602_0001331 | 3300048088 | Bacteria | 24377 |
| 253 | Ga0495602_0265309 | 3300048088 | Bacteria | 1272 |
| 254 | Ga0496102_0038313 | 3300048905 | Unclassified | 4326 |
| 255 | Ga0496104_0172445 | 3300048907 | Bacteria | 2074 |
| 256 | Ga0496106_0108047 | 3300048909 | Unclassified | 2164 |
| 257 | Ga0496110_0181716 | 3300048913 | Bacteria | 1910 |
| 258 | Ga0496114_0006674 | 3300048917 | Bacteria | 9095 |
| 259 | Ga0496115_0004071 | 3300048918 | Bacteria | 10563 |
| 260 | Ga0496115_0004873 | 3300048918 | Bacteria | 9741 |
| 261 | Ga0496115_0032873 | 3300048918 | Bacteria | 4095 |
| 262 | nmdc:mga0rr50_145372_c1 | 3300050513 | Bacteria | 1911 |
| 263 | nmdc:mga0rr50_693661_c1 | 3300050513 | Bacteria | 869 |
| 264 | nmdc:mga08x19_16589_c1 | 3300050514 | Unclassified | 4494 |
| 265 | nmdc:mga08x19_188_c1 | 3300050514 | Bacteria | 49158 |
| 266 | nmdc:mga08x19_210512_c1 | 3300050514 | Bacteria | 1334 |
| 267 | nmdc:mga08x19_214416_c1 | 3300050514 | Unclassified | 1322 |
| 268 | nmdc:mga08x19_43984_c1 | 3300050514 | Bacteria | 2850 |
| 269 | nmdc:mga08x19_62675_c1 | 3300050514 | Bacteria | 2411 |
| 270 | Ga0495619_0030759 | 3300053085 | Unclassified | 3475 |
| 271 | Ga0495619_0607480 | 3300053085 | Bacteria | 748 |
| 272 | Ga0265765_1004419 | |||
| 273 | Ga0070709_10005144 | |||
| 274 | Ga0070709_10111887 | |||
| 275 | Ga0070709_10211727 | |||
| 276 | Ga0070714_100053349 | |||
| 277 | Ga0070713_100064904 | |||
| 278 | Ga0070713_100283772 | |||
| 279 | Ga0070710_10029304 | |||
| 280 | Ga0070710_10263214 | |||
| 281 | Ga0070711_100017469 | |||
| 282 | Ga0070711_100648639 | |||
| 283 | Ga0070705_100156200 | |||
| 284 | Ga0070705_100653644 | |||
| 285 | Ga0070708_100001728 | |||
| 286 | Ga0070708_100047173 | |||
| 287 | Ga0070708_100060288 | |||
| 288 | Ga0070708_100124696 | |||
| 289 | Ga0070685_10188548 | |||
| 290 | Ga0070706_100165273 | |||
| 291 | Ga0070706_100182901 | |||
| 292 | Ga0070706_100326699 | |||
| 293 | Ga0070706_100716830 | |||
| 294 | Ga0070706_100773582 | |||
| 295 | Ga0070707_100000208 | |||
| 296 | Ga0070707_100106345 | |||
| 297 | Ga0070707_100123709 | |||
| 298 | Ga0070707_100227995 | |||
| 299 | Ga0070707_100260765 | |||
| 300 | Ga0070707_100432143 | |||
| 301 | Ga0070707_100892829 | |||
| 302 | Ga0070699_100118733 | |||
| 303 | Ga0070679_100100128 | |||
| 304 | Ga0070697_100000132 | |||
| 305 | Ga0070697_100016483 | |||
| 306 | Ga0070697_100052290 | |||
| 307 | Ga0070697_100194070 | |||
| 308 | Ga0070697_100263449 | |||
| 309 | Ga0070697_100291217 | |||
| 310 | Ga0070697_100431791 | |||
| 311 | Ga0070697_100750304 | |||
| 312 | Ga0070686_100159728 | |||
| 313 | Ga0070695_100024189 | |||
| 314 | Ga0070696_100006012 | |||
| 315 | Ga0070665_100007185 | |||
| 316 | Ga0070704_100104781 | |||
| 317 | Ga0068866_10352820 | |||
| 318 | Ga0068863_100003171 | |||
| 319 | Ga0068860_100007420 | |||
| 320 | Ga0068860_100346735 | |||
| 321 | Ga0068862_100609167 | |||
| 322 | Ga0081540_1108655 | |||
| 323 | Ga0070717_10401144 | |||
| 324 | Ga0070717_10470801 | |||
| 325 | Ga0070715_10117154 | |||
| 326 | Ga0070715_10152038 | |||
| 327 | Ga0070715_10357886 | |||
| 328 | Ga0070715_10571168 | |||
| 329 | Ga0070716_100002680 | |||
| 330 | Ga0070716_100006003 | |||
| 331 | Ga0070716_100031132 | |||
| 332 | Ga0070716_100067263 | |||
| 333 | Ga0070716_100121392 | |||
| 334 | Ga0070712_100037508 | |||
| 335 | Ga0070712_100047243 | |||
| 336 | Ga0097621_100002044 | |||
| 337 | Ga0068871_100030116 | |||
| 338 | Ga0075434_100150082 | |||
| 339 | Ga0068865_100756358 | |||
| 340 | Ga0075436_100000280 | |||
| 341 | Ga0075436_100329242 | |||
| 342 | Ga0075435_100078736 | |||
| 343 | Ga0075435_100089205 | |||
| 344 | Ga0099794_10002221 | |||
| 345 | Ga0099794_10006506 | |||
| 346 | Ga0099794_10009472 | |||
| 347 | Ga0099794_10013716 | |||
| 348 | Ga0099794_10016621 | |||
| 349 | Ga0099794_10031590 | |||
| 350 | Ga0099794_10045821 | |||
| 351 | Ga0099794_10056845 | |||
| 352 | Ga0099794_10056849 | |||
| 353 | Ga0099794_10062451 | |||
| 354 | Ga0099794_10080561 | |||
| 355 | Ga0099794_10178216 | |||
| 356 | Ga0099795_10016584 | |||
| 357 | Ga0099795_10041481 | |||
| 358 | Ga0105240_10098443 | |||
| 359 | Ga0105245_10035006 | |||
| 360 | Ga0105243_10070684 | |||
| 361 | Ga0105241_10984298 | |||
| 362 | Ga0105237_10014789 | |||
| 363 | Ga0105237_10643769 | |||
| 364 | Ga0105249_10196353 | |||
| 365 | Ga0099796_10001986 | |||
| 366 | Ga0099796_10022046 | |||
| 367 | Ga0099796_10274072 | |||
| 368 | Ga0105239_10283319 | |||
| 369 | Ga0157374_10005993 | |||
| 370 | Ga0157374_10684516 | |||
| 371 | Ga0157378_10000198 | |||
| 372 | Ga0157378_10003225 | |||
| 373 | Ga0157378_10009498 | |||
| 374 | Ga0157378_10288127 | |||
| 375 | Ga0157378_10603656 | |||
| 376 | Ga0157372_10007582 | |||
| 377 | Ga0157375_10446243 | |||
| 378 | Ga0157375_11093208 | |||
| 379 | Ga0157379_10033226 | |||
| 380 | Ga0157379_10517508 | |||
| 381 | Ga0157376_10000016 | |||
| 382 | Ga0157376_10042328 | |||
| 383 | Ga0213876_10060366 | |||
| 384 | Ga0228598_1008648 | |||
| 385 | Ga0207692_10032525 | |||
| 386 | Ga0207692_10042174 | |||
| 387 | Ga0207642_10152820 | |||
| 388 | Ga0207642_10568095 | |||
| 389 | Ga0207685_10021892 | |||
| 390 | Ga0207685_10112692 | |||
| 391 | Ga0207685_10269124 | |||
| 392 | Ga0207699_10003245 | |||
| 393 | Ga0207699_10044363 | |||
| 394 | Ga0207699_10215905 | |||
| 395 | Ga0207684_10025806 | |||
| 396 | Ga0207707_10159113 | |||
| 397 | Ga0207695_10474009 | |||
| 398 | Ga0207671_10337129 | |||
| 399 | Ga0207663_10127487 | |||
| 400 | Ga0207663_10592122 | |||
| 401 | Ga0207652_10115049 | |||
| 402 | Ga0207646_10000016 | |||
| 403 | Ga0207646_10018417 | |||
| 404 | Ga0207646_10218066 | |||
| 405 | Ga0207646_10343991 | |||
| 406 | Ga0207646_10451527 | |||
| 407 | Ga0207687_10050497 | |||
| 408 | Ga0207700_10069665 | |||
| 409 | Ga0207700_10306497 | |||
| 410 | Ga0207664_10081292 | |||
| 411 | Ga0207704_10673638 | |||
| 412 | Ga0207665_10000021 | |||
| 413 | Ga0207665_10006464 | |||
| 414 | Ga0207665_10008415 | |||
| 415 | Ga0207665_10009837 | |||
| 416 | Ga0207665_10051812 | |||
| 417 | Ga0207665_10074614 | |||
| 418 | Ga0207665_10329636 | |||
| 419 | Ga0207711_10304324 | |||
| 420 | Ga0207712_10037460 | |||
| 421 | Ga0207703_10135764 | |||
| 422 | Ga0207639_10598736 | |||
| 423 | Ga0207641_10062756 | |||
| 424 | Ga0209588_1004018 | |||
| 425 | Ga0209588_1009291 | |||
| 426 | Ga0209588_1018126 | |||
| 427 | Ga0209588_1027355 | |||
| 428 | Ga0209588_1044359 | |||
| 429 | Ga0209588_1053464 | |||
| 430 | Ga0209588_1057936 | |||
| 431 | Ga0209588_1092203 | |||
| 432 | Ga0265354_1001811 | |||
| 433 | Ga0268266_10003263 | |||
| 434 | Ga0265338_10199072 | |||
| 435 | Ga0265338_10483147 | |||
| 436 | Ga0265770_1000935 | |||
| 437 | Ga0265770_1001865 | |||
| 438 | Ga0265765_1004490 | |||
| 439 | Ga0265760_10042121 | |||
| 440 | Ga0265329_10036282 | |||
| 441 | Ga0265331_10005974 | |||
| 442 | Ga0265316_10016670 | |||
| 443 | Ga0316212_1002122 | |||
| 444 | Ga0373926_0000849 | |||
| 445 | Ga0373944_0069004 | |||
| 446 | Ga0373923_0088859 | |||
| 447 | Ga0373954_0005215 | |||
| 448 | Ga0373954_0107850 | |||
| 449 | Ga0373956_0001668 | |||
| 450 | Ga0373946_0082334 | |||
| 451 | Ga0373946_0133033 | |||
| 452 | Ga0373955_0001802 | |||
| 453 | Ga0373924_0319703 | |||
| 454 | Ga0373931_0015943 | |||
| 455 | Ga0373927_0003574 | |||
| 456 | Ga0373933_0000917 | |||
| 457 | Ga0373947_0005373 | |||
| 458 | Ga0373947_0772415 | |||
| 459 | Ga0373937_0001340 | |||
| 460 | Ga0373937_0077719 | |||
| 461 | Ga0373925_0004769 | |||
| 462 | Ga0373925_0102004 | |||
| 463 | Ga0436365_0964789 | |||
| 464 | Ga0495592_0004606 | |||
| 465 | Ga0495592_0023728 | |||
| 466 | Ga0495592_0154219 | |||
| 467 | Ga0495603_0048374 | |||
| 468 | Ga0495629_0570378 | |||
| 469 | Ga0495651_0003427 | |||
| 470 | Ga0495653_0051035 | |||
| 471 | Ga0495580_0001299 | |||
| 472 | Ga0495580_0016104 | |||
| 473 | Ga0495580_0034860 | |||
| 474 | Ga0495580_0108652 | |||
| 475 | Ga0495580_0490639 | |||
| 476 | Ga0495582_0002411 | |||
| 477 | Ga0495582_0080356 | |||
| 478 | Ga0495664_0344253 | |||
| 479 | Ga0495608_0024656 | |||
| 480 | Ga0495618_0311854 | |||
| 481 | Ga0495628_0006224 | |||
| 482 | Ga0495628_0025018 | |||
| 483 | Ga0495628_0092891 | |||
| 484 | Ga0495628_0573462 | |||
| 485 | Ga0495630_0007168 | |||
| 486 | Ga0495630_0019533 | |||
| 487 | Ga0495630_0820772 | |||
| 488 | Ga0495652_0002423 | |||
| 489 | Ga0495640_0066004 | |||
| 490 | Ga0495586_0161916 | |||
| 491 | Ga0495586_0201466 | |||
| 492 | Ga0495587_0002796 | |||
| 493 | Ga0495587_0010885 | |||
| 494 | Ga0495645_0002527 | |||
| 495 | Ga0495645_0437505 | |||
| 496 | Ga0495667_0007047 | |||
| 497 | Ga0495667_0630429 | |||
| 498 | Ga0495635_0449605 | |||
| 499 | Ga0495657_0279479 | |||
| 500 | Ga0495599_0018302 | |||
| 501 | Ga0495623_0119428 | |||
| 502 | Ga0495658_0012449 | |||
| 503 | Ga0495613_0122842 | |||
| 504 | Ga0495624_0299475 | |||
| 505 | Ga0495600_0006869 | |||
| 506 | Ga0495600_0323044 | |||
| 507 | Ga0495604_0000316 | |||
| 508 | Ga0495604_0016599 | |||
| 509 | Ga0495604_0178933 | |||
| 510 | Ga0495674_0018036 | |||
| 511 | Ga0495674_0032723 | |||
| 512 | Ga0495674_0059376 | |||
| 513 | Ga0495674_0178397 | |||
| 514 | Ga0495676_0066621 | |||
| 515 | Ga0495680_0000656 | |||
| 516 | Ga0495675_0000393 | |||
| 517 | Ga0495675_0059215 | |||
| 518 | Ga0495675_0133101 | |||
| 519 | Ga0495684_0003953 | |||
| 520 | Ga0495684_0006074 | |||
| 521 | Ga0495684_0019139 | |||
| 522 | Ga0495684_0056813 | |||
| 523 | Ga0495602_0001331 | |||
| 524 | Ga0495602_0265309 | |||
| 525 | Ga0496102_0038313 | |||
| 526 | Ga0496104_0172445 | |||
| 527 | Ga0496106_0108047 | |||
| 528 | Ga0496110_0181716 | |||
| 529 | Ga0496114_0006674 | |||
| 530 | Ga0496115_0004071 | |||
| 531 | Ga0496115_0004873 | |||
| 532 | Ga0496115_0032873 | |||
| 533 | nmdc:mga0rr50_145372_c1 | |||
| 534 | nmdc:mga0rr50_693661_c1 | |||
| 535 | nmdc:mga08x19_16589_c1 | |||
| 536 | nmdc:mga08x19_188_c1 | |||
| 537 | nmdc:mga08x19_210512_c1 | |||
| 538 | nmdc:mga08x19_214416_c1 | |||
| 539 | nmdc:mga08x19_43984_c1 | |||
| 540 | nmdc:mga08x19_62675_c1 | |||
| 541 | Ga0495619_0030759 | |||
| 542 | Ga0495619_0607480 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h2v-assembly2.cif.gz_B | human raver1 rrm1 domain in complex with human vinculin tail domain vt | 0.3119 | 11 | 164 |
| 3h2v-assembly2.cif.gz_B | human raver1 rrm1 domain in complex with human vinculin tail domain vt | 0.2807 | 11 | 164 |
| 4q7c-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase | 0.2768 | 10 | 166 |
| 8tno-assembly1.cif.gz_A | unc_239 from chroma generative model | 0.2642 | 2 | 169 |
| 3g7r-assembly1.cif.gz_B | crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor | 0.263 | 7 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8934 | 42 | 158 | 1.10.1760.20 |
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8504 | 42 | 158 | 1.10.1760.20 |
| af_Q95XZ5_1825_2025_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3678 | 2 | 144 | 1.25.10.10 |
| af_A0A0R0GV15_321_483_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3677 | 10 | 169 | 1.20.1250.20 |
| af_A5HEI1_1388_1587_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3496 | 11 | 142 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8WNV9-F1-model_v4 | VTT domain-containing protein | 0.9179 | 1 | 204 |
GO:0005886
|
| AF-A0A2V8WNV9-F1-model_v4 | VTT domain-containing protein | 0.9136 | 1 | 204 |
GO:0005886
|
| AF-A0A7C6A4S7-F1-model_v4 | VTT domain-containing protein | 0.9112 | 8 | 197 |
GO:0016020
|
| AF-A0A2V9BMC7-F1-model_v4 | VTT domain-containing protein | 0.9103 | 1 | 204 |
GO:0016020
|
| AF-A0A7C4BW85-F1-model_v4 | VTT domain-containing protein | 0.9077 | 10 | 202 |
GO:0005886
|