F377730

General Info

Members Datasets Scaffolds Average Seq Length
271 140 542 203

Family's Representative Sequence

Representative Sequence 3300030879|Ga0265765_1004419|Ga0265765_10044191
Length 193
Sequence LSLSLSGWKQKIIAFASGLGAPGLFLISFLDSSVLSFPIINDLLLINLSMRNHARMPLYALMAATGSVLGCVLLYFLARMGGEAYFHRKAGARAHAIRHWVERNGFGGMLIAALLPPPTPFKIFVFAAGVFEAPLFGRYFGVGYLAVRYGADAMPYLAAHKLQVTAIVIALVVVSYGLSRWILRHQPHQEIPK

Samples

Sample ID Description Type Environment
1 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 36.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265765_1004419 3300030879 Unclassified 1446
2 Ga0070709_10005144 3300005434 Bacteria 7077
3 Ga0070709_10111887 3300005434 Bacteria 1836
4 Ga0070709_10211727 3300005434 Unclassified 1378
5 Ga0070714_100053349 3300005435 Unclassified 3451
6 Ga0070713_100064904 3300005436 Bacteria 3065
7 Ga0070713_100283772 3300005436 Unclassified 1520
8 Ga0070710_10029304 3300005437 Bacteria 2953
9 Ga0070710_10263214 3300005437 Unclassified 1113
10 Ga0070711_100017469 3300005439 Bacteria 4569
11 Ga0070711_100648639 3300005439 Unclassified 885
12 Ga0070705_100156200 3300005440 Unclassified 1519
13 Ga0070705_100653644 3300005440 Unclassified 820
14 Ga0070708_100001728 3300005445 Bacteria 16788
15 Ga0070708_100047173 3300005445 Unclassified 3804
16 Ga0070708_100060288 3300005445 Bacteria 3386
17 Ga0070708_100124696 3300005445 Bacteria 2379
18 Ga0070685_10188548 3300005466 Bacteria 1332
19 Ga0070706_100165273 3300005467 Bacteria 2067
20 Ga0070706_100182901 3300005467 Unclassified 1957
21 Ga0070706_100326699 3300005467 Unclassified 1430
22 Ga0070706_100716830 3300005467 Unclassified 927
23 Ga0070706_100773582 3300005467 Bacteria 889
24 Ga0070707_100000208 3300005468 Bacteria 58895
25 Ga0070707_100106345 3300005468 Bacteria 2721
26 Ga0070707_100123709 3300005468 Bacteria 2512
27 Ga0070707_100227995 3300005468 Bacteria 1814
28 Ga0070707_100260765 3300005468 Bacteria 1686
29 Ga0070707_100432143 3300005468 Unclassified 1277
30 Ga0070707_100892829 3300005468 Bacteria 853
31 Ga0070699_100118733 3300005518 Bacteria 2325
32 Ga0070679_100100128 3300005530 Bacteria 2885
33 Ga0070697_100000132 3300005536 Bacteria 59826
34 Ga0070697_100016483 3300005536 Bacteria 5813
35 Ga0070697_100052290 3300005536 Unclassified 3319
36 Ga0070697_100194070 3300005536 Bacteria 1724
37 Ga0070697_100263449 3300005536 Unclassified 1476
38 Ga0070697_100291217 3300005536 Unclassified 1402
39 Ga0070697_100431791 3300005536 Bacteria 1146
40 Ga0070697_100750304 3300005536 Unclassified 862
41 Ga0070686_100159728 3300005544 Bacteria 1586
42 Ga0070695_100024189 3300005545 Bacteria 3740
43 Ga0070696_100006012 3300005546 Bacteria 8099
44 Ga0070665_100007185 3300005548 Bacteria 11320
45 Ga0070704_100104781 3300005549 Bacteria 2140
46 Ga0068866_10352820 3300005718 Unclassified 935
47 Ga0068863_100003171 3300005841 Bacteria 16256
48 Ga0068860_100007420 3300005843 Bacteria 10967
49 Ga0068860_100346735 3300005843 Unclassified 1461
50 Ga0068862_100609167 3300005844 Bacteria 1049
51 Ga0081540_1108655 3300005983 Bacteria 1178
52 Ga0070717_10401144 3300006028 Unclassified 1232
53 Ga0070717_10470801 3300006028 Unclassified 1134
54 Ga0070715_10117154 3300006163 Unclassified 1265
55 Ga0070715_10152038 3300006163 Unclassified 1135
56 Ga0070715_10357886 3300006163 Unclassified 799
57 Ga0070715_10571168 3300006163 Unclassified 659
58 Ga0070716_100002680 3300006173 Bacteria 8236
59 Ga0070716_100006003 3300006173 Bacteria 5914
60 Ga0070716_100031132 3300006173 Bacteria 2900
61 Ga0070716_100067263 3300006173 Bacteria 2093
62 Ga0070716_100121392 3300006173 Unclassified 1636
63 Ga0070712_100037508 3300006175 Unclassified 3305
64 Ga0070712_100047243 3300006175 Bacteria 2978
65 Ga0097621_100002044 3300006237 Bacteria 13803
66 Ga0068871_100030116 3300006358 Bacteria 4271
67 Ga0075434_100150082 3300006871 Unclassified 2351
68 Ga0068865_100756358 3300006881 Unclassified 835
69 Ga0075436_100000280 3300006914 Bacteria 32243
70 Ga0075436_100329242 3300006914 Bacteria 1098
71 Ga0075435_100078736 3300007076 Bacteria 2703
72 Ga0075435_100089205 3300007076 Bacteria 2542
73 Ga0099794_10002221 3300007265 Bacteria 7093
74 Ga0099794_10006506 3300007265 Bacteria 4738
75 Ga0099794_10009472 3300007265 Unclassified 4097
76 Ga0099794_10013716 3300007265 Bacteria 3535
77 Ga0099794_10016621 3300007265 Unclassified 3265
78 Ga0099794_10031590 3300007265 Bacteria 2480
79 Ga0099794_10045821 3300007265 Unclassified 2093
80 Ga0099794_10056845 3300007265 Bacteria 1894
81 Ga0099794_10056849 3300007265 Bacteria 1894
82 Ga0099794_10062451 3300007265 Unclassified 1811
83 Ga0099794_10080561 3300007265 Bacteria 1606
84 Ga0099794_10178216 3300007265 Bacteria 1084
85 Ga0099795_10016584 3300007788 Eukaryota 2332
86 Ga0099795_10041481 3300007788 Unclassified 1639
87 Ga0105240_10098443 3300009093 Unclassified 3562
88 Ga0105245_10035006 3300009098 Bacteria 4455
89 Ga0105243_10070684 3300009148 Unclassified 2819
90 Ga0105241_10984298 3300009174 Unclassified 788
91 Ga0105237_10014789 3300009545 Bacteria 8144
92 Ga0105237_10643769 3300009545 Unclassified 1067
93 Ga0105249_10196353 3300009553 Unclassified 1972
94 Ga0099796_10001986 3300010159 Bacteria 4353
95 Ga0099796_10022046 3300010159 Unclassified 1971
96 Ga0099796_10274072 3300010159 Unclassified 708
97 Ga0105239_10283319 3300010375 Bacteria 1866
98 Ga0157374_10005993 3300013296 Bacteria 10286
99 Ga0157374_10684516 3300013296 Bacteria 1038
100 Ga0157378_10000198 3300013297 Bacteria 58644
101 Ga0157378_10003225 3300013297 Bacteria 14512
102 Ga0157378_10009498 3300013297 Bacteria 8471
103 Ga0157378_10288127 3300013297 Unclassified 1585
104 Ga0157378_10603656 3300013297 Bacteria 1109
105 Ga0157372_10007582 3300013307 Bacteria 11538
106 Ga0157375_10446243 3300013308 Bacteria 1459
107 Ga0157375_11093208 3300013308 Unclassified 933
108 Ga0157379_10033226 3300014968 Bacteria 4601
109 Ga0157379_10517508 3300014968 Unclassified 1107
110 Ga0157376_10000016 3300014969 Bacteria 271570
111 Ga0157376_10042328 3300014969 Bacteria 3733
112 Ga0213876_10060366 3300021384 Bacteria 2000
113 Ga0228598_1008648 3300024227 Unclassified 2051
114 Ga0207692_10032525 3300025898 Bacteria 2508
115 Ga0207692_10042174 3300025898 Unclassified 2263
116 Ga0207642_10152820 3300025899 Unclassified 1231
117 Ga0207642_10568095 3300025899 Unclassified 702
118 Ga0207685_10021892 3300025905 Bacteria 2151
119 Ga0207685_10112692 3300025905 Unclassified 1181
120 Ga0207685_10269124 3300025905 Unclassified 831
121 Ga0207699_10003245 3300025906 Bacteria 7749
122 Ga0207699_10044363 3300025906 Bacteria 2588
123 Ga0207699_10215905 3300025906 Unclassified 1307
124 Ga0207684_10025806 3300025910 Bacteria 5008
125 Ga0207707_10159113 3300025912 Bacteria 1975
126 Ga0207695_10474009 3300025913 Unclassified 1134
127 Ga0207671_10337129 3300025914 Bacteria 1195
128 Ga0207663_10127487 3300025916 Bacteria 1753
129 Ga0207663_10592122 3300025916 Unclassified 871
130 Ga0207652_10115049 3300025921 Bacteria 2389
131 Ga0207646_10000016 3300025922 Bacteria 337048
132 Ga0207646_10018417 3300025922 Bacteria 6514
133 Ga0207646_10218066 3300025922 Unclassified 1724
134 Ga0207646_10343991 3300025922 Unclassified 1348
135 Ga0207646_10451527 3300025922 Unclassified 1160
136 Ga0207687_10050497 3300025927 Bacteria 2895
137 Ga0207700_10069665 3300025928 Bacteria 2700
138 Ga0207700_10306497 3300025928 Unclassified 1372
139 Ga0207664_10081292 3300025929 Unclassified 2636
140 Ga0207704_10673638 3300025938 Unclassified 854
141 Ga0207665_10000021 3300025939 Bacteria 111867
142 Ga0207665_10006464 3300025939 Bacteria 7774
143 Ga0207665_10008415 3300025939 Bacteria 6801
144 Ga0207665_10009837 3300025939 Bacteria 6276
145 Ga0207665_10051812 3300025939 Unclassified 2764
146 Ga0207665_10074614 3300025939 Bacteria 2321
147 Ga0207665_10329636 3300025939 Unclassified 1148
148 Ga0207711_10304324 3300025941 Unclassified 1471
149 Ga0207712_10037460 3300025961 Bacteria 3309
150 Ga0207703_10135764 3300026035 Unclassified 2129
151 Ga0207639_10598736 3300026041 Unclassified 1016
152 Ga0207641_10062756 3300026088 Unclassified 3172
153 Ga0209588_1004018 3300027671 Bacteria 4119
154 Ga0209588_1009291 3300027671 Unclassified 2936
155 Ga0209588_1018126 3300027671 Unclassified 2190
156 Ga0209588_1027355 3300027671 Unclassified 1815
157 Ga0209588_1044359 3300027671 Bacteria 1438
158 Ga0209588_1053464 3300027671 Unclassified 1306
159 Ga0209588_1057936 3300027671 Unclassified 1252
160 Ga0209588_1092203 3300027671 Unclassified 976
161 Ga0265354_1001811 3300028016 Bacteria 2899
162 Ga0268266_10003263 3300028379 Bacteria 16350
163 Ga0265338_10199072 3300028800 Bacteria 1512
164 Ga0265338_10483147 3300028800 Unclassified 874
165 Ga0265770_1000935 3300030878 Unclassified 4045
166 Ga0265770_1001865 3300030878 Bacteria 2872
167 Ga0265765_1004490 3300030879 Bacteria 1438
168 Ga0265760_10042121 3300031090 Bacteria 1363
169 Ga0265329_10036282 3300031242 Bacteria 1590
170 Ga0265331_10005974 3300031250 Bacteria 7264
171 Ga0265316_10016670 3300031344 Bacteria 6368
172 Ga0316212_1002122 3300033547 Bacteria 2802
173 Ga0373926_0000849 3300035083 Bacteria 8709
174 Ga0373944_0069004 3300035089 Unclassified 1148
175 Ga0373923_0088859 3300035111 Unclassified 1349
176 Ga0373954_0005215 3300035118 Bacteria 5617
177 Ga0373954_0107850 3300035118 Bacteria 1346
178 Ga0373956_0001668 3300035119 Bacteria 9136
179 Ga0373946_0082334 3300035171 Bacteria 1411
180 Ga0373946_0133033 3300035171 Bacteria 1146
181 Ga0373955_0001802 3300035172 Bacteria 9198
182 Ga0373924_0319703 3300035410 Unclassified 690
183 Ga0373931_0015943 3300035691 Bacteria 3693
184 Ga0373927_0003574 3300035695 Bacteria 11096
185 Ga0373933_0000917 3300035724 Bacteria 17999
186 Ga0373947_0005373 3300035725 Bacteria 7479
187 Ga0373947_0772415 3300035725 Bacteria 656
188 Ga0373937_0001340 3300036401 Bacteria 20595
189 Ga0373937_0077719 3300036401 Unclassified 3067
190 Ga0373925_0004769 3300037068 Bacteria 10213
191 Ga0373925_0102004 3300037068 Bacteria 2207
192 Ga0436365_0964789 3300039437 Bacteria 2162
193 Ga0495592_0004606 3300046454 Bacteria 10098
194 Ga0495592_0023728 3300046454 Bacteria 4666
195 Ga0495592_0154219 3300046454 Bacteria 1585
196 Ga0495603_0048374 3300046455 Bacteria 2532
197 Ga0495629_0570378 3300046459 Unclassified 758
198 Ga0495651_0003427 3300046462 Bacteria 12166
199 Ga0495653_0051035 3300046463 Bacteria 3178
200 Ga0495580_0001299 3300046472 Bacteria 22058
201 Ga0495580_0016104 3300046472 Bacteria 5620
202 Ga0495580_0034860 3300046472 Bacteria 3621
203 Ga0495580_0108652 3300046472 Bacteria 1926
204 Ga0495580_0490639 3300046472 Bacteria 821
205 Ga0495582_0002411 3300046473 Bacteria 10439
206 Ga0495582_0080356 3300046473 Bacteria 1810
207 Ga0495664_0344253 3300046477 Unclassified 898
208 Ga0495608_0024656 3300046511 Bacteria 4110
209 Ga0495618_0311854 3300046514 Unclassified 976
210 Ga0495628_0006224 3300046516 Bacteria 10435
211 Ga0495628_0025018 3300046516 Bacteria 4881
212 Ga0495628_0092891 3300046516 Unclassified 2334
213 Ga0495628_0573462 3300046516 Unclassified 808
214 Ga0495630_0007168 3300046517 Bacteria 7947
215 Ga0495630_0019533 3300046517 Bacteria 4982
216 Ga0495630_0820772 3300046517 Unclassified 710
217 Ga0495652_0002423 3300046529 Bacteria 19233
218 Ga0495640_0066004 3300046533 Bacteria 2441
219 Ga0495586_0161916 3300046535 Bacteria 1262
220 Ga0495586_0201466 3300046535 Unclassified 1128
221 Ga0495587_0002796 3300046536 Bacteria 11662
222 Ga0495587_0010885 3300046536 Bacteria 5773
223 Ga0495645_0002527 3300046543 Bacteria 12421
224 Ga0495645_0437505 3300046543 Unclassified 827
225 Ga0495667_0007047 3300046559 Bacteria 7629
226 Ga0495667_0630429 3300046559 Unclassified 667
227 Ga0495635_0449605 3300046663 Unclassified 852
228 Ga0495657_0279479 3300046675 Unclassified 999
229 Ga0495599_0018302 3300046678 Bacteria 4365
230 Ga0495623_0119428 3300046679 Bacteria 1588
231 Ga0495658_0012449 3300046683 Bacteria 4308
232 Ga0495613_0122842 3300046689 Bacteria 1863
233 Ga0495624_0299475 3300046690 Unclassified 970
234 Ga0495600_0006869 3300046809 Bacteria 6939
235 Ga0495600_0323044 3300046809 Unclassified 970
236 Ga0495604_0000316 3300047317 Bacteria 43437
237 Ga0495604_0016599 3300047317 Bacteria 5887
238 Ga0495604_0178933 3300047317 Bacteria 1485
239 Ga0495674_0018036 3300047319 Bacteria 6571
240 Ga0495674_0032723 3300047319 Unclassified 4714
241 Ga0495674_0059376 3300047319 Bacteria 3340
242 Ga0495674_0178397 3300047319 Bacteria 1770
243 Ga0495676_0066621 3300047321 Bacteria 2790
244 Ga0495680_0000656 3300047322 Bacteria 38851
245 Ga0495675_0000393 3300047444 Bacteria 30249
246 Ga0495675_0059215 3300047444 Unclassified 2428
247 Ga0495675_0133101 3300047444 Unclassified 1545
248 Ga0495684_0003953 3300047471 Bacteria 11554
249 Ga0495684_0006074 3300047471 Bacteria 9391
250 Ga0495684_0019139 3300047471 Bacteria 5272
251 Ga0495684_0056813 3300047471 Bacteria 2983
252 Ga0495602_0001331 3300048088 Bacteria 24377
253 Ga0495602_0265309 3300048088 Bacteria 1272
254 Ga0496102_0038313 3300048905 Unclassified 4326
255 Ga0496104_0172445 3300048907 Bacteria 2074
256 Ga0496106_0108047 3300048909 Unclassified 2164
257 Ga0496110_0181716 3300048913 Bacteria 1910
258 Ga0496114_0006674 3300048917 Bacteria 9095
259 Ga0496115_0004071 3300048918 Bacteria 10563
260 Ga0496115_0004873 3300048918 Bacteria 9741
261 Ga0496115_0032873 3300048918 Bacteria 4095
262 nmdc:mga0rr50_145372_c1 3300050513 Bacteria 1911
263 nmdc:mga0rr50_693661_c1 3300050513 Bacteria 869
264 nmdc:mga08x19_16589_c1 3300050514 Unclassified 4494
265 nmdc:mga08x19_188_c1 3300050514 Bacteria 49158
266 nmdc:mga08x19_210512_c1 3300050514 Bacteria 1334
267 nmdc:mga08x19_214416_c1 3300050514 Unclassified 1322
268 nmdc:mga08x19_43984_c1 3300050514 Bacteria 2850
269 nmdc:mga08x19_62675_c1 3300050514 Bacteria 2411
270 Ga0495619_0030759 3300053085 Unclassified 3475
271 Ga0495619_0607480 3300053085 Bacteria 748
272 Ga0265765_1004419
273 Ga0070709_10005144
274 Ga0070709_10111887
275 Ga0070709_10211727
276 Ga0070714_100053349
277 Ga0070713_100064904
278 Ga0070713_100283772
279 Ga0070710_10029304
280 Ga0070710_10263214
281 Ga0070711_100017469
282 Ga0070711_100648639
283 Ga0070705_100156200
284 Ga0070705_100653644
285 Ga0070708_100001728
286 Ga0070708_100047173
287 Ga0070708_100060288
288 Ga0070708_100124696
289 Ga0070685_10188548
290 Ga0070706_100165273
291 Ga0070706_100182901
292 Ga0070706_100326699
293 Ga0070706_100716830
294 Ga0070706_100773582
295 Ga0070707_100000208
296 Ga0070707_100106345
297 Ga0070707_100123709
298 Ga0070707_100227995
299 Ga0070707_100260765
300 Ga0070707_100432143
301 Ga0070707_100892829
302 Ga0070699_100118733
303 Ga0070679_100100128
304 Ga0070697_100000132
305 Ga0070697_100016483
306 Ga0070697_100052290
307 Ga0070697_100194070
308 Ga0070697_100263449
309 Ga0070697_100291217
310 Ga0070697_100431791
311 Ga0070697_100750304
312 Ga0070686_100159728
313 Ga0070695_100024189
314 Ga0070696_100006012
315 Ga0070665_100007185
316 Ga0070704_100104781
317 Ga0068866_10352820
318 Ga0068863_100003171
319 Ga0068860_100007420
320 Ga0068860_100346735
321 Ga0068862_100609167
322 Ga0081540_1108655
323 Ga0070717_10401144
324 Ga0070717_10470801
325 Ga0070715_10117154
326 Ga0070715_10152038
327 Ga0070715_10357886
328 Ga0070715_10571168
329 Ga0070716_100002680
330 Ga0070716_100006003
331 Ga0070716_100031132
332 Ga0070716_100067263
333 Ga0070716_100121392
334 Ga0070712_100037508
335 Ga0070712_100047243
336 Ga0097621_100002044
337 Ga0068871_100030116
338 Ga0075434_100150082
339 Ga0068865_100756358
340 Ga0075436_100000280
341 Ga0075436_100329242
342 Ga0075435_100078736
343 Ga0075435_100089205
344 Ga0099794_10002221
345 Ga0099794_10006506
346 Ga0099794_10009472
347 Ga0099794_10013716
348 Ga0099794_10016621
349 Ga0099794_10031590
350 Ga0099794_10045821
351 Ga0099794_10056845
352 Ga0099794_10056849
353 Ga0099794_10062451
354 Ga0099794_10080561
355 Ga0099794_10178216
356 Ga0099795_10016584
357 Ga0099795_10041481
358 Ga0105240_10098443
359 Ga0105245_10035006
360 Ga0105243_10070684
361 Ga0105241_10984298
362 Ga0105237_10014789
363 Ga0105237_10643769
364 Ga0105249_10196353
365 Ga0099796_10001986
366 Ga0099796_10022046
367 Ga0099796_10274072
368 Ga0105239_10283319
369 Ga0157374_10005993
370 Ga0157374_10684516
371 Ga0157378_10000198
372 Ga0157378_10003225
373 Ga0157378_10009498
374 Ga0157378_10288127
375 Ga0157378_10603656
376 Ga0157372_10007582
377 Ga0157375_10446243
378 Ga0157375_11093208
379 Ga0157379_10033226
380 Ga0157379_10517508
381 Ga0157376_10000016
382 Ga0157376_10042328
383 Ga0213876_10060366
384 Ga0228598_1008648
385 Ga0207692_10032525
386 Ga0207692_10042174
387 Ga0207642_10152820
388 Ga0207642_10568095
389 Ga0207685_10021892
390 Ga0207685_10112692
391 Ga0207685_10269124
392 Ga0207699_10003245
393 Ga0207699_10044363
394 Ga0207699_10215905
395 Ga0207684_10025806
396 Ga0207707_10159113
397 Ga0207695_10474009
398 Ga0207671_10337129
399 Ga0207663_10127487
400 Ga0207663_10592122
401 Ga0207652_10115049
402 Ga0207646_10000016
403 Ga0207646_10018417
404 Ga0207646_10218066
405 Ga0207646_10343991
406 Ga0207646_10451527
407 Ga0207687_10050497
408 Ga0207700_10069665
409 Ga0207700_10306497
410 Ga0207664_10081292
411 Ga0207704_10673638
412 Ga0207665_10000021
413 Ga0207665_10006464
414 Ga0207665_10008415
415 Ga0207665_10009837
416 Ga0207665_10051812
417 Ga0207665_10074614
418 Ga0207665_10329636
419 Ga0207711_10304324
420 Ga0207712_10037460
421 Ga0207703_10135764
422 Ga0207639_10598736
423 Ga0207641_10062756
424 Ga0209588_1004018
425 Ga0209588_1009291
426 Ga0209588_1018126
427 Ga0209588_1027355
428 Ga0209588_1044359
429 Ga0209588_1053464
430 Ga0209588_1057936
431 Ga0209588_1092203
432 Ga0265354_1001811
433 Ga0268266_10003263
434 Ga0265338_10199072
435 Ga0265338_10483147
436 Ga0265770_1000935
437 Ga0265770_1001865
438 Ga0265765_1004490
439 Ga0265760_10042121
440 Ga0265329_10036282
441 Ga0265331_10005974
442 Ga0265316_10016670
443 Ga0316212_1002122
444 Ga0373926_0000849
445 Ga0373944_0069004
446 Ga0373923_0088859
447 Ga0373954_0005215
448 Ga0373954_0107850
449 Ga0373956_0001668
450 Ga0373946_0082334
451 Ga0373946_0133033
452 Ga0373955_0001802
453 Ga0373924_0319703
454 Ga0373931_0015943
455 Ga0373927_0003574
456 Ga0373933_0000917
457 Ga0373947_0005373
458 Ga0373947_0772415
459 Ga0373937_0001340
460 Ga0373937_0077719
461 Ga0373925_0004769
462 Ga0373925_0102004
463 Ga0436365_0964789
464 Ga0495592_0004606
465 Ga0495592_0023728
466 Ga0495592_0154219
467 Ga0495603_0048374
468 Ga0495629_0570378
469 Ga0495651_0003427
470 Ga0495653_0051035
471 Ga0495580_0001299
472 Ga0495580_0016104
473 Ga0495580_0034860
474 Ga0495580_0108652
475 Ga0495580_0490639
476 Ga0495582_0002411
477 Ga0495582_0080356
478 Ga0495664_0344253
479 Ga0495608_0024656
480 Ga0495618_0311854
481 Ga0495628_0006224
482 Ga0495628_0025018
483 Ga0495628_0092891
484 Ga0495628_0573462
485 Ga0495630_0007168
486 Ga0495630_0019533
487 Ga0495630_0820772
488 Ga0495652_0002423
489 Ga0495640_0066004
490 Ga0495586_0161916
491 Ga0495586_0201466
492 Ga0495587_0002796
493 Ga0495587_0010885
494 Ga0495645_0002527
495 Ga0495645_0437505
496 Ga0495667_0007047
497 Ga0495667_0630429
498 Ga0495635_0449605
499 Ga0495657_0279479
500 Ga0495599_0018302
501 Ga0495623_0119428
502 Ga0495658_0012449
503 Ga0495613_0122842
504 Ga0495624_0299475
505 Ga0495600_0006869
506 Ga0495600_0323044
507 Ga0495604_0000316
508 Ga0495604_0016599
509 Ga0495604_0178933
510 Ga0495674_0018036
511 Ga0495674_0032723
512 Ga0495674_0059376
513 Ga0495674_0178397
514 Ga0495676_0066621
515 Ga0495680_0000656
516 Ga0495675_0000393
517 Ga0495675_0059215
518 Ga0495675_0133101
519 Ga0495684_0003953
520 Ga0495684_0006074
521 Ga0495684_0019139
522 Ga0495684_0056813
523 Ga0495602_0001331
524 Ga0495602_0265309
525 Ga0496102_0038313
526 Ga0496104_0172445
527 Ga0496106_0108047
528 Ga0496110_0181716
529 Ga0496114_0006674
530 Ga0496115_0004071
531 Ga0496115_0004873
532 Ga0496115_0032873
533 nmdc:mga0rr50_145372_c1
534 nmdc:mga0rr50_693661_c1
535 nmdc:mga08x19_16589_c1
536 nmdc:mga08x19_188_c1
537 nmdc:mga08x19_210512_c1
538 nmdc:mga08x19_214416_c1
539 nmdc:mga08x19_43984_c1
540 nmdc:mga08x19_62675_c1
541 Ga0495619_0030759
542 Ga0495619_0607480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

44

153

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h2v-assembly2.cif.gz_B human raver1 rrm1 domain in complex with human vinculin tail domain vt 0.3119 11 164
3h2v-assembly2.cif.gz_B human raver1 rrm1 domain in complex with human vinculin tail domain vt 0.2807 11 164
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.2768 10 166
8tno-assembly1.cif.gz_A unc_239 from chroma generative model 0.2642 2 169
3g7r-assembly1.cif.gz_B crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.263 7 159
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8934 42 158 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8504 42 158 1.10.1760.20
af_Q95XZ5_1825_2025_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3678 2 144 1.25.10.10
af_A0A0R0GV15_321_483_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3677 10 169 1.20.1250.20
af_A5HEI1_1388_1587_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3496 11 142 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A2V8WNV9-F1-model_v4 VTT domain-containing protein 0.9179 1 204 GO:0005886
AF-A0A2V8WNV9-F1-model_v4 VTT domain-containing protein 0.9136 1 204 GO:0005886
AF-A0A7C6A4S7-F1-model_v4 VTT domain-containing protein 0.9112 8 197 GO:0016020
AF-A0A2V9BMC7-F1-model_v4 VTT domain-containing protein 0.9103 1 204 GO:0016020
AF-A0A7C4BW85-F1-model_v4 VTT domain-containing protein 0.9077 10 202 GO:0005886

Map