F377721

General Info

Members Datasets Scaffolds Average Seq Length
271 197 233 233

Family's Representative Sequence

Representative Sequence 3300027695|Ga0209966_1011569|Ga0209966_10115692
Length 256
Sequence MKAHAAAPASDRPSHDGATCVRTIAERIASYEWSAAEAALDEHGWAPLAGALTAGECDALASMYPREEHFRSRVVMARHGFGRGEYKYFSYPLPALVAELRSLLYARLVTIANRWNELMKLDVRFPDDHAGFIERCHRAGQQRPTPLLLQYGPEDYNCLHQDLYGEHVFPLQAVILLSAPSHDFTGGEFVLTEQRPRMQSRAEVVPLAKGDGAIFAVNQRPKRGARGFYRVTMRHGASRVRSGRRYTAGVIFHDAR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231012 Pseudomonas sp. GM33 Isolate Nodule
3 2511231014 Pseudomonas sp. GM48 Isolate Nodule
4 2511231019 Pseudomonas sp. GM67 Isolate Nodule
5 2511231020 Pseudomonas sp. GM74 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
8 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
9 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
10 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
11 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
12 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
13 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
14 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
15 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
16 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
17 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
18 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
19 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
20 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
21 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
22 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
23 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
24 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
25 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
26 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
27 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
28 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
29 2773857673 Pseudomonas sp. 443 Isolate Unclassified
30 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
31 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
32 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
33 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
34 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
35 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
36 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
37 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
38 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
98 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
99 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
100 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
101 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
102 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
103 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.98
Metatranscriptomes 0
Isolates 14.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 2.58
Rhizoplane 6.27
Rhizosphere 81.55
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2563641 2162886007 Bacteria 1092
2 rootH1_10009337 3300003323 Bacteria 14683
3 Ga0065704_10073617 3300005289 Bacteria 6952
4 Ga0068869_100053759 3300005334 Bacteria 2929
5 Ga0070689_100482597 3300005340 Bacteria 1059
6 Ga0070691_10347514 3300005341 Bacteria 823
7 Ga0070675_100077671 3300005354 Bacteria 2764
8 Ga0070703_10034000 3300005406 Bacteria 1554
9 Ga0070701_10140838 3300005438 Bacteria 1379
10 Ga0070705_100385263 3300005440 Bacteria 1033
11 Ga0070700_100036947 3300005441 Bacteria 2967
12 Ga0070700_100416968 3300005441 Bacteria 1014
13 Ga0070681_10001358 3300005458 Bacteria 21392
14 Ga0070681_10281240 3300005458 Bacteria 1574
15 Ga0070679_100048488 3300005530 Bacteria 4232
16 Ga0070697_100627303 3300005536 Bacteria 946
17 Ga0070696_100069012 3300005546 Bacteria 2483
18 Ga0070704_100057719 3300005549 Bacteria 2762
19 Ga0068859_100012047 3300005617 Bacteria 8688
20 Ga0068861_100001707 3300005719 Bacteria 14112
21 Ga0068862_100013427 3300005844 Bacteria 6779
22 Ga0075364_10033909 3300006051 Bacteria 3290
23 Ga0075364_10217071 3300006051 Bacteria 1297
24 Ga0075432_10003206 3300006058 Bacteria 5519
25 Ga0075436_100118410 3300006914 Bacteria 1852
26 Ga0075436_100160076 3300006914 Bacteria 1587
27 Ga0097620_100012047 3300006931 Bacteria 8688
28 Ga0079104_1000081 3300006946 Bacteria 140632
29 Ga0105251_10035179 3300009011 Bacteria 2473
30 Ga0105251_10057621 3300009011 Bacteria 1836
31 Ga0105243_10000170 3300009148 Bacteria 74646
32 Ga0105246_10000014 3300011119 Bacteria 66861
33 Ga0157373_10001889 3300013100 Bacteria 15894
34 Ga0157370_10008555 3300013104 Bacteria 11029
35 Ga0163162_10020646 3300013306 Bacteria 6474
36 Ga0182008_10007599 3300014497 Bacteria 5976
37 Ga0182008_10056878 3300014497 Bacteria 1932
38 Ga0182006_1117913 3300015261 Bacteria 925
39 Ga0182006_1118000 3300015261 Bacteria 925
40 Ga0182005_1020371 3300015265 Bacteria 1825
41 Ga0182005_1129737 3300015265 Bacteria 722
42 Ga0163161_10020987 3300017792 Bacteria 4590
43 Ga0163161_10025390 3300017792 Bacteria 4193
44 Ga0209676_1006772 3300025292 Bacteria 5566
45 Ga0209050_1001872 3300025298 Bacteria 20226
46 Ga0209051_1010212 3300025303 Bacteria 4768
47 Ga0207655_1000520 3300025728 Bacteria 49037
48 Ga0207713_1014098 3300025735 Bacteria 4172
49 Ga0207653_10050444 3300025885 Bacteria 1383
50 Ga0207707_10017552 3300025912 Bacteria 6242
51 Ga0207707_10303615 3300025912 Bacteria 1380
52 Ga0207652_10156366 3300025921 Bacteria 2043
53 Ga0207659_10073899 3300025926 Bacteria 2498
54 Ga0207709_10000004 3300025935 Bacteria 825156
55 Ga0207709_10082900 3300025935 Bacteria 2072
56 Ga0207670_10370726 3300025936 Bacteria 1138
57 Ga0207708_10106275 3300026075 Bacteria 2176
58 Ga0209281_1000055 3300027111 Bacteria 308297
59 Ga0209966_1011569 3300027695 Bacteria 1611
60 Ga0207428_10006877 3300027907 Bacteria 10424
61 Ga0207428_10027791 3300027907 Bacteria 4707
62 Ga0207428_10115229 3300027907 Bacteria 2065
63 Ga0268265_10048335 3300028380 Bacteria 3193
64 Ga0307405_10015004 3300031731 Bacteria 4182
65 Ga0307405_10220109 3300031731 Bacteria 1392
66 Ga0307407_10180693 3300031903 Bacteria 1398
67 Ga0307409_100305564 3300031995 Bacteria 1482
68 Ga0307411_10144475 3300032005 Bacteria 1759
69 Ga0316574_0084081 3300035398 Bacteria 2024
70 Ga0395898_0531076 3300037466 Bacteria 1118
71 Ga0395905_0057233 3300037471 Bacteria 3647
72 Ga0439438_002292 3300041405 Bacteria 8200
73 Ga0439438_003510 3300041405 Bacteria 6331
74 Ga0439438_006585 3300041405 Bacteria 4075
75 Ga0439438_016539 3300041405 Bacteria 2143
76 Ga0439447_003245 3300041407 Bacteria 5783
77 Ga0439447_004840 3300041407 Bacteria 4569
78 Ga0439466_0005713 3300041411 Bacteria 4743
79 Ga0439466_0010568 3300041411 Bacteria 3431
80 Ga0439466_0012395 3300041411 Bacteria 3142
81 Ga0439466_0045418 3300041411 Bacteria 1453
82 Ga0439432_004212 3300042006 Bacteria 5263
83 Ga0439432_009711 3300042006 Bacteria 3346
84 Ga0439432_024834 3300042006 Bacteria 1969
85 Ga0439451_000475 3300042009 Bacteria 7813
86 Ga0439452_000856 3300042010 Bacteria 14070
87 Ga0439452_008456 3300042010 Bacteria 3096
88 Ga0439452_009792 3300042010 Bacteria 2813
89 Ga0439456_002424 3300042013 Bacteria 3759
90 Ga0450911_001991 3300042115 Bacteria 4250
91 Ga0450903_008942 3300042138 Bacteria 1636
92 Ga0450908_002184 3300042184 Bacteria 3836
93 Ga0439460_0002051 3300042461 Bacteria 4827
94 Ga0466966_0000701 3300044684 Bacteria 21320
95 Ga0466961_0037321 3300044693 Bacteria 3117
96 Ga0466970_0023116 3300044765 Bacteria 3245
97 Ga0466957_0287241 3300044842 Bacteria 1102
98 Ga0466960_0122059 3300044901 Bacteria 1366
99 Ga0466959_0000100 3300045049 Bacteria 54979
100 Ga0466958_0217786 3300045836 Bacteria 1217
101 Ga0495617_003351 3300046452 Bacteria 6049
102 Ga0495617_007388 3300046452 Bacteria 3812
103 Ga0495627_000894 3300046453 Bacteria 20947
104 Ga0495627_024796 3300046453 Bacteria 1951
105 Ga0495592_0006258 3300046454 Bacteria 8858
106 Ga0495603_0029202 3300046455 Bacteria 3325
107 Ga0495603_0185055 3300046455 Bacteria 1205
108 Ga0495590_0016526 3300046457 Bacteria 2663
109 Ga0495591_081835 3300046458 Bacteria 822
110 Ga0495629_0019552 3300046459 Bacteria 4837
111 Ga0495638_0126240 3300046460 Bacteria 1507
112 Ga0495653_0000629 3300046463 Bacteria 26909
113 Ga0495653_0008249 3300046463 Bacteria 8538
114 Ga0495653_0029871 3300046463 Bacteria 4344
115 Ga0495653_0036422 3300046463 Bacteria 3875
116 Ga0495650_0009806 3300046471 Bacteria 5411
117 Ga0495580_0210878 3300046472 Bacteria 1336
118 Ga0495582_0010259 3300046473 Bacteria 5155
119 Ga0495605_0038909 3300046474 Bacteria 2384
120 Ga0495639_0008112 3300046475 Bacteria 4509
121 Ga0495639_0039169 3300046475 Bacteria 2130
122 Ga0495584_0066180 3300046491 Bacteria 1817
123 Ga0495584_0073961 3300046491 Bacteria 1712
124 Ga0495585_0000149 3300046492 Bacteria 75947
125 Ga0495585_0004048 3300046492 Bacteria 9647
126 Ga0495585_0008195 3300046492 Bacteria 6346
127 Ga0495585_0017605 3300046492 Bacteria 4128
128 Ga0495594_0007149 3300046499 Bacteria 5744
129 Ga0495594_0020529 3300046499 Bacteria 3518
130 Ga0495607_0001404 3300046501 Bacteria 21432
131 Ga0495583_0006693 3300046506 Bacteria 7467
132 Ga0495606_0015443 3300046507 Bacteria 5881
133 Ga0495610_0056534 3300046512 Bacteria 1886
134 Ga0495616_0001724 3300046513 Bacteria 14900
135 Ga0495616_0008289 3300046513 Bacteria 6168
136 Ga0495630_0019394 3300046517 Bacteria 4999
137 Ga0495637_0015017 3300046520 Bacteria 3641
138 Ga0495648_0013821 3300046524 Bacteria 5947
139 Ga0495648_0119577 3300046524 Bacteria 1418
140 Ga0495666_0000015 3300046526 Bacteria 76311
141 Ga0495666_0002576 3300046526 Bacteria 9016
142 Ga0495666_0002871 3300046526 Bacteria 8631
143 Ga0495666_0057022 3300046526 Bacteria 1870
144 Ga0495654_0004836 3300046530 Bacteria 7927
145 Ga0495654_0006967 3300046530 Bacteria 6367
146 Ga0495587_0001836 3300046536 Bacteria 14161
147 Ga0495587_0043456 3300046536 Bacteria 2676
148 Ga0495609_0012415 3300046538 Bacteria 4041
149 Ga0495609_0034021 3300046538 Bacteria 2312
150 Ga0495609_0086601 3300046538 Bacteria 1366
151 Ga0495597_0014838 3300046542 Bacteria 3704
152 Ga0495645_0090325 3300046543 Bacteria 2189
153 Ga0495645_0108667 3300046543 Bacteria 1964
154 Ga0495622_0000378 3300046557 Bacteria 30622
155 Ga0495622_0005533 3300046557 Bacteria 5856
156 Ga0495622_0186834 3300046557 Bacteria 927
157 Ga0495633_0004863 3300046558 Bacteria 8401
158 Ga0495633_0038145 3300046558 Bacteria 2296
159 Ga0495656_0109543 3300046615 Bacteria 1289
160 Ga0495634_0007186 3300046642 Bacteria 8395
161 Ga0495625_0003190 3300046660 Bacteria 16661
162 Ga0495625_0015352 3300046660 Bacteria 6069
163 Ga0495661_0013514 3300046665 Bacteria 5481
164 Ga0495588_0000433 3300046674 Bacteria 21750
165 Ga0495657_0031972 3300046675 Bacteria 3675
166 Ga0495646_0006591 3300046680 Bacteria 7367
167 Ga0495646_0025058 3300046680 Bacteria 3752
168 Ga0495613_0018325 3300046689 Bacteria 5221
169 Ga0495624_0000133 3300046690 Bacteria 52717
170 Ga0495670_0002913 3300046691 Bacteria 8431
171 Ga0495670_0009280 3300046691 Bacteria 4839
172 Ga0495671_0005132 3300046692 Bacteria 7704
173 Ga0495671_0045298 3300046692 Bacteria 2202
174 Ga0495671_0052090 3300046692 Bacteria 2034
175 Ga0495671_0087468 3300046692 Bacteria 1526
176 Ga0495589_0046877 3300046794 Bacteria 2143
177 Ga0495600_0010297 3300046809 Bacteria 5800
178 Ga0495600_0041732 3300046809 Bacteria 2990
179 Ga0495660_0003102 3300046810 Bacteria 10360
180 Ga0495660_0004632 3300046810 Bacteria 8294
181 Ga0495660_0007519 3300046810 Bacteria 6395
182 Ga0495660_0042140 3300046810 Bacteria 2523
183 Ga0495581_0030497 3300047315 Bacteria 3124
184 Ga0495604_0006676 3300047317 Bacteria 9145
185 Ga0495604_0025080 3300047317 Bacteria 4753
186 Ga0495672_0001695 3300047320 Bacteria 21354
187 Ga0495672_0007362 3300047320 Bacteria 8290
188 Ga0495672_0024297 3300047320 Bacteria 3907
189 Ga0495676_0000178 3300047321 Bacteria 50077
190 Ga0495676_0012300 3300047321 Bacteria 7709
191 Ga0495680_0000939 3300047322 Bacteria 32333
192 Ga0495680_0009475 3300047322 Bacteria 8751
193 Ga0495680_0018342 3300047322 Bacteria 5943
194 Ga0495683_0001324 3300047323 Bacteria 16613
195 Ga0495687_002798 3300047443 Bacteria 13462
196 Ga0495675_0047008 3300047444 Bacteria 2746
197 Ga0495673_0002783 3300047469 Bacteria 11963
198 Ga0495673_0039730 3300047469 Bacteria 2132
199 Ga0495681_0010468 3300047470 Bacteria 5614
200 Ga0495684_0008890 3300047471 Bacteria 7758
201 Ga0495684_0027147 3300047471 Bacteria 4395
202 Ga0495686_0094540 3300047472 Bacteria 1811
203 Ga0495593_0000378 3300047673 Bacteria 24648
204 Ga0495593_0005461 3300047673 Bacteria 7506
205 Ga0495593_0017782 3300047673 Bacteria 4004
206 Ga0495602_0000644 3300048088 Bacteria 32644
207 Ga0495626_0000310 3300048091 Bacteria 51701
208 Ga0496104_0926939 3300048907 Bacteria 776
209 Ga0496110_0497287 3300048913 Bacteria 1110
210 Ga0496117_0009457 3300048920 Bacteria 9067
211 Ga0496118_0008152 3300048921 Bacteria 10906
212 Ga0496118_0066524 3300048921 Bacteria 2630
213 Ga0496118_0246032 3300048921 Bacteria 1020
214 Ga0496121_0144717 3300048924 Bacteria 1758
215 Ga0496122_0011523 3300048925 Bacteria 8941
216 Ga0496123_0008998 3300048926 Bacteria 9061
217 Ga0496124_0041129 3300048927 Bacteria 3993
218 Ga0496124_0053395 3300048927 Bacteria 3426
219 Ga0496125_0012636 3300048928 Bacteria 8360
220 Ga0496126_0002229 3300048929 Bacteria 26812
221 Ga0495678_011612 3300049459 Bacteria 4207
222 Ga0495678_017964 3300049459 Bacteria 3190
223 Ga0495682_0000701 3300049460 Bacteria 21947
224 Ga0501040_0386485 3300049576 Bacteria 1004
225 Ga0501071_0527335 3300049587 Bacteria 906
226 Ga0501072_0279732 3300049588 Bacteria 1327
227 Ga0501079_0150878 3300049741 Bacteria 1812
228 Ga0501080_0562281 3300049742 Bacteria 1015
229 nmdc:mga03683_52012_c1 3300050489 Bacteria 1712
230 nmdc:mga08x19_217596_c1 3300050514 Bacteria 1312
231 Ga0500641_0008836 3300053096 Bacteria 3607
232 Ga0500649_105821 3300053722 Bacteria 1102
233 Ga0466962_0051818 3300061719 Bacteria 1962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10056878 Ga0182008_100568783 206
2 3300049459 Ga0495678_017964 Ga0495678_017964_225_929 206
3 3300046542 Ga0495597_0014838 Ga0495597_0014838_1451_2152 212
4 3300053096 Ga0500641_0008836 Ga0500641_0008836_1647_2411 216
5 iso_pu_bacteria 2919456309 2919460587 218
6 3300013104 Ga0157370_10008555 Ga0157370_100085558 222
7 3300013306 Ga0163162_10020646 Ga0163162_100206467 222
8 3300015265 Ga0182005_1020371 Ga0182005_10203712 222
9 3300015265 Ga0182005_1129737 Ga0182005_11297371 222
10 3300046455 Ga0495603_0029202 Ga0495603_0029202_2419_3087 222
11 3300046455 Ga0495603_0185055 Ga0495603_0185055_258_926 222
12 3300046471 Ga0495650_0009806 Ga0495650_0009806_2307_2975 222
13 3300046474 Ga0495605_0038909 Ga0495605_0038909_400_1068 222
14 3300046475 Ga0495639_0039169 Ga0495639_0039169_1140_1808 222
15 3300046491 Ga0495584_0066180 Ga0495584_0066180_903_1571 222
16 3300046491 Ga0495584_0073961 Ga0495584_0073961_246_914 222
17 3300046492 Ga0495585_0008195 Ga0495585_0008195_628_1296 222
18 3300046507 Ga0495606_0015443 Ga0495606_0015443_2428_3096 222
19 3300046513 Ga0495616_0008289 Ga0495616_0008289_4985_5653 222
20 3300046520 Ga0495637_0015017 Ga0495637_0015017_566_1234 222
21 3300046524 Ga0495648_0119577 Ga0495648_0119577_313_981 222
22 3300046530 Ga0495654_0004836 Ga0495654_0004836_7021_7689 222
23 3300046538 Ga0495609_0086601 Ga0495609_0086601_240_908 222
24 3300046557 Ga0495622_0186834 Ga0495622_0186834_208_876 222
25 3300046558 Ga0495633_0004863 Ga0495633_0004863_5312_5980 222
26 3300046660 Ga0495625_0003190 Ga0495625_0003190_13608_14276 222
27 3300046691 Ga0495670_0002913 Ga0495670_0002913_2429_3097 222
28 3300046692 Ga0495671_0045298 Ga0495671_0045298_1510_2178 222
29 3300046794 Ga0495589_0046877 Ga0495589_0046877_833_1501 222
30 3300046810 Ga0495660_0004632 Ga0495660_0004632_567_1235 222
31 3300046810 Ga0495660_0042140 Ga0495660_0042140_1141_1809 222
32 3300047323 Ga0495683_0001324 Ga0495683_0001324_13504_14172 222
33 3300047469 Ga0495673_0002783 Ga0495673_0002783_8853_9521 222
34 3300047470 Ga0495681_0010468 Ga0495681_0010468_557_1225 222
35 3300047472 Ga0495686_0094540 Ga0495686_0094540_215_883 222
36 3300048924 Ga0496121_0144717 Ga0496121_0144717_466_1134 222
37 3300048927 Ga0496124_0041129 Ga0496124_0041129_2797_3465 222
38 3300048928 Ga0496125_0012636 Ga0496125_0012636_649_1317 222
39 3300049576 Ga0501040_0386485 Ga0501040_0386485_139_903 222
40 3300049587 Ga0501071_0527335 Ga0501071_0527335_46_810 222
41 3300049588 Ga0501072_0279732 Ga0501072_0279732_11_775 222
42 3300049741 Ga0501079_0150878 Ga0501079_0150878_296_1060 222
43 3300049742 Ga0501080_0562281 Ga0501080_0562281_110_874 222
44 3300044901 Ga0466960_0122059 Ga0466960_0122059_97_771 224
45 3300031903 Ga0307407_10180693 Ga0307407_101806932 227
46 3300032005 Ga0307411_10144475 Ga0307411_101444752 227
47 3300005458 Ga0070681_10001358 Ga0070681_100013589 228
48 3300005530 Ga0070679_100048488 Ga0070679_1000484885 228
49 3300005536 Ga0070697_100627303 Ga0070697_1006273032 228
50 3300005546 Ga0070696_100069012 Ga0070696_1000690124 228
51 3300025912 Ga0207707_10017552 Ga0207707_100175526 228
52 3300025921 Ga0207652_10156366 Ga0207652_101563662 228
53 3300046463 Ga0495653_0036422 Ga0495653_0036422_658_1344 228
54 3300046517 Ga0495630_0019394 Ga0495630_0019394_2503_3189 228
55 3300046526 Ga0495666_0000015 Ga0495666_0000015_2622_3308 228
56 3300046675 Ga0495657_0031972 Ga0495657_0031972_279_965 228
57 3300046809 Ga0495600_0041732 Ga0495600_0041732_1613_2299 228
58 3300047317 Ga0495604_0006676 Ga0495604_0006676_2284_2970 228
59 3300047320 Ga0495672_0024297 Ga0495672_0024297_434_1120 228
60 3300047322 Ga0495680_0018342 Ga0495680_0018342_4934_5620 228
61 3300047444 Ga0495675_0047008 Ga0495675_0047008_460_1146 228
62 3300047471 Ga0495684_0008890 Ga0495684_0008890_2055_2741 228
63 3300047673 Ga0495593_0000378 Ga0495593_0000378_20363_21049 228
64 3300005458 Ga0070681_10281240 Ga0070681_102812402 229
65 3300006914 Ga0075436_100160076 Ga0075436_1001600762 229
66 3300025912 Ga0207707_10303615 Ga0207707_103036152 229
67 3300037471 Ga0395905_0057233 Ga0395905_0057233_763_1452 229
68 3300046558 Ga0495633_0038145 Ga0495633_0038145_527_1216 229
69 3300003323 rootH1_10009337 rootH1_100093374 230
70 3300045836 Ga0466958_0217786 Ga0466958_0217786_308_1000 230
71 3300046458 Ga0495591_081835 Ga0495591_081835_11_730 230
72 iso_pu_bacteria 2511231012 2511302653 230
73 iso_pu_bacteria 2511231014 2511313308 230
74 iso_pu_bacteria 2511231020 2511352426 230
75 iso_pu_bacteria 2511231021 2511359483 230
76 iso_pu_bacteria 2643221589 2643954259 230
77 iso_pu_bacteria 2643221602 2644023068 230
78 iso_pu_bacteria 2808606382 2808956196 230
79 iso_pu_bacteria 3007511990 3007514085 230
80 iso_pu_bacteria 8056125926 8056128648 230
81 iso_pu_bacteria 2511231019 2511342322 231
82 iso_pu_bacteria 2773857673 2774133958 232
83 iso_pu_bacteria 2904518522 2904519937 232
84 iso_pu_bacteria 3007861166 3007861869 232
85 3300005441 Ga0070700_100416968 Ga0070700_1004169681 233
86 3300044684 Ga0466966_0000701 Ga0466966_0000701_19365_20066 233
87 3300044693 Ga0466961_0037321 Ga0466961_0037321_1064_1765 233
88 3300044765 Ga0466970_0023116 Ga0466970_0023116_753_1454 233
89 3300044842 Ga0466957_0287241 Ga0466957_0287241_298_999 233
90 3300045049 Ga0466959_0000100 Ga0466959_0000100_13144_13845 233
91 3300061719 Ga0466962_0051818 Ga0466962_0051818_282_983 233
92 iso_pu_bacteria 3007718800 3007722533 233
93 3300006051 Ga0075364_10033909 Ga0075364_100339094 234
94 3300006051 Ga0075364_10217071 Ga0075364_102170712 234
95 3300006058 Ga0075432_10003206 Ga0075432_100032061 234
96 3300006914 Ga0075436_100118410 Ga0075436_1001184101 234
97 3300006946 Ga0079104_1000081 Ga0079104_1000081115 234
98 3300009011 Ga0105251_10035179 Ga0105251_100351793 234
99 3300014497 Ga0182008_10007599 Ga0182008_100075993 234
100 3300015261 Ga0182006_1117913 Ga0182006_11179131 234
101 3300015261 Ga0182006_1118000 Ga0182006_11180001 234
102 3300017792 Ga0163161_10020987 Ga0163161_100209877 234
103 3300017792 Ga0163161_10025390 Ga0163161_100253903 234
104 3300025292 Ga0209676_1006772 Ga0209676_10067729 234
105 3300025298 Ga0209050_1001872 Ga0209050_100187219 234
106 3300025303 Ga0209051_1010212 Ga0209051_10102129 234
107 3300025735 Ga0207713_1014098 Ga0207713_10140984 234
108 3300025935 Ga0207709_10082900 Ga0207709_100829003 234
109 3300027111 Ga0209281_1000055 Ga0209281_1000055212 234
110 3300027907 Ga0207428_10006877 Ga0207428_100068779 234
111 3300027907 Ga0207428_10027791 Ga0207428_100277912 234
112 3300027907 Ga0207428_10115229 Ga0207428_101152293 234
113 3300041405 Ga0439438_003510 Ga0439438_003510_2697_3401 234
114 3300041405 Ga0439438_006585 Ga0439438_006585_2419_3123 234
115 3300041405 Ga0439438_016539 Ga0439438_016539_506_1210 234
116 3300041407 Ga0439447_003245 Ga0439447_003245_1295_1999 234
117 3300041411 Ga0439466_0010568 Ga0439466_0010568_2420_3124 234
118 3300041411 Ga0439466_0012395 Ga0439466_0012395_1075_1779 234
119 3300041411 Ga0439466_0045418 Ga0439466_0045418_393_1097 234
120 3300042006 Ga0439432_004212 Ga0439432_004212_492_1196 234
121 3300042010 Ga0439452_000856 Ga0439452_000856_2692_3396 234
122 3300042010 Ga0439452_009792 Ga0439452_009792_1025_1729 234
123 3300042013 Ga0439456_002424 Ga0439456_002424_479_1183 234
124 3300042115 Ga0450911_001991 Ga0450911_001991_3036_3740 234
125 3300042138 Ga0450903_008942 Ga0450903_008942_602_1306 234
126 3300042184 Ga0450908_002184 Ga0450908_002184_3071_3775 234
127 3300042461 Ga0439460_0002051 Ga0439460_0002051_156_860 234
128 3300046452 Ga0495617_007388 Ga0495617_007388_2763_3467 234
129 3300046453 Ga0495627_000894 Ga0495627_000894_2630_3334 234
130 3300046453 Ga0495627_024796 Ga0495627_024796_523_1227 234
131 3300046454 Ga0495592_0006258 Ga0495592_0006258_7708_8412 234
132 3300046460 Ga0495638_0126240 Ga0495638_0126240_297_1001 234
133 3300046463 Ga0495653_0000629 Ga0495653_0000629_23838_24542 234
134 3300046472 Ga0495580_0210878 Ga0495580_0210878_475_1179 234
135 3300046492 Ga0495585_0017605 Ga0495585_0017605_2745_3449 234
136 3300046499 Ga0495594_0020529 Ga0495594_0020529_1184_1888 234
137 3300046506 Ga0495583_0006693 Ga0495583_0006693_5004_5708 234
138 3300046524 Ga0495648_0013821 Ga0495648_0013821_4751_5455 234
139 3300046526 Ga0495666_0002576 Ga0495666_0002576_7754_8458 234
140 3300046526 Ga0495666_0057022 Ga0495666_0057022_660_1364 234
141 3300046530 Ga0495654_0006967 Ga0495654_0006967_4945_5649 234
142 3300046536 Ga0495587_0043456 Ga0495587_0043456_410_1114 234
143 3300046538 Ga0495609_0012415 Ga0495609_0012415_3005_3709 234
144 3300046538 Ga0495609_0034021 Ga0495609_0034021_1557_2261 234
145 3300046543 Ga0495645_0108667 Ga0495645_0108667_62_766 234
146 3300046557 Ga0495622_0000378 Ga0495622_0000378_22294_22998 234
147 3300046557 Ga0495622_0005533 Ga0495622_0005533_2924_3628 234
148 3300046615 Ga0495656_0109543 Ga0495656_0109543_356_1060 234
149 3300046642 Ga0495634_0007186 Ga0495634_0007186_5514_6218 234
150 3300046674 Ga0495588_0000433 Ga0495588_0000433_13198_13902 234
151 3300046680 Ga0495646_0025058 Ga0495646_0025058_687_1391 234
152 3300046690 Ga0495624_0000133 Ga0495624_0000133_2800_3504 234
153 3300046691 Ga0495670_0009280 Ga0495670_0009280_2410_3114 234
154 3300046692 Ga0495671_0052090 Ga0495671_0052090_872_1576 234
155 3300046809 Ga0495600_0010297 Ga0495600_0010297_2383_3087 234
156 3300046810 Ga0495660_0007519 Ga0495660_0007519_948_1652 234
157 3300047320 Ga0495672_0001695 Ga0495672_0001695_2679_3383 234
158 3300047320 Ga0495672_0007362 Ga0495672_0007362_2504_3208 234
159 3300047321 Ga0495676_0012300 Ga0495676_0012300_2366_3070 234
160 3300047322 Ga0495680_0009475 Ga0495680_0009475_7212_7916 234
161 3300047443 Ga0495687_002798 Ga0495687_002798_11966_12670 234
162 3300047469 Ga0495673_0039730 Ga0495673_0039730_804_1508 234
163 3300047471 Ga0495684_0027147 Ga0495684_0027147_1315_2019 234
164 3300047673 Ga0495593_0005461 Ga0495593_0005461_1123_1827 234
165 3300047673 Ga0495593_0017782 Ga0495593_0017782_2105_2809 234
166 3300048088 Ga0495602_0000644 Ga0495602_0000644_29569_30273 234
167 3300048091 Ga0495626_0000310 Ga0495626_0000310_24573_25277 234
168 3300048907 Ga0496104_0926939 Ga0496104_0926939_16_720 234
169 3300048913 Ga0496110_0497287 Ga0496110_0497287_218_922 234
170 3300048921 Ga0496118_0066524 Ga0496118_0066524_1704_2408 234
171 3300049459 Ga0495678_011612 Ga0495678_011612_3354_4058 234
172 3300049460 Ga0495682_0000701 Ga0495682_0000701_2913_3617 234
173 3300050489 nmdc:mga03683_52012_c1 nmdc:mga03683_52012_c1_994_1698 234
174 3300050514 nmdc:mga08x19_217596_c1 nmdc:mga08x19_217596_c1_227_931 234
175 iso_pu_bacteria 2512047018 2512328812 234
176 iso_pu_bacteria 2582580891 2583792191 234
177 iso_pu_bacteria 2825651385 2825657253 234
178 3300013100 Ga0157373_10001889 Ga0157373_100018897 235
179 3300042006 Ga0439432_009711 Ga0439432_009711_294_1004 235
180 3300042010 Ga0439452_008456 Ga0439452_008456_30_740 235
181 3300046452 Ga0495617_003351 Ga0495617_003351_4967_5677 235
182 3300046457 Ga0495590_0016526 Ga0495590_0016526_144_854 235
183 3300046459 Ga0495629_0019552 Ga0495629_0019552_2946_3653 235
184 3300046463 Ga0495653_0008249 Ga0495653_0008249_7293_8000 235
185 3300046463 Ga0495653_0029871 Ga0495653_0029871_2580_3290 235
186 3300046473 Ga0495582_0010259 Ga0495582_0010259_1616_2323 235
187 3300046475 Ga0495639_0008112 Ga0495639_0008112_689_1396 235
188 3300046492 Ga0495585_0000149 Ga0495585_0000149_2427_3134 235
189 3300046492 Ga0495585_0004048 Ga0495585_0004048_780_1490 235
190 3300046499 Ga0495594_0007149 Ga0495594_0007149_1372_2079 235
191 3300046501 Ga0495607_0001404 Ga0495607_0001404_18371_19081 235
192 3300046512 Ga0495610_0056534 Ga0495610_0056534_110_820 235
193 3300046513 Ga0495616_0001724 Ga0495616_0001724_13604_14314 235
194 3300046526 Ga0495666_0002871 Ga0495666_0002871_2457_3164 235
195 3300046536 Ga0495587_0001836 Ga0495587_0001836_3211_3918 235
196 3300046543 Ga0495645_0090325 Ga0495645_0090325_556_1263 235
197 3300046660 Ga0495625_0015352 Ga0495625_0015352_639_1346 235
198 3300046665 Ga0495661_0013514 Ga0495661_0013514_4723_5433 235
199 3300046680 Ga0495646_0006591 Ga0495646_0006591_871_1578 235
200 3300046689 Ga0495613_0018325 Ga0495613_0018325_2917_3624 235
201 3300046692 Ga0495671_0005132 Ga0495671_0005132_4580_5287 235
202 3300046692 Ga0495671_0087468 Ga0495671_0087468_643_1353 235
203 3300046810 Ga0495660_0003102 Ga0495660_0003102_1173_1883 235
204 3300047315 Ga0495581_0030497 Ga0495581_0030497_1046_1753 235
205 3300047317 Ga0495604_0025080 Ga0495604_0025080_999_1706 235
206 3300047321 Ga0495676_0000178 Ga0495676_0000178_46747_47457 235
207 3300047322 Ga0495680_0000939 Ga0495680_0000939_1865_2572 235
208 3300053722 Ga0500649_105821 Ga0500649_105821_323_1033 235
209 iso_pu_bacteria 2511231156 2511824297 235
210 iso_pu_bacteria 2643221650 2644284774 235
211 3300005334 Ga0068869_100053759 Ga0068869_1000537593 236
212 3300005340 Ga0070689_100482597 Ga0070689_1004825972 236
213 3300005341 Ga0070691_10347514 Ga0070691_103475141 236
214 3300005406 Ga0070703_10034000 Ga0070703_100340002 236
215 3300005438 Ga0070701_10140838 Ga0070701_101408382 236
216 3300005440 Ga0070705_100385263 Ga0070705_1003852632 236
217 3300005441 Ga0070700_100036947 Ga0070700_1000369472 236
218 3300005549 Ga0070704_100057719 Ga0070704_1000577192 236
219 3300005617 Ga0068859_100012047 Ga0068859_1000120476 236
220 3300005719 Ga0068861_100001707 Ga0068861_1000017073 236
221 3300005844 Ga0068862_100013427 Ga0068862_1000134277 236
222 3300006931 Ga0097620_100012047 Ga0097620_1000120476 236
223 3300009148 Ga0105243_10000170 Ga0105243_100001707 236
224 3300011119 Ga0105246_10000014 Ga0105246_1000001427 236
225 3300025728 Ga0207655_1000520 Ga0207655_100052019 236
226 3300025885 Ga0207653_10050444 Ga0207653_100504442 236
227 3300025935 Ga0207709_10000004 Ga0207709_10000004591 236
228 3300025936 Ga0207670_10370726 Ga0207670_103707261 236
229 3300026075 Ga0207708_10106275 Ga0207708_101062752 236
230 3300028380 Ga0268265_10048335 Ga0268265_100483352 236
231 3300031731 Ga0307405_10015004 Ga0307405_100150044 236
232 3300035398 Ga0316574_0084081 Ga0316574_0084081_896_1615 236
233 3300048920 Ga0496117_0009457 Ga0496117_0009457_543_1256 236
234 3300048921 Ga0496118_0008152 Ga0496118_0008152_2379_3092 236
235 3300048925 Ga0496122_0011523 Ga0496122_0011523_7620_8333 236
236 3300048926 Ga0496123_0008998 Ga0496123_0008998_605_1318 236
237 3300048927 Ga0496124_0053395 Ga0496124_0053395_272_985 236
238 iso_pu_bacteria 2600255318 2601798891 236
239 iso_pu_bacteria 2603880185 2606077786 236
240 iso_pu_bacteria 2603880199 2606130039 236
241 iso_pu_bacteria 2713897149 2715757041 236
242 iso_pu_bacteria 2878029506 2878032923 236
243 3300005354 Ga0070675_100077671 Ga0070675_1000776712 237
244 3300009011 Ga0105251_10057621 Ga0105251_100576212 237
245 3300025926 Ga0207659_10073899 Ga0207659_100738993 237
246 3300027695 Ga0209966_1011569 Ga0209966_10115692 237
247 3300031731 Ga0307405_10220109 Ga0307405_102201091 237
248 3300031995 Ga0307409_100305564 Ga0307409_1003055641 237
249 3300037466 Ga0395898_0531076 Ga0395898_0531076_322_1041 237
250 3300041405 Ga0439438_002292 Ga0439438_002292_4950_5669 237
251 3300041407 Ga0439447_004840 Ga0439447_004840_1266_1982 237
252 3300041411 Ga0439466_0005713 Ga0439466_0005713_1217_1933 237
253 3300042006 Ga0439432_024834 Ga0439432_024834_736_1452 237
254 3300042009 Ga0439451_000475 Ga0439451_000475_918_1634 237
255 3300048921 Ga0496118_0246032 Ga0496118_0246032_234_989 237
256 3300048929 Ga0496126_0002229 Ga0496126_0002229_25803_26558 237
257 2162886007 SwRhRL2b_contig_2563641 SwRhRL2b_0300.00005240 238
258 3300005289 Ga0065704_10073617 Ga0065704_100736175 238
259 iso_pu_bacteria 2599185248 2599770058 238
260 iso_pu_bacteria 2599185289 2599887382 238
261 iso_pu_bacteria 2599185291 2599898453 238
262 iso_pu_bacteria 2599185305 2599958912 238
263 iso_pu_bacteria 2599185306 2599968966 238
264 iso_pu_bacteria 2599185308 2599980223 238
265 iso_pu_bacteria 2599185313 2600006094 238
266 iso_pu_bacteria 2599185314 2600009423 238
267 iso_pu_bacteria 2599185315 2600017244 238
268 iso_pu_bacteria 2599185321 2600052067 238
269 iso_pu_bacteria 2599185324 2600069715 238
270 iso_pu_bacteria 2667528170 2671090945 238
271 iso_pu_bacteria 2919481497 2919485209 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

84

255

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s7e-assembly2.cif.gz_B crystal structure of ara h 1 0.7459 128 231
5c5t-assembly1.cif.gz_A the crystal structure of viral collagen prolyl hydroxylase vcph from paramecium bursaria chlorella virus-1 - 2og complex 0.7048 23 233
4j25-assembly7.cif.gz_G crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) 0.6868 15 235
8awp-assembly1.cif.gz_A crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) 0.6859 127 233
4j25-assembly6.cif.gz_F crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) 0.6833 15 234
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9596 71 237 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9271 71 237 2.60.120.590
af_Q9VVQ4_306_472_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7264 27 233 2.60.120.620
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7017 127 233 2.60.120.10
4j25F00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6833 15 234 2.60.120.620
ID Description Score Start End GO Terms
AF-A3NLI2-F1-model_v4 deleted 0.9937 6 238
AF-A0A2V2ANZ7-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9936 18 238
AF-A0A4Q3RDX1-F1-model_v4 deleted 0.9931 6 238
AF-A0A2V8L8S2-F1-model_v4 Proline hydroxylase 0.9931 70 238
AF-A0A5E7MKX5-F1-model_v4 Proline hydroxylase 0.9926 18 238

Feature Viewer

pLDDT pTM Quality
92.57 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map