F377575

General Info

Members Datasets Scaffolds Average Seq Length
271 151 542 532

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100059055|Ga0068871_1000590552
Length 576
Sequence MYVTQLIFKRVCNFGKVRYPSPGSHLVMGATLSRWERDTTKESAMAQQLKLPGILAAAMLILIAVIPAQAQVFADKKLSKVDYSQSDIAPHKACDALGQYKAKAIKQIAAAMKAATGAVPAFCDVTGVLGVEIAFELSLPSKWNGRFYMIGNGGPAGEALDAADRVAQRNDALQQGFAFAQTNTGHDARKEPGDTFVLSNPEKAIDYAYRAVHETARISKELTKDYYGKAVSYAYWNSCSNGGRQGLLEAQRYPEDFDGIIANAPWVDQTGFTIGAMWNQKAVSETPISNAKMVLVADKVMAKCDAIDGLKDGLIDDPRKCNFDPVKDVPQCAPGADGADCLTSTQAAAISKVYSGPVSNGKPFYPGYMPGSEQVTSLFGGGTGSGWMNVILPGQSNAKPADFNLAEGIMQYLVHTPPKPDYDYRKFNFDTDIHLLDNWSKLADAKDPDLSKFRKRGGKLVMTYGWADTILQPMAGVHYYEEATKKNGPGTKDFFRLFMIPGMSHCSGGIGPDRHDPVTAVINWVEKDAAPASIIASRVINNQVVRTRPLCPYPEVARYKGQGSIDDAANFRCVAP

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 1.48
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 14.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100059055 3300006358 Bacteria 3124
2 Ga0065712_10068381 3300005290 Bacteria 11112
3 Ga0065707_10091078 3300005295 Bacteria 4010
4 Ga0070683_100001092 3300005329 Bacteria 20437
5 Ga0070683_100002476 3300005329 Bacteria 14690
6 Ga0070683_100181119 3300005329 Bacteria 2000
7 Ga0070690_100009910 3300005330 Bacteria 5527
8 Ga0070690_100044050 3300005330 Bacteria 2832
9 Ga0070670_100007459 3300005331 Bacteria 9288
10 Ga0070670_100009267 3300005331 Bacteria 8411
11 Ga0070670_100074448 3300005331 Bacteria 2917
12 Ga0070666_10001730 3300005335 Bacteria 13314
13 Ga0070666_10002488 3300005335 Bacteria 11143
14 Ga0070680_100001941 3300005336 Bacteria 15204
15 Ga0068868_100002209 3300005338 Bacteria 13441
16 Ga0068868_100025791 3300005338 Bacteria 4474
17 Ga0068868_100040257 3300005338 Bacteria 3637
18 Ga0070660_100004274 3300005339 Bacteria 9865
19 Ga0070689_100075861 3300005340 Unclassified 2633
20 Ga0070691_10004844 3300005341 Bacteria 6127
21 Ga0070661_100006659 3300005344 Bacteria 7967
22 Ga0070661_100027429 3300005344 Bacteria 4101
23 Ga0070669_100037758 3300005353 Bacteria 3504
24 Ga0070675_100000554 3300005354 Bacteria 25704
25 Ga0070675_100000869 3300005354 Bacteria 21482
26 Ga0070675_100002273 3300005354 Bacteria 14265
27 Ga0070675_100004656 3300005354 Bacteria 10474
28 Ga0070675_100041278 3300005354 Bacteria 3768
29 Ga0070671_100004582 3300005355 Bacteria 10951
30 Ga0070671_100005192 3300005355 Bacteria 10377
31 Ga0070671_100010255 3300005355 Bacteria 7522
32 Ga0070671_100018653 3300005355 Bacteria 5637
33 Ga0070671_100137655 3300005355 Unclassified 2059
34 Ga0070673_100011103 3300005364 Bacteria 6139
35 Ga0070688_100023582 3300005365 Bacteria 3620
36 Ga0070667_100006097 3300005367 Bacteria 10008
37 Ga0070667_100014154 3300005367 Bacteria 6589
38 Ga0070667_100083753 3300005367 Unclassified 2732
39 Ga0070709_10073831 3300005434 Bacteria 2209
40 Ga0070713_100074753 3300005436 Bacteria 2872
41 Ga0070713_100115883 3300005436 Bacteria 2342
42 Ga0070701_10002309 3300005438 Bacteria 7319
43 Ga0070678_100149549 3300005456 Bacteria 1879
44 Ga0070662_100071459 3300005457 Bacteria 2559
45 Ga0070681_10009445 3300005458 Bacteria 9598
46 Ga0070681_10013581 3300005458 Bacteria 8102
47 Ga0068867_100032504 3300005459 Bacteria 3774
48 Ga0070707_100018452 3300005468 Bacteria 6563
49 Ga0070679_100003989 3300005530 Bacteria 13588
50 Ga0070684_100010256 3300005535 Bacteria 7418
51 Ga0070684_100010259 3300005535 Bacteria 7416
52 Ga0070684_100016589 3300005535 Bacteria 6022
53 Ga0068853_100064008 3300005539 Unclassified 3187
54 Ga0070672_100001094 3300005543 Bacteria 16522
55 Ga0070672_100062167 3300005543 Bacteria 2946
56 Ga0070686_100007072 3300005544 Bacteria 6257
57 Ga0070686_100024467 3300005544 Unclassified 3620
58 Ga0070695_100056145 3300005545 Bacteria 2540
59 Ga0070665_100015754 3300005548 Bacteria 7595
60 Ga0070665_100036727 3300005548 Bacteria 4927
61 Ga0068855_100019750 3300005563 Bacteria 8091
62 Ga0068855_100036104 3300005563 Bacteria 5884
63 Ga0070664_100000181 3300005564 Bacteria 44596
64 Ga0070664_100032109 3300005564 Unclassified 4392
65 Ga0070664_100053207 3300005564 Bacteria 3431
66 Ga0070664_100114867 3300005564 Bacteria 2352
67 Ga0068857_100000083 3300005577 Bacteria 54933
68 Ga0068857_100005636 3300005577 Bacteria 10704
69 Ga0068856_100012123 3300005614 Bacteria 8349
70 Ga0068856_100190109 3300005614 Bacteria 2067
71 Ga0070702_100035577 3300005615 Bacteria 2752
72 Ga0068852_100002631 3300005616 Bacteria 12407
73 Ga0068852_100010176 3300005616 Bacteria 7009
74 Ga0068859_100007174 3300005617 Bacteria 11313
75 Ga0068859_100017465 3300005617 Bacteria 7212
76 Ga0068859_100062981 3300005617 Bacteria 3739
77 Ga0068859_100089959 3300005617 Unclassified 3120
78 Ga0068864_100045020 3300005618 Bacteria 3785
79 Ga0068864_100152724 3300005618 Bacteria 2093
80 Ga0068863_100009356 3300005841 Bacteria 9561
81 Ga0068863_100021038 3300005841 Bacteria 6232
82 Ga0068863_100052419 3300005841 Unclassified 3866
83 Ga0068858_100005824 3300005842 Bacteria 12037
84 Ga0068858_100131103 3300005842 Bacteria 2351
85 Ga0068860_100012510 3300005843 Bacteria 8355
86 Ga0068860_100057572 3300005843 Bacteria 3695
87 Ga0068860_100149458 3300005843 Unclassified 2249
88 Ga0068862_100085884 3300005844 Unclassified 2735
89 Ga0081540_1000211 3300005983 Bacteria 61289
90 Ga0081539_10000209 3300005985 Bacteria 136637
91 Ga0070717_10018174 3300006028 Bacteria 5486
92 Ga0097621_100027920 3300006237 Unclassified 4444
93 Ga0068871_100008284 3300006358 Bacteria 7470
94 Ga0068871_100011761 3300006358 Bacteria 6430
95 Ga0068871_100028649 3300006358 Bacteria 4368
96 Ga0068871_100036237 3300006358 Bacteria 3926
97 Ga0075428_100029887 3300006844 Bacteria 6027
98 Ga0075430_100077677 3300006846 Bacteria 2783
99 Ga0075431_100063601 3300006847 Bacteria 3808
100 Ga0075433_10009626 3300006852 Bacteria 7734
101 Ga0075434_100032331 3300006871 Bacteria 5160
102 Ga0075434_100047597 3300006871 Bacteria 4256
103 Ga0068865_100009193 3300006881 Bacteria 6116
104 Ga0097620_100007174 3300006931 Bacteria 11313
105 Ga0097620_100017465 3300006931 Bacteria 7212
106 Ga0097620_100062982 3300006931 Bacteria 3739
107 Ga0097620_100089951 3300006931 Unclassified 3120
108 Ga0105240_10156777 3300009093 Bacteria 2707
109 Ga0105240_10178820 3300009093 Bacteria 2505
110 Ga0111539_10050825 3300009094 Bacteria 4939
111 Ga0105245_10003721 3300009098 Bacteria 13588
112 Ga0105245_10006897 3300009098 Bacteria 9958
113 Ga0105245_10017619 3300009098 Bacteria 6235
114 Ga0105245_10046830 3300009098 Bacteria 3864
115 Ga0105245_10063995 3300009098 Bacteria 3323
116 Ga0114129_10001193 3300009147 Bacteria 34524
117 Ga0114129_10067891 3300009147 Bacteria 4972
118 Ga0114129_10143743 3300009147 Bacteria 3268
119 Ga0114129_10278479 3300009147 Unclassified 2236
120 Ga0105243_10221286 3300009148 Bacteria 1673
121 Ga0105241_10004939 3300009174 Bacteria 9834
122 Ga0105241_10010673 3300009174 Bacteria 6738
123 Ga0105242_10012668 3300009176 Bacteria 6494
124 Ga0105242_10074704 3300009176 Bacteria 2821
125 Ga0105242_10124636 3300009176 Bacteria 2216
126 Ga0105248_10001746 3300009177 Bacteria 24183
127 Ga0105248_10005445 3300009177 Bacteria 13991
128 Ga0105248_10006151 3300009177 Bacteria 13159
129 Ga0105248_10008653 3300009177 Bacteria 11181
130 Ga0105248_10019913 3300009177 Bacteria 7427
131 Ga0105237_10003000 3300009545 Bacteria 20390
132 Ga0105237_10111818 3300009545 Bacteria 2723
133 Ga0105238_10001024 3300009551 Bacteria 28428
134 Ga0105238_10009457 3300009551 Bacteria 9756
135 Ga0105238_10020721 3300009551 Bacteria 6696
136 Ga0105238_10029444 3300009551 Bacteria 5594
137 Ga0105238_10117932 3300009551 Bacteria 2634
138 Ga0105238_10148337 3300009551 Unclassified 2321
139 Ga0105249_10066986 3300009553 Unclassified 3307
140 Ga0105249_10071968 3300009553 Unclassified 3195
141 Ga0105239_10016569 3300010375 Bacteria 8146
142 Ga0105239_10019371 3300010375 Bacteria 7515
143 Ga0105239_10029157 3300010375 Bacteria 6067
144 Ga0105239_10056524 3300010375 Bacteria 4304
145 Ga0105246_10022976 3300011119 Bacteria 4030
146 Ga0105246_10030910 3300011119 Unclassified 3541
147 Ga0157370_10008910 3300013104 Bacteria 10779
148 Ga0157369_10010761 3300013105 Bacteria 10414
149 Ga0157369_10094743 3300013105 Bacteria 3187
150 Ga0157374_10243008 3300013296 Unclassified 1771
151 Ga0157378_10032816 3300013297 Bacteria 4590
152 Ga0163162_10003158 3300013306 Bacteria 15738
153 Ga0163162_10017656 3300013306 Bacteria 6981
154 Ga0163162_10021463 3300013306 Bacteria 6361
155 Ga0163162_10132550 3300013306 Bacteria 2601
156 Ga0157372_10003294 3300013307 Bacteria 17440
157 Ga0157372_10004760 3300013307 Bacteria 14409
158 Ga0157372_10079265 3300013307 Unclassified 3714
159 Ga0157375_10001701 3300013308 Bacteria 18887
160 Ga0157375_10321939 3300013308 Unclassified 1711
161 Ga0163163_10002320 3300014325 Bacteria 16071
162 Ga0163163_10010840 3300014325 Bacteria 8232
163 Ga0163163_10023889 3300014325 Bacteria 5811
164 Ga0163163_10033586 3300014325 Unclassified 4964
165 Ga0157380_10003750 3300014326 Bacteria 10452
166 Ga0157380_10056528 3300014326 Bacteria 3121
167 Ga0157380_10157188 3300014326 Bacteria 1972
168 Ga0157376_10114260 3300014969 Unclassified 2382
169 Ga0207682_10004976 3300025893 Bacteria 5454
170 Ga0207680_10050147 3300025903 Unclassified 2489
171 Ga0207654_10001867 3300025911 Bacteria 10906
172 Ga0207654_10004960 3300025911 Bacteria 6729
173 Ga0207707_10000635 3300025912 Bacteria 34780
174 Ga0207707_10017402 3300025912 Bacteria 6267
175 Ga0207695_10001870 3300025913 Bacteria 32956
176 Ga0207671_10018616 3300025914 Bacteria 5321
177 Ga0207660_10007814 3300025917 Bacteria 6921
178 Ga0207657_10045341 3300025919 Unclassified 3860
179 Ga0207652_10008592 3300025921 Bacteria 8218
180 Ga0207646_10146321 3300025922 Bacteria 2129
181 Ga0207681_10015445 3300025923 Bacteria 4761
182 Ga0207694_10002548 3300025924 Bacteria 14793
183 Ga0207694_10003433 3300025924 Bacteria 12598
184 Ga0207694_10019825 3300025924 Bacteria 5087
185 Ga0207694_10171034 3300025924 Bacteria 1759
186 Ga0207650_10002756 3300025925 Bacteria 12126
187 Ga0207650_10051302 3300025925 Bacteria 3052
188 Ga0207659_10000825 3300025926 Bacteria 18371
189 Ga0207659_10002218 3300025926 Bacteria 11563
190 Ga0207659_10003516 3300025926 Bacteria 9417
191 Ga0207659_10061057 3300025926 Bacteria 2715
192 Ga0207687_10000466 3300025927 Bacteria 27642
193 Ga0207687_10028620 3300025927 Unclassified 3744
194 Ga0207687_10058115 3300025927 Bacteria 2720
195 Ga0207700_10076885 3300025928 Bacteria 2592
196 Ga0207644_10027072 3300025931 Unclassified 3958
197 Ga0207644_10124170 3300025931 Bacteria 1968
198 Ga0207706_10028531 3300025933 Bacteria 4984
199 Ga0207704_10014630 3300025938 Bacteria 3969
200 Ga0207691_10003572 3300025940 Bacteria 15133
201 Ga0207691_10126034 3300025940 Bacteria 2266
202 Ga0207711_10004461 3300025941 Bacteria 11931
203 Ga0207711_10004745 3300025941 Bacteria 11541
204 Ga0207711_10028923 3300025941 Bacteria 4669
205 Ga0207689_10005777 3300025942 Bacteria 10986
206 Ga0207689_10082547 3300025942 Bacteria 2642
207 Ga0207661_10001003 3300025944 Bacteria 18642
208 Ga0207661_10015925 3300025944 Bacteria 5540
209 Ga0207679_10001387 3300025945 Bacteria 15268
210 Ga0207679_10067933 3300025945 Bacteria 2675
211 Ga0207667_10006553 3300025949 Bacteria 14084
212 Ga0207651_10007299 3300025960 Bacteria 5876
213 Ga0207651_10012766 3300025960 Bacteria 4772
214 Ga0207651_10054468 3300025960 Bacteria 2741
215 Ga0207658_10006204 3300025986 Bacteria 8164
216 Ga0207658_10009129 3300025986 Bacteria 6725
217 Ga0207677_10142683 3300026023 Bacteria 1836
218 Ga0207703_10053657 3300026035 Bacteria 3277
219 Ga0207639_10108660 3300026041 Unclassified 2256
220 Ga0207708_10067566 3300026075 Bacteria 2734
221 Ga0207702_10005075 3300026078 Bacteria 11566
222 Ga0207641_10013879 3300026088 Bacteria 6608
223 Ga0207641_10013911 3300026088 Bacteria 6600
224 Ga0207648_10019645 3300026089 Bacteria 6097
225 Ga0207648_10070806 3300026089 Unclassified 3040
226 Ga0207676_10040324 3300026095 Bacteria 3578
227 Ga0207676_10066922 3300026095 Bacteria 2868
228 Ga0207674_10000698 3300026116 Bacteria 43696
229 Ga0207674_10002313 3300026116 Bacteria 24141
230 Ga0207683_10136039 3300026121 Bacteria 2212
231 Ga0207683_10167988 3300026121 Unclassified 1986
232 Ga0207698_10004972 3300026142 Bacteria 8150
233 Ga0268266_10025304 3300028379 Bacteria 5050
234 Ga0268264_10135185 3300028381 Bacteria 2191
235 Ga0265340_10019671 3300031247 Bacteria 3476
236 Ga0265340_10032867 3300031247 Unclassified 2587
237 Ga0265313_10001957 3300031595 Bacteria 18633
238 Ga0373937_0068008 3300036401 Bacteria 3283
239 Ga0373937_0131006 3300036401 Bacteria 2342
240 Ga0373925_0027328 3300037068 Bacteria 4177
241 Ga0436364_1078340 3300037853 Bacteria 2305
242 Ga0495650_0012080 3300046471 Bacteria 4671
243 Ga0495580_0036410 3300046472 Unclassified 3533
244 Ga0495582_0025792 3300046473 Unclassified 3220
245 Ga0495652_0004918 3300046529 Bacteria 12676
246 Ga0495587_0006474 3300046536 Bacteria 7629
247 Ga0495621_0036131 3300046539 Bacteria 1714
248 Ga0495667_0001821 3300046559 Bacteria 14154
249 Ga0495657_0003691 3300046675 Bacteria 12402
250 Ga0495599_0003778 3300046678 Bacteria 8895
251 Ga0495658_0022570 3300046683 Bacteria 3329
252 Ga0495613_0138158 3300046689 Unclassified 1742
253 Ga0495636_0010025 3300047318 Bacteria 3735
254 Ga0495636_0018427 3300047318 Unclassified 2801
255 Ga0495674_0020246 3300047319 Bacteria 6161
256 Ga0495684_0005595 3300047471 Bacteria 9789
257 Ga0495684_0127708 3300047471 Unclassified 1912
258 Ga0495602_0002027 3300048088 Bacteria 20386
259 Ga0496104_0120697 3300048907 Unclassified 2517
260 Ga0496109_0031565 3300048912 Bacteria 4755
261 Ga0496112_0049595 3300048915 Bacteria 4115
262 Ga0496115_0034298 3300048918 Unclassified 4011
263 nmdc:mga05p37_12378_c1 3300050507 Bacteria 10189
264 nmdc:mga05p37_219527_c1 3300050507 Unclassified 2295
265 nmdc:mga06r32_34483_c1 3300050510 Bacteria 4772
266 nmdc:mga08y16_18909_c1 3300050511 Bacteria 7254
267 nmdc:mga08y16_40667_c1 3300050511 Bacteria 4871
268 nmdc:mga0rr50_126881_c1 3300050513 Unclassified 2038
269 Ga0500641_0001955 3300053096 Bacteria 7321
270 Ga0500658_0013957 3300053134 Bacteria 2971
271 Ga0500568_0015982 3300053139 Bacteria 3346
272 Ga0068871_100059055
273 Ga0065712_10068381
274 Ga0065707_10091078
275 Ga0070683_100001092
276 Ga0070683_100002476
277 Ga0070683_100181119
278 Ga0070690_100009910
279 Ga0070690_100044050
280 Ga0070670_100007459
281 Ga0070670_100009267
282 Ga0070670_100074448
283 Ga0070666_10001730
284 Ga0070666_10002488
285 Ga0070680_100001941
286 Ga0068868_100002209
287 Ga0068868_100025791
288 Ga0068868_100040257
289 Ga0070660_100004274
290 Ga0070689_100075861
291 Ga0070691_10004844
292 Ga0070661_100006659
293 Ga0070661_100027429
294 Ga0070669_100037758
295 Ga0070675_100000554
296 Ga0070675_100000869
297 Ga0070675_100002273
298 Ga0070675_100004656
299 Ga0070675_100041278
300 Ga0070671_100004582
301 Ga0070671_100005192
302 Ga0070671_100010255
303 Ga0070671_100018653
304 Ga0070671_100137655
305 Ga0070673_100011103
306 Ga0070688_100023582
307 Ga0070667_100006097
308 Ga0070667_100014154
309 Ga0070667_100083753
310 Ga0070709_10073831
311 Ga0070713_100074753
312 Ga0070713_100115883
313 Ga0070701_10002309
314 Ga0070678_100149549
315 Ga0070662_100071459
316 Ga0070681_10009445
317 Ga0070681_10013581
318 Ga0068867_100032504
319 Ga0070707_100018452
320 Ga0070679_100003989
321 Ga0070684_100010256
322 Ga0070684_100010259
323 Ga0070684_100016589
324 Ga0068853_100064008
325 Ga0070672_100001094
326 Ga0070672_100062167
327 Ga0070686_100007072
328 Ga0070686_100024467
329 Ga0070695_100056145
330 Ga0070665_100015754
331 Ga0070665_100036727
332 Ga0068855_100019750
333 Ga0068855_100036104
334 Ga0070664_100000181
335 Ga0070664_100032109
336 Ga0070664_100053207
337 Ga0070664_100114867
338 Ga0068857_100000083
339 Ga0068857_100005636
340 Ga0068856_100012123
341 Ga0068856_100190109
342 Ga0070702_100035577
343 Ga0068852_100002631
344 Ga0068852_100010176
345 Ga0068859_100007174
346 Ga0068859_100017465
347 Ga0068859_100062981
348 Ga0068859_100089959
349 Ga0068864_100045020
350 Ga0068864_100152724
351 Ga0068863_100009356
352 Ga0068863_100021038
353 Ga0068863_100052419
354 Ga0068858_100005824
355 Ga0068858_100131103
356 Ga0068860_100012510
357 Ga0068860_100057572
358 Ga0068860_100149458
359 Ga0068862_100085884
360 Ga0081540_1000211
361 Ga0081539_10000209
362 Ga0070717_10018174
363 Ga0097621_100027920
364 Ga0068871_100008284
365 Ga0068871_100011761
366 Ga0068871_100028649
367 Ga0068871_100036237
368 Ga0075428_100029887
369 Ga0075430_100077677
370 Ga0075431_100063601
371 Ga0075433_10009626
372 Ga0075434_100032331
373 Ga0075434_100047597
374 Ga0068865_100009193
375 Ga0097620_100007174
376 Ga0097620_100017465
377 Ga0097620_100062982
378 Ga0097620_100089951
379 Ga0105240_10156777
380 Ga0105240_10178820
381 Ga0111539_10050825
382 Ga0105245_10003721
383 Ga0105245_10006897
384 Ga0105245_10017619
385 Ga0105245_10046830
386 Ga0105245_10063995
387 Ga0114129_10001193
388 Ga0114129_10067891
389 Ga0114129_10143743
390 Ga0114129_10278479
391 Ga0105243_10221286
392 Ga0105241_10004939
393 Ga0105241_10010673
394 Ga0105242_10012668
395 Ga0105242_10074704
396 Ga0105242_10124636
397 Ga0105248_10001746
398 Ga0105248_10005445
399 Ga0105248_10006151
400 Ga0105248_10008653
401 Ga0105248_10019913
402 Ga0105237_10003000
403 Ga0105237_10111818
404 Ga0105238_10001024
405 Ga0105238_10009457
406 Ga0105238_10020721
407 Ga0105238_10029444
408 Ga0105238_10117932
409 Ga0105238_10148337
410 Ga0105249_10066986
411 Ga0105249_10071968
412 Ga0105239_10016569
413 Ga0105239_10019371
414 Ga0105239_10029157
415 Ga0105239_10056524
416 Ga0105246_10022976
417 Ga0105246_10030910
418 Ga0157370_10008910
419 Ga0157369_10010761
420 Ga0157369_10094743
421 Ga0157374_10243008
422 Ga0157378_10032816
423 Ga0163162_10003158
424 Ga0163162_10017656
425 Ga0163162_10021463
426 Ga0163162_10132550
427 Ga0157372_10003294
428 Ga0157372_10004760
429 Ga0157372_10079265
430 Ga0157375_10001701
431 Ga0157375_10321939
432 Ga0163163_10002320
433 Ga0163163_10010840
434 Ga0163163_10023889
435 Ga0163163_10033586
436 Ga0157380_10003750
437 Ga0157380_10056528
438 Ga0157380_10157188
439 Ga0157376_10114260
440 Ga0207682_10004976
441 Ga0207680_10050147
442 Ga0207654_10001867
443 Ga0207654_10004960
444 Ga0207707_10000635
445 Ga0207707_10017402
446 Ga0207695_10001870
447 Ga0207671_10018616
448 Ga0207660_10007814
449 Ga0207657_10045341
450 Ga0207652_10008592
451 Ga0207646_10146321
452 Ga0207681_10015445
453 Ga0207694_10002548
454 Ga0207694_10003433
455 Ga0207694_10019825
456 Ga0207694_10171034
457 Ga0207650_10002756
458 Ga0207650_10051302
459 Ga0207659_10000825
460 Ga0207659_10002218
461 Ga0207659_10003516
462 Ga0207659_10061057
463 Ga0207687_10000466
464 Ga0207687_10028620
465 Ga0207687_10058115
466 Ga0207700_10076885
467 Ga0207644_10027072
468 Ga0207644_10124170
469 Ga0207706_10028531
470 Ga0207704_10014630
471 Ga0207691_10003572
472 Ga0207691_10126034
473 Ga0207711_10004461
474 Ga0207711_10004745
475 Ga0207711_10028923
476 Ga0207689_10005777
477 Ga0207689_10082547
478 Ga0207661_10001003
479 Ga0207661_10015925
480 Ga0207679_10001387
481 Ga0207679_10067933
482 Ga0207667_10006553
483 Ga0207651_10007299
484 Ga0207651_10012766
485 Ga0207651_10054468
486 Ga0207658_10006204
487 Ga0207658_10009129
488 Ga0207677_10142683
489 Ga0207703_10053657
490 Ga0207639_10108660
491 Ga0207708_10067566
492 Ga0207702_10005075
493 Ga0207641_10013879
494 Ga0207641_10013911
495 Ga0207648_10019645
496 Ga0207648_10070806
497 Ga0207676_10040324
498 Ga0207676_10066922
499 Ga0207674_10000698
500 Ga0207674_10002313
501 Ga0207683_10136039
502 Ga0207683_10167988
503 Ga0207698_10004972
504 Ga0268266_10025304
505 Ga0268264_10135185
506 Ga0265340_10019671
507 Ga0265340_10032867
508 Ga0265313_10001957
509 Ga0373937_0068008
510 Ga0373937_0131006
511 Ga0373925_0027328
512 Ga0436364_1078340
513 Ga0495650_0012080
514 Ga0495580_0036410
515 Ga0495582_0025792
516 Ga0495652_0004918
517 Ga0495587_0006474
518 Ga0495621_0036131
519 Ga0495667_0001821
520 Ga0495657_0003691
521 Ga0495599_0003778
522 Ga0495658_0022570
523 Ga0495613_0138158
524 Ga0495636_0010025
525 Ga0495636_0018427
526 Ga0495674_0020246
527 Ga0495684_0005595
528 Ga0495684_0127708
529 Ga0495602_0002027
530 Ga0496104_0120697
531 Ga0496109_0031565
532 Ga0496112_0049595
533 Ga0496115_0034298
534 nmdc:mga05p37_12378_c1
535 nmdc:mga05p37_219527_c1
536 nmdc:mga06r32_34483_c1
537 nmdc:mga08y16_18909_c1
538 nmdc:mga08y16_40667_c1
539 nmdc:mga0rr50_126881_c1
540 Ga0500641_0001955
541 Ga0500658_0013957
542 Ga0500568_0015982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07519

Tannase

Tannase and feruloyl esterase

114

574

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qz2-assembly4.cif.gz_D structure of mhetase from ideonella sakaiensis 0.9024 43 525
6qga-assembly5.cif.gz_E crystal structure of ideonella sakaiensis mhetase bound to the non-hydrolyzable ligand mheta 0.8963 43 525
6qg9-assembly5.cif.gz_E crystal structure of ideonella sakaiensis mhetase 0.8893 43 525
6jtt-assembly1.cif.gz_A mhetase in complex with bhet 0.882 43 525
6qg9-assembly7.cif.gz_G crystal structure of ideonella sakaiensis mhetase 0.8804 39 525
ID Description Score Start End Superfamily
af_Q54T49_3_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9237 406 453 3.40.50.1820
af_D4A328_4_184_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8424 404 453 3.40.50.1820
af_P39946_151_493_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8088 54 87 2.130.10.10
af_Q05946_160_365_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.802 54 88 2.130.10.10
af_Q4D5S0_57_247_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.793 406 447 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V9JSN8-F1-model_v4 Tannase/feruloyl esterase family alpha/beta hydrolase 0.9914 388 524 GO:0052689
AF-A0A2V9D314-F1-model_v4 Tannase/feruloyl esterase family alpha/beta hydrolase 0.9905 454 524 GO:0052689
AF-A0A7V2HH80-F1-model_v4 Tannase/feruloyl esterase family alpha/beta hydrolase 0.9845 395 524 GO:0052689
AF-A0A2V9JSN8-F1-model_v4 Tannase/feruloyl esterase family alpha/beta hydrolase 0.9772 388 524 GO:0052689
AF-A0A2V8B422-F1-model_v4 Tannase/feruloyl esterase family alpha/beta hydrolase 0.9771 391 522 GO:0046872
GO:0052689

Map