F377376

General Info

Members Datasets Scaffolds Average Seq Length
271 194 542 264

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10128682|rootH2_101286822
Length 289
Sequence VPPALVFDCDGVLADTERYGHLPAFNQTFQEFGLPVRWSDADYAELVKVGGGKERMKTLLTPDFIAKVGLPSDPDALGTEVARWHRRKTEIYTGIIAGGAIPPRPGVRRIAAEAHAAGWPLAVASTSAEPSVRAVLDLAAGPELAAHFSVFAGDVVPRKKPAPDIYAYAAERMGLDPAQTMVVEDSRNGMLAALAAGLPCTVTTSAYTGQEDFTGAALVVSTLGDPAGPEAGGAGTQDLRGGDGPDGSGAVTTEVLADPFGIDPRPYVRLADLAALIGLAAKNPGTGPH

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
103 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
191 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
192 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
193 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
194 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0.74
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 12.55
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10128682 3300003320 Bacteria 2149
2 Ga0070682_100012373 3300005337 Bacteria 4893
3 Ga0070682_100141179 3300005337 Bacteria 1642
4 Ga0070682_100327714 3300005337 Bacteria 1134
5 Ga0070691_10050088 3300005341 Bacteria 1992
6 Ga0070668_100219718 3300005347 Bacteria 1567
7 Ga0070675_100043381 3300005354 Bacteria 3675
8 Ga0070673_100098195 3300005364 Bacteria 2407
9 Ga0070659_100254592 3300005366 Bacteria 1456
10 Ga0070714_100015651 3300005435 Bacteria 6105
11 Ga0070714_100157352 3300005435 Bacteria 2052
12 Ga0070713_100183792 3300005436 Bacteria 1880
13 Ga0070713_100255873 3300005436 Bacteria 1599
14 Ga0070711_100174702 3300005439 Bacteria 1640
15 Ga0070700_100003533 3300005441 Bacteria 8064
16 Ga0070663_100068581 3300005455 Bacteria 2575
17 Ga0070678_100535674 3300005456 Bacteria 1038
18 Ga0070662_100013216 3300005457 Bacteria 5489
19 Ga0070685_10026770 3300005466 Bacteria 3180
20 Ga0070684_100041783 3300005535 Bacteria 3955
21 Ga0070684_100061140 3300005535 Bacteria 3296
22 Ga0070684_100408680 3300005535 Bacteria 1252
23 Ga0068853_100012990 3300005539 Bacteria 6789
24 Ga0070665_100051114 3300005548 Bacteria 4146
25 Ga0070665_100075636 3300005548 Bacteria 3374
26 Ga0070704_100444427 3300005549 Bacteria 1115
27 Ga0070664_100023388 3300005564 Bacteria 5103
28 Ga0068857_100289591 3300005577 Bacteria 1508
29 Ga0068856_100066637 3300005614 Bacteria 3557
30 Ga0068856_100163373 3300005614 Bacteria 2238
31 Ga0068859_100124488 3300005617 Bacteria 2646
32 Ga0068864_100073051 3300005618 Bacteria 2990
33 Ga0068858_100237267 3300005842 Bacteria 1729
34 Ga0081538_10031853 3300005981 Bacteria 3547
35 Ga0081538_10124590 3300005981 Bacteria 1229
36 Ga0081540_1002567 3300005983 Bacteria 14736
37 Ga0081540_1012342 3300005983 Bacteria 5636
38 Ga0081540_1045330 3300005983 Bacteria 2235
39 Ga0070717_10027318 3300006028 Bacteria 4561
40 Ga0070717_10028793 3300006028 Bacteria 4450
41 Ga0070717_10427196 3300006028 Bacteria 1192
42 Ga0075432_10000099 3300006058 Bacteria 18409
43 Ga0070712_100014049 3300006175 Bacteria 5133
44 Ga0097621_100548762 3300006237 Bacteria 1052
45 Ga0075431_100285882 3300006847 Bacteria 1669
46 Ga0075433_10001181 3300006852 Bacteria 18990
47 Ga0075433_10158496 3300006852 Bacteria 2014
48 Ga0075434_100019484 3300006871 Bacteria 6567
49 Ga0075434_100150147 3300006871 Bacteria 2350
50 Ga0068865_100054662 3300006881 Bacteria 2775
51 Ga0075436_100137865 3300006914 Bacteria 1714
52 Ga0097620_100124489 3300006931 Bacteria 2646
53 Ga0075435_100000430 3300007076 Bacteria 25677
54 Ga0075435_100195355 3300007076 Bacteria 1713
55 Ga0075435_100419060 3300007076 Bacteria 1153
56 Ga0105240_10253861 3300009093 Bacteria 2032
57 Ga0111539_10009937 3300009094 Bacteria 12001
58 Ga0111539_10044762 3300009094 Bacteria 5300
59 Ga0111539_10672761 3300009094 Bacteria 1205
60 Ga0105245_10061258 3300009098 Bacteria 3392
61 Ga0105245_10067799 3300009098 Bacteria 3232
62 Ga0105243_10044487 3300009148 Bacteria 3483
63 Ga0105243_10326920 3300009148 Bacteria 1399
64 Ga0105242_10075134 3300009176 Bacteria 2813
65 Ga0105248_10031371 3300009177 Bacteria 5941
66 Ga0105248_10355500 3300009177 Bacteria 1649
67 Ga0105237_10044619 3300009545 Bacteria 4464
68 Ga0105237_10081430 3300009545 Bacteria 3228
69 Ga0105237_10294884 3300009545 Bacteria 1624
70 Ga0105249_10009782 3300009553 Bacteria 8399
71 Ga0105239_10036901 3300010375 Bacteria 5362
72 Ga0105239_10238105 3300010375 Bacteria 2043
73 Ga0157369_10000926 3300013105 Bacteria 37311
74 Ga0157374_10037231 3300013296 Bacteria 4463
75 Ga0157372_10029942 3300013307 Bacteria 5949
76 Ga0157372_10548393 3300013307 Bacteria 1348
77 Ga0157375_10031809 3300013308 Bacteria 4996
78 Ga0157375_10451559 3300013308 Bacteria 1451
79 Ga0163163_10112029 3300014325 Bacteria 2758
80 Ga0163163_10780329 3300014325 Bacteria 1019
81 Ga0157380_10094422 3300014326 Bacteria 2476
82 Ga0182008_10033943 3300014497 Bacteria 2559
83 Ga0157377_10006619 3300014745 Bacteria 5538
84 Ga0157377_10217494 3300014745 Bacteria 1221
85 Ga0157376_10512687 3300014969 Bacteria 1181
86 Ga0206350_10831762 3300020080 Bacteria 3276
87 Ga0213876_10024157 3300021384 Bacteria 3208
88 Ga0224712_10008255 3300022467 Bacteria 3076
89 Ga0207710_10195779 3300025900 Bacteria 997
90 Ga0207688_10002125 3300025901 Bacteria 10644
91 Ga0207688_10035163 3300025901 Bacteria 2775
92 Ga0207647_10070483 3300025904 Bacteria 2111
93 Ga0207695_10543303 3300025913 Bacteria 1043
94 Ga0207671_10250706 3300025914 Bacteria 1392
95 Ga0207693_10038577 3300025915 Bacteria 3761
96 Ga0207663_10147985 3300025916 Bacteria 1644
97 Ga0207687_10086680 3300025927 Bacteria 2274
98 Ga0207700_10188152 3300025928 Bacteria 1733
99 Ga0207700_10223941 3300025928 Bacteria 1596
100 Ga0207690_10121821 3300025932 Bacteria 1896
101 Ga0207686_10096206 3300025934 Bacteria 1967
102 Ga0207669_10123014 3300025937 Bacteria 1766
103 Ga0207691_10242244 3300025940 Bacteria 1559
104 Ga0207711_10276987 3300025941 Bacteria 1544
105 Ga0207661_10047429 3300025944 Bacteria 3410
106 Ga0207661_10251690 3300025944 Bacteria 1570
107 Ga0207679_10061421 3300025945 Bacteria 2797
108 Ga0207651_10010784 3300025960 Bacteria 5081
109 Ga0207668_10159756 3300025972 Bacteria 1755
110 Ga0207640_10050483 3300025981 Bacteria 2699
111 Ga0207677_10193512 3300026023 Bacteria 1610
112 Ga0207639_10011282 3300026041 Bacteria 6200
113 Ga0207678_10072369 3300026067 Bacteria 2954
114 Ga0207708_10005337 3300026075 Bacteria 9469
115 Ga0207708_10092583 3300026075 Bacteria 2333
116 Ga0207702_10230282 3300026078 Bacteria 1731
117 Ga0207641_10414433 3300026088 Bacteria 1296
118 Ga0207676_10050888 3300026095 Bacteria 3232
119 Ga0207674_10056951 3300026116 Bacteria 3965
120 Ga0207698_10011320 3300026142 Bacteria 5777
121 Ga0207428_10019475 3300027907 Bacteria 5786
122 Ga0207428_10040108 3300027907 Bacteria 3800
123 Ga0207428_10090404 3300027907 Bacteria 2378
124 Ga0268265_10121642 3300028380 Bacteria 2152
125 Ga0265337_1006347 3300028556 Bacteria 4574
126 Ga0307513_10002345 3300031456 Bacteria 26347
127 Ga0373935_0105783 3300035692 Bacteria 1861
128 Ga0395899_0044904 3300037312 Bacteria 3291
129 Ga0395900_0258687 3300037418 Bacteria 1739
130 Ga0395898_0002776 3300037466 Bacteria 20131
131 Ga0436365_0334427 3300039437 Bacteria 5197
132 Ga0436362_0571022 3300039453 Bacteria 2751
133 Ga0451791_0874933 3300041451 Bacteria 1718
134 Ga0451793_0030040 3300041452 Bacteria 12686
135 Ga0451833_1224380 3300041491 Bacteria 1843
136 Ga0451837_1334231 3300041494 Bacteria 2360
137 Ga0451841_0237529 3300041498 Bacteria 7098
138 Ga0451855_1141175 3300041511 Bacteria 995
139 Ga0451853_0450880 3300041512 Bacteria 5781
140 Ga0439448_0008180 3300042005 Bacteria 3056
141 Ga0439455_0039850 3300042012 Bacteria 1199
142 Ga0466963_0010993 3300044694 Bacteria 5503
143 Ga0466957_0134549 3300044842 Bacteria 1587
144 Ga0495592_0004026 3300046454 Bacteria 10673
145 Ga0495629_0007646 3300046459 Bacteria 7958
146 Ga0495629_0047716 3300046459 Bacteria 3004
147 Ga0495664_0131603 3300046477 Bacteria 1515
148 Ga0495608_0092583 3300046511 Bacteria 1953
149 Ga0495620_0001093 3300046515 Bacteria 16563
150 Ga0495628_0018212 3300046516 Bacteria 5823
151 Ga0495643_0002411 3300046522 Bacteria 14864
152 Ga0495648_0038187 3300046524 Bacteria 3075
153 Ga0495652_0145875 3300046529 Bacteria 1855
154 Ga0495640_0005145 3300046533 Bacteria 10395
155 Ga0495667_0140767 3300046559 Bacteria 1555
156 Ga0495668_0000259 3300046616 Bacteria 74862
157 Ga0495634_0069515 3300046642 Bacteria 2323
158 Ga0495625_0003277 3300046660 Bacteria 16357
159 Ga0495635_0087708 3300046663 Bacteria 2129
160 Ga0495657_0023866 3300046675 Bacteria 4365
161 Ga0495613_0050102 3300046689 Bacteria 3080
162 Ga0495613_0110620 3300046689 Bacteria 1979
163 Ga0495624_0014418 3300046690 Bacteria 5364
164 Ga0495649_0079577 3300046694 Bacteria 1753
165 Ga0495604_0019070 3300047317 Bacteria 5493
166 Ga0495604_0195527 3300047317 Bacteria 1406
167 Ga0495676_0014471 3300047321 Bacteria 7060
168 Ga0495676_0029978 3300047321 Bacteria 4624
169 Ga0495676_0075537 3300047321 Bacteria 2577
170 Ga0495680_0375919 3300047322 Bacteria 985
171 Ga0495593_0023629 3300047673 Bacteria 3415
172 Ga0495593_0137993 3300047673 Bacteria 1236
173 Ga0495614_0022334 3300048089 Bacteria 2731
174 Ga0495626_0001026 3300048091 Bacteria 24018
175 Ga0496101_0032744 3300048904 Bacteria 3662
176 Ga0496101_0035463 3300048904 Bacteria 3528
177 Ga0496101_0076673 3300048904 Bacteria 2463
178 Ga0496101_0405592 3300048904 Bacteria 1074
179 Ga0496102_0040385 3300048905 Bacteria 4220
180 Ga0496104_0006011 3300048907 Bacteria 10642
181 Ga0496104_0087579 3300048907 Bacteria 2974
182 Ga0496104_0447613 3300048907 Bacteria 1203
183 Ga0496105_0000927 3300048908 Bacteria 19975
184 Ga0496105_0034846 3300048908 Bacteria 4142
185 Ga0496106_0075657 3300048909 Bacteria 2579
186 Ga0496107_0146902 3300048910 Bacteria 1743
187 Ga0496108_0026896 3300048911 Bacteria 4747
188 Ga0496108_0042385 3300048911 Bacteria 3799
189 Ga0496108_0145740 3300048911 Bacteria 2041
190 Ga0496109_0001511 3300048912 Bacteria 19346
191 Ga0496109_0067077 3300048912 Bacteria 3286
192 Ga0496109_0106742 3300048912 Bacteria 2601
193 Ga0496109_0111227 3300048912 Bacteria 2547
194 Ga0496110_0011802 3300048913 Bacteria 7171
195 Ga0496110_0062166 3300048913 Bacteria 3297
196 Ga0496111_0001202 3300048914 Bacteria 14446
197 Ga0496111_0025360 3300048914 Bacteria 4183
198 Ga0496112_0062905 3300048915 Bacteria 3661
199 Ga0496112_0102649 3300048915 Bacteria 2830
200 Ga0496112_0120518 3300048915 Bacteria 2593
201 Ga0496113_0013054 3300048916 Bacteria 5608
202 Ga0496113_0046863 3300048916 Bacteria 3211
203 Ga0496114_0105799 3300048917 Bacteria 2407
204 Ga0496114_0298934 3300048917 Bacteria 1421
205 Ga0496115_0056742 3300048918 Bacteria 3148
206 Ga0496115_0114671 3300048918 Bacteria 2215
207 Ga0496117_0000174 3300048920 Bacteria 132648
208 Ga0496117_0016333 3300048920 Bacteria 6268
209 Ga0496126_0085128 3300048929 Bacteria 2788
210 Ga0501031_0027582 3300049568 Bacteria 3702
211 Ga0501031_0100931 3300049568 Bacteria 1883
212 Ga0501032_0021812 3300049569 Bacteria 4448
213 Ga0501033_0420835 3300049570 Bacteria 930
214 Ga0501034_0077110 3300049571 Bacteria 3338
215 Ga0501034_0174552 3300049571 Bacteria 2115
216 Ga0501036_0072659 3300049572 Bacteria 2908
217 Ga0501036_0432156 3300049572 Bacteria 1097
218 Ga0501037_0009319 3300049573 Bacteria 7203
219 Ga0501037_0010114 3300049573 Bacteria 6922
220 Ga0501038_0019423 3300049574 Bacteria 6124
221 Ga0501038_0059076 3300049574 Bacteria 3286
222 Ga0501038_0188414 3300049574 Bacteria 1661
223 Ga0501039_0007593 3300049575 Bacteria 8282
224 Ga0501040_0025270 3300049576 Bacteria 3993
225 Ga0501042_0021679 3300049578 Bacteria 4480
226 Ga0501043_0100016 3300049579 Bacteria 2279
227 Ga0501046_0028293 3300049580 Bacteria 4566
228 Ga0501047_0000064 3300049581 Bacteria 136110
229 Ga0501047_0063248 3300049581 Bacteria 3570
230 Ga0501047_0087458 3300049581 Bacteria 2993
231 Ga0501047_0514957 3300049581 Unclassified 1022
232 Ga0501048_0005570 3300049582 Bacteria 9582
233 Ga0501068_0007149 3300049584 Bacteria 6180
234 Ga0501070_0038446 3300049586 Bacteria 3992
235 Ga0501071_0031967 3300049587 Bacteria 3734
236 Ga0501072_0030812 3300049588 Bacteria 4196
237 Ga0501073_0200153 3300049589 Bacteria 1381
238 Ga0501074_0140241 3300049590 Bacteria 1729
239 Ga0501076_0076989 3300049592 Bacteria 2675
240 Ga0501077_0025740 3300049593 Bacteria 3734
241 Ga0501080_0079378 3300049742 Bacteria 3051
242 Ga0501080_0625587 3300049742 Bacteria 954
243 Ga0501081_0031498 3300049743 Bacteria 3594
244 Ga0501083_0000229 3300049744 Bacteria 35953
245 Ga0501035_0317082 3300049822 Bacteria 1310
246 Ga0501044_0091720 3300049823 Bacteria 3064
247 Ga0501044_0178061 3300049823 Bacteria 2094
248 Ga0501044_0184164 3300049823 Bacteria 2054
249 Ga0501045_0128751 3300049824 Bacteria 1881
250 nmdc:mga06r32_298352_c1 3300050510 Bacteria 1598
251 nmdc:mga08y16_181607_c1 3300050511 Bacteria 2185
252 nmdc:mga08y16_67399_c1 3300050511 Bacteria 3734
253 nmdc:mga0n895_13779_c1 3300050512 Bacteria 7312
254 nmdc:mga0rr50_184769_c1 3300050513 Bacteria 1706
255 nmdc:mga0rr50_8592_c1 3300050513 Bacteria 6366
256 nmdc:mga08x19_216307_c1 3300050514 Bacteria 1316
257 nmdc:mga0a205_131149_c1 3300050515 Bacteria 2406
258 nmdc:mga0a205_6275_c1 3300050515 Bacteria 10731
259 Ga0500635_0000472 3300053080 Bacteria 11439
260 Ga0500644_0004453 3300053088 Bacteria 3506
261 Ga0500616_0000010 3300053153 Bacteria 761410
262 Ga0501084_0047564 3300054114 Bacteria 3592
263 Ga0501084_0140640 3300054114 Bacteria 2032
264 Ga0501082_0011292 3300060353 Bacteria 7678
265 Ga0501082_0179199 3300060353 Bacteria 1843
266 Ga0530510_0006472 3300061734 Bacteria 8157
267 2644183380 2643221632 Bacteria 3406696
268 2644526247 2643221694 Bacteria 4392972
269 2644670922 2643221722 Bacteria 4247614
270 2816422585 2816332119 Bacteria 8120218
271 2939660300 2939657138 Bacteria 3740283
272 rootH2_10128682
273 Ga0070682_100012373
274 Ga0070682_100141179
275 Ga0070682_100327714
276 Ga0070691_10050088
277 Ga0070668_100219718
278 Ga0070675_100043381
279 Ga0070673_100098195
280 Ga0070659_100254592
281 Ga0070714_100015651
282 Ga0070714_100157352
283 Ga0070713_100183792
284 Ga0070713_100255873
285 Ga0070711_100174702
286 Ga0070700_100003533
287 Ga0070663_100068581
288 Ga0070678_100535674
289 Ga0070662_100013216
290 Ga0070685_10026770
291 Ga0070684_100041783
292 Ga0070684_100061140
293 Ga0070684_100408680
294 Ga0068853_100012990
295 Ga0070665_100051114
296 Ga0070665_100075636
297 Ga0070704_100444427
298 Ga0070664_100023388
299 Ga0068857_100289591
300 Ga0068856_100066637
301 Ga0068856_100163373
302 Ga0068859_100124488
303 Ga0068864_100073051
304 Ga0068858_100237267
305 Ga0081538_10031853
306 Ga0081538_10124590
307 Ga0081540_1002567
308 Ga0081540_1012342
309 Ga0081540_1045330
310 Ga0070717_10027318
311 Ga0070717_10028793
312 Ga0070717_10427196
313 Ga0075432_10000099
314 Ga0070712_100014049
315 Ga0097621_100548762
316 Ga0075431_100285882
317 Ga0075433_10001181
318 Ga0075433_10158496
319 Ga0075434_100019484
320 Ga0075434_100150147
321 Ga0068865_100054662
322 Ga0075436_100137865
323 Ga0097620_100124489
324 Ga0075435_100000430
325 Ga0075435_100195355
326 Ga0075435_100419060
327 Ga0105240_10253861
328 Ga0111539_10009937
329 Ga0111539_10044762
330 Ga0111539_10672761
331 Ga0105245_10061258
332 Ga0105245_10067799
333 Ga0105243_10044487
334 Ga0105243_10326920
335 Ga0105242_10075134
336 Ga0105248_10031371
337 Ga0105248_10355500
338 Ga0105237_10044619
339 Ga0105237_10081430
340 Ga0105237_10294884
341 Ga0105249_10009782
342 Ga0105239_10036901
343 Ga0105239_10238105
344 Ga0157369_10000926
345 Ga0157374_10037231
346 Ga0157372_10029942
347 Ga0157372_10548393
348 Ga0157375_10031809
349 Ga0157375_10451559
350 Ga0163163_10112029
351 Ga0163163_10780329
352 Ga0157380_10094422
353 Ga0182008_10033943
354 Ga0157377_10006619
355 Ga0157377_10217494
356 Ga0157376_10512687
357 Ga0206350_10831762
358 Ga0213876_10024157
359 Ga0224712_10008255
360 Ga0207710_10195779
361 Ga0207688_10002125
362 Ga0207688_10035163
363 Ga0207647_10070483
364 Ga0207695_10543303
365 Ga0207671_10250706
366 Ga0207693_10038577
367 Ga0207663_10147985
368 Ga0207687_10086680
369 Ga0207700_10188152
370 Ga0207700_10223941
371 Ga0207690_10121821
372 Ga0207686_10096206
373 Ga0207669_10123014
374 Ga0207691_10242244
375 Ga0207711_10276987
376 Ga0207661_10047429
377 Ga0207661_10251690
378 Ga0207679_10061421
379 Ga0207651_10010784
380 Ga0207668_10159756
381 Ga0207640_10050483
382 Ga0207677_10193512
383 Ga0207639_10011282
384 Ga0207678_10072369
385 Ga0207708_10005337
386 Ga0207708_10092583
387 Ga0207702_10230282
388 Ga0207641_10414433
389 Ga0207676_10050888
390 Ga0207674_10056951
391 Ga0207698_10011320
392 Ga0207428_10019475
393 Ga0207428_10040108
394 Ga0207428_10090404
395 Ga0268265_10121642
396 Ga0265337_1006347
397 Ga0307513_10002345
398 Ga0373935_0105783
399 Ga0395899_0044904
400 Ga0395900_0258687
401 Ga0395898_0002776
402 Ga0436365_0334427
403 Ga0436362_0571022
404 Ga0451791_0874933
405 Ga0451793_0030040
406 Ga0451833_1224380
407 Ga0451837_1334231
408 Ga0451841_0237529
409 Ga0451855_1141175
410 Ga0451853_0450880
411 Ga0439448_0008180
412 Ga0439455_0039850
413 Ga0466963_0010993
414 Ga0466957_0134549
415 Ga0495592_0004026
416 Ga0495629_0007646
417 Ga0495629_0047716
418 Ga0495664_0131603
419 Ga0495608_0092583
420 Ga0495620_0001093
421 Ga0495628_0018212
422 Ga0495643_0002411
423 Ga0495648_0038187
424 Ga0495652_0145875
425 Ga0495640_0005145
426 Ga0495667_0140767
427 Ga0495668_0000259
428 Ga0495634_0069515
429 Ga0495625_0003277
430 Ga0495635_0087708
431 Ga0495657_0023866
432 Ga0495613_0050102
433 Ga0495613_0110620
434 Ga0495624_0014418
435 Ga0495649_0079577
436 Ga0495604_0019070
437 Ga0495604_0195527
438 Ga0495676_0014471
439 Ga0495676_0029978
440 Ga0495676_0075537
441 Ga0495680_0375919
442 Ga0495593_0023629
443 Ga0495593_0137993
444 Ga0495614_0022334
445 Ga0495626_0001026
446 Ga0496101_0032744
447 Ga0496101_0035463
448 Ga0496101_0076673
449 Ga0496101_0405592
450 Ga0496102_0040385
451 Ga0496104_0006011
452 Ga0496104_0087579
453 Ga0496104_0447613
454 Ga0496105_0000927
455 Ga0496105_0034846
456 Ga0496106_0075657
457 Ga0496107_0146902
458 Ga0496108_0026896
459 Ga0496108_0042385
460 Ga0496108_0145740
461 Ga0496109_0001511
462 Ga0496109_0067077
463 Ga0496109_0106742
464 Ga0496109_0111227
465 Ga0496110_0011802
466 Ga0496110_0062166
467 Ga0496111_0001202
468 Ga0496111_0025360
469 Ga0496112_0062905
470 Ga0496112_0102649
471 Ga0496112_0120518
472 Ga0496113_0013054
473 Ga0496113_0046863
474 Ga0496114_0105799
475 Ga0496114_0298934
476 Ga0496115_0056742
477 Ga0496115_0114671
478 Ga0496117_0000174
479 Ga0496117_0016333
480 Ga0496126_0085128
481 Ga0501031_0027582
482 Ga0501031_0100931
483 Ga0501032_0021812
484 Ga0501033_0420835
485 Ga0501034_0077110
486 Ga0501034_0174552
487 Ga0501036_0072659
488 Ga0501036_0432156
489 Ga0501037_0009319
490 Ga0501037_0010114
491 Ga0501038_0019423
492 Ga0501038_0059076
493 Ga0501038_0188414
494 Ga0501039_0007593
495 Ga0501040_0025270
496 Ga0501042_0021679
497 Ga0501043_0100016
498 Ga0501046_0028293
499 Ga0501047_0000064
500 Ga0501047_0063248
501 Ga0501047_0087458
502 Ga0501047_0514957
503 Ga0501048_0005570
504 Ga0501068_0007149
505 Ga0501070_0038446
506 Ga0501071_0031967
507 Ga0501072_0030812
508 Ga0501073_0200153
509 Ga0501074_0140241
510 Ga0501076_0076989
511 Ga0501077_0025740
512 Ga0501080_0079378
513 Ga0501080_0625587
514 Ga0501081_0031498
515 Ga0501083_0000229
516 Ga0501035_0317082
517 Ga0501044_0091720
518 Ga0501044_0178061
519 Ga0501044_0184164
520 Ga0501045_0128751
521 nmdc:mga06r32_298352_c1
522 nmdc:mga08y16_181607_c1
523 nmdc:mga08y16_67399_c1
524 nmdc:mga0n895_13779_c1
525 nmdc:mga0rr50_184769_c1
526 nmdc:mga0rr50_8592_c1
527 nmdc:mga08x19_216307_c1
528 nmdc:mga0a205_131149_c1
529 nmdc:mga0a205_6275_c1
530 Ga0500635_0000472
531 Ga0500644_0004453
532 Ga0500616_0000010
533 Ga0501084_0047564
534 Ga0501084_0140640
535 Ga0501082_0011292
536 Ga0501082_0179199
537 Ga0530510_0006472
538 2644183380
539 2644526247
540 2644670922
541 2816422585
542 2939660300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

157

226

0.85

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

5

203

0.84

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

2

197

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uav-assembly1.cif.gz_A crystal structure of cbby (at3g48420) from arabidobsis thaliana 0.881 1 226
6hdh-assembly1.cif.gz_A r49k variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer to 1.6 a. 0.829 1 203
2go7-assembly3.cif.gz_C crystal structure of a hydrolase from haloacid dehalogenase-like family (sp_2064) from streptococcus pneumoniae tigr4 at 2.10 a resolution 0.8274 2 202
3kbb-assembly1.cif.gz_A crystal structure of putative beta-phosphoglucomutase from thermotoga maritima 0.8271 3 204
4g9b-assembly1.cif.gz_A-2 crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid 0.8267 3 222
ID Description Score Start End Superfamily
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9607 104 219 3.40.50.1000
af_Q6ZDS0_185_318_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9604 104 219 3.40.50.1000
4uavA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9343 1 226 3.40.50.1000
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9297 104 219 3.40.50.1000
4uatA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9272 103 222 3.40.50.1000
ID Description Score Start End GO Terms
AF-U2T4L2-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9772 3 127 GO:0016787
AF-A0A7S0V7N9-F1-model_v4 Riboflavin kinase 0.9724 102 223 GO:0016787
AF-A0A7X6NSP5-F1-model_v4 HAD-IA family hydrolase 0.971 2 278 GO:0016787
AF-A0A7X8B8K3-F1-model_v4 HAD-IA family hydrolase 0.9705 1 278 GO:0016787
AF-A0A3D3BR11-F1-model_v4 Haloacid dehalogenase 0.9676 104 277 GO:0016787

Map