F377296

General Info

Members Datasets Scaffolds Average Seq Length
270 155 262 166

Family's Representative Sequence

Representative Sequence 3300053157|Ga0500624_000135|Ga0500624_000135_2464_3042
Length 192
Sequence LIIINCPYKTRPIAARLFLTINKKIKMKTIKIFIIIFLLSVTAVKAQFTKAELQVSGLTCALCAKSTEKSLRTLPFISDIKTDLIRNVFILTFKNDVPVNFEQISKKVQGSGFSVNSLKATFNFDNTKIADNRFSYGGDTYKLLNAADKTLSGNVSLTIVDNGFAPKSVSKKYLGQVTDTAPASGRIYHLAI

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
143 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
144 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
145 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
146 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
147 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
148 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
153 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.19
Metatranscriptomes 1.85
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 0
Rhizoplane 0.37
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018607 3300001979 Bacteria 2458
2 JGI24739J22299_10036423 3300001989 Bacteria 1662
3 JGI24739J22299_10105861 3300001989 Bacteria 846
4 JGI24739J22299_10214418 3300001989 Unclassified 564
5 JGI24737J22298_10000211 3300001990 Bacteria 19043
6 JGI24743J22301_10015820 3300001991 Bacteria 1402
7 JGI24735J21928_10000011 3300002067 Bacteria 217841
8 JGI24744J21845_10009357 3300002077 Bacteria 2010
9 JGI25162J39368_1000086 3300002737 Bacteria 107401
10 rootH1_10128277 3300003316 Bacteria 3266
11 rootH2_10000579 3300003320 Bacteria 178428
12 rootH2_10156055 3300003320 Bacteria 3466
13 rootH1_10033794 3300003323 Bacteria 2332
14 Ga0055529_1012391 3300003763 Bacteria 1091
15 Ga0058863_11009948 3300004799 Bacteria 2035
16 Ga0065714_10019082 3300005288 Bacteria 1534
17 Ga0065714_10066431 3300005288 Bacteria 6873
18 Ga0065714_10091796 3300005288 Bacteria 1898
19 Ga0065714_10156303 3300005288 Bacteria 1076
20 Ga0070658_10000069 3300005327 Bacteria 101140
21 Ga0070658_10043109 3300005327 Bacteria 3646
22 Ga0070658_10083928 3300005327 Bacteria 2619
23 Ga0070676_10000138 3300005328 Bacteria 28188
24 Ga0068869_100158390 3300005334 Bacteria 1761
25 Ga0070680_100063704 3300005336 Bacteria 3021
26 Ga0068868_100027027 3300005338 Bacteria 4376
27 Ga0070660_100186998 3300005339 Bacteria 1677
28 Ga0070660_101336808 3300005339 Bacteria 608
29 Ga0070671_100726840 3300005355 Bacteria 862
30 Ga0070673_100007603 3300005364 Bacteria 7169
31 Ga0070681_10002600 3300005458 Bacteria 16566
32 Ga0068867_100003760 3300005459 Bacteria 10683
33 Ga0070684_100224742 3300005535 Unclassified 1713
34 Ga0068853_100018241 3300005539 Bacteria 5806
35 Ga0068853_100034736 3300005539 Bacteria 4281
36 Ga0068853_100119832 3300005539 Unclassified 2346
37 Ga0068853_100393034 3300005539 Bacteria 1297
38 Ga0070665_100000017 3300005548 Bacteria 448013
39 Ga0068855_100000141 3300005563 Bacteria 92463
40 Ga0068855_100000489 3300005563 Bacteria 48884
41 Ga0068855_100012432 3300005563 Bacteria 10282
42 Ga0068855_100024915 3300005563 Bacteria 7158
43 Ga0068855_100058452 3300005563 Bacteria 4516
44 Ga0068855_100801779 3300005563 Bacteria 1001
45 Ga0068855_101307080 3300005563 Bacteria 750
46 Ga0068854_100049531 3300005578 Bacteria 3001
47 Ga0068856_100026783 3300005614 Bacteria 5622
48 Ga0068856_100104893 3300005614 Bacteria 2821
49 Ga0068856_100390018 3300005614 Bacteria 1412
50 Ga0068856_100422826 3300005614 Bacteria 1352
51 Ga0068856_101671656 3300005614 Bacteria 649
52 Ga0068852_100002521 3300005616 Bacteria 12616
53 Ga0068852_100508957 3300005616 Bacteria 1200
54 Ga0068866_10295470 3300005718 Bacteria 1009
55 Ga0068870_10227317 3300005840 Bacteria 1145
56 Ga0075366_10000026 3300006195 Bacteria 51752
57 Ga0075366_10000682 3300006195 Bacteria 16076
58 Ga0097621_100004042 3300006237 Bacteria 10175
59 Ga0075370_10231549 3300006353 Bacteria 1093
60 Ga0068871_100001920 3300006358 Bacteria 14064
61 Ga0068865_100000223 3300006881 Bacteria 31553
62 Ga0105240_10007283 3300009093 Bacteria 16106
63 Ga0105240_10021014 3300009093 Bacteria 8687
64 Ga0105240_10064747 3300009093 Bacteria 4541
65 Ga0105240_10200697 3300009093 Bacteria 2337
66 Ga0105240_10373561 3300009093 Bacteria 1611
67 Ga0105240_10410158 3300009093 Bacteria 1524
68 Ga0105240_10558999 3300009093 Bacteria 1265
69 Ga0105240_10585914 3300009093 Bacteria 1230
70 Ga0105240_11107456 3300009093 Bacteria 842
71 Ga0105241_10003752 3300009174 Bacteria 11269
72 Ga0105241_10059718 3300009174 Bacteria 2933
73 Ga0105241_10066239 3300009174 Unclassified 2793
74 Ga0105241_10136616 3300009174 Bacteria 1991
75 Ga0105242_10014530 3300009176 Bacteria 6100
76 Ga0105237_10000782 3300009545 Bacteria 43496
77 Ga0105237_10001513 3300009545 Bacteria 30535
78 Ga0105237_10019875 3300009545 Bacteria 6935
79 Ga0105237_10020293 3300009545 Bacteria 6854
80 Ga0105237_10034771 3300009545 Bacteria 5100
81 Ga0105237_10111105 3300009545 Bacteria 2732
82 Ga0105237_10138522 3300009545 Bacteria 2428
83 Ga0105237_10385459 3300009545 Bacteria 1406
84 Ga0105238_10005009 3300009551 Bacteria 13092
85 Ga0105238_10106396 3300009551 Bacteria 2787
86 Ga0105239_10001541 3300010375 Bacteria 30447
87 Ga0105239_10001835 3300010375 Bacteria 27813
88 Ga0105239_10011111 3300010375 Bacteria 10049
89 Ga0105239_10101425 3300010375 Bacteria 3184
90 Ga0105239_10204786 3300010375 Bacteria 2211
91 Ga0105239_10213232 3300010375 Bacteria 2165
92 Ga0105239_10825054 3300010375 Bacteria 1063
93 Ga0157370_10280585 3300013104 Bacteria 1539
94 Ga0157369_10031646 3300013105 Bacteria 5823
95 Ga0157374_10002377 3300013296 Bacteria 15856
96 Ga0157374_10004748 3300013296 Bacteria 11393
97 Ga0157374_10487183 3300013296 Unclassified 1237
98 Ga0157378_10078042 3300013297 Bacteria 2986
99 Ga0163162_10000071 3300013306 Bacteria 94831
100 Ga0163162_12061106 3300013306 Bacteria 654
101 Ga0157372_10021745 3300013307 Bacteria 6933
102 Ga0157372_10239394 3300013307 Bacteria 2105
103 Ga0157375_10005697 3300013308 Bacteria 10839
104 Ga0157376_10229057 3300014969 Bacteria 1725
105 Ga0157376_11082027 3300014969 Bacteria 827
106 Ga0163161_10021220 3300017792 Bacteria 4566
107 Ga0206350_11095099 3300020080 Bacteria 1461
108 Ga0209437_100144 3300025233 Bacteria 164794
109 Ga0209455_1002982 3300025272 Bacteria 6223
110 Ga0207642_10137956 3300025899 Bacteria 1282
111 Ga0207647_10004699 3300025904 Bacteria 10108
112 Ga0207645_10000956 3300025907 Bacteria 23938
113 Ga0207643_10271409 3300025908 Bacteria 1050
114 Ga0207705_10000032 3300025909 Bacteria 224376
115 Ga0207705_10452171 3300025909 Bacteria 996
116 Ga0207705_10840690 3300025909 Bacteria 712
117 Ga0207654_10006889 3300025911 Bacteria 5721
118 Ga0207654_10103356 3300025911 Bacteria 1759
119 Ga0207707_10020724 3300025912 Bacteria 5742
120 Ga0207695_10020575 3300025913 Bacteria 7554
121 Ga0207695_10101543 3300025913 Bacteria 2870
122 Ga0207695_10176899 3300025913 Bacteria 2056
123 Ga0207695_10365328 3300025913 Bacteria 1329
124 Ga0207671_10001617 3300025914 Bacteria 25642
125 Ga0207671_10003176 3300025914 Bacteria 16589
126 Ga0207671_10044807 3300025914 Bacteria 3271
127 Ga0207671_10081518 3300025914 Bacteria 2427
128 Ga0207671_10250452 3300025914 Bacteria 1392
129 Ga0207671_10274991 3300025914 Bacteria 1327
130 Ga0207660_10023487 3300025917 Bacteria 4165
131 Ga0207657_10051073 3300025919 Bacteria 3595
132 Ga0207649_11041735 3300025920 Bacteria 644
133 Ga0207652_10001318 3300025921 Bacteria 22041
134 Ga0207694_10057536 3300025924 Bacteria 3022
135 Ga0207686_10102926 3300025934 Bacteria 1910
136 Ga0207704_10000138 3300025938 Bacteria 39263
137 Ga0207667_10000030 3300025949 Bacteria 327226
138 Ga0207667_10000408 3300025949 Bacteria 58389
139 Ga0207667_10054795 3300025949 Bacteria 4194
140 Ga0207667_10701756 3300025949 Bacteria 1014
141 Ga0207667_10781020 3300025949 Bacteria 953
142 Ga0207667_10786694 3300025949 Unclassified 949
143 Ga0207651_10007781 3300025960 Bacteria 5731
144 Ga0207640_10043527 3300025981 Bacteria 2870
145 Ga0207677_10100700 3300026023 Bacteria 2125
146 Ga0207639_10011518 3300026041 Bacteria 6143
147 Ga0207639_10029246 3300026041 Bacteria 4032
148 Ga0207639_10136870 3300026041 Bacteria 2035
149 Ga0207639_10335681 3300026041 Bacteria 1346
150 Ga0207639_11523441 3300026041 Bacteria 627
151 Ga0207702_10008393 3300026078 Bacteria 8716
152 Ga0207702_10046459 3300026078 Bacteria 3655
153 Ga0207702_10228224 3300026078 Bacteria 1739
154 Ga0207702_10799109 3300026078 Unclassified 932
155 Ga0207648_10000495 3300026089 Bacteria 43912
156 Ga0207683_10152679 3300026121 Bacteria 2084
157 Ga0207698_10003110 3300026142 Bacteria 9958
158 Ga0268266_10000195 3300028379 Bacteria 105788
159 Ga0307517_10000212 3300028786 Bacteria 99215
160 Ga0307515_10001565 3300028794 Bacteria 51101
161 Ga0307515_10006038 3300028794 Bacteria 24361
162 Ga0307515_10292698 3300028794 Bacteria 1322
163 Ga0265338_10026555 3300028800 Bacteria 5836
164 Ga0307507_10000111 3300033179 Bacteria 134722
165 Ga0307510_10009321 3300033180 Bacteria 11695
166 Ga0373941_0044221 3300035115 Bacteria 1389
167 Ga0395899_0002293 3300037312 Bacteria 15606
168 Ga0395899_0676155 3300037312 Unclassified 650
169 Ga0395900_0001731 3300037418 Bacteria 25191
170 Ga0395900_1181397 3300037418 Bacteria 681
171 Ga0395898_0004986 3300037466 Bacteria 14394
172 Ga0395905_0000987 3300037471 Bacteria 36490
173 Ga0395905_0326835 3300037471 Bacteria 1424
174 Ga0395901_0000822 3300038443 Bacteria 34379
175 Ga0439445_0091195 3300042004 Bacteria 858
176 Ga0439448_0000331 3300042005 Bacteria 10524
177 Ga0466967_1428526 3300045976 Bacteria 689
178 Ga0495629_0167714 3300046459 Bacteria 1525
179 Ga0495638_0059069 3300046460 Bacteria 2376
180 Ga0495638_0180129 3300046460 Bacteria 1206
181 Ga0495651_0028091 3300046462 Bacteria 4385
182 Ga0495650_0000050 3300046471 Bacteria 318894
183 Ga0495605_0101726 3300046474 Bacteria 1320
184 Ga0495584_0482153 3300046491 Unclassified 631
185 Ga0495585_0000198 3300046492 Bacteria 62640
186 Ga0495585_0002275 3300046492 Bacteria 13869
187 Ga0495607_0111942 3300046501 Bacteria 1446
188 Ga0495583_0014766 3300046506 Bacteria 4286
189 Ga0495606_0000213 3300046507 Bacteria 103305
190 Ga0495606_0004695 3300046507 Bacteria 13491
191 Ga0495606_0007936 3300046507 Bacteria 9353
192 Ga0495606_0042024 3300046507 Bacteria 3061
193 Ga0495606_0048892 3300046507 Bacteria 2778
194 Ga0495606_0100576 3300046507 Bacteria 1761
195 Ga0495606_0108693 3300046507 Unclassified 1676
196 Ga0495610_0007660 3300046512 Bacteria 7135
197 Ga0495616_0001462 3300046513 Bacteria 16406
198 Ga0495616_0011068 3300046513 Bacteria 5183
199 Ga0495616_0222570 3300046513 Bacteria 821
200 Ga0495631_0004004 3300046518 Bacteria 7941
201 Ga0495631_0224100 3300046518 Bacteria 802
202 Ga0495632_0226637 3300046519 Bacteria 844
203 Ga0495632_0260936 3300046519 Bacteria 775
204 Ga0495637_0195843 3300046520 Bacteria 744
205 Ga0495644_0143428 3300046523 Bacteria 912
206 Ga0495648_0018887 3300046524 Bacteria 4863
207 Ga0495648_0038135 3300046524 Bacteria 3078
208 Ga0495652_0170873 3300046529 Bacteria 1678
209 Ga0495652_0220410 3300046529 Bacteria 1426
210 Ga0495654_0242767 3300046530 Bacteria 753
211 Ga0495609_0002293 3300046538 Bacteria 11896
212 Ga0495609_0399568 3300046538 Bacteria 550
213 Ga0495633_0000083 3300046558 Bacteria 125035
214 Ga0495633_0010488 3300046558 Bacteria 5052
215 Ga0495668_0000055 3300046616 Bacteria 199412
216 Ga0495668_0053821 3300046616 Bacteria 2225
217 Ga0495611_0129542 3300046648 Bacteria 1177
218 Ga0495625_0000105 3300046660 Bacteria 126078
219 Ga0495625_0001180 3300046660 Bacteria 33548
220 Ga0495625_0008307 3300046660 Bacteria 8873
221 Ga0495625_0102956 3300046660 Bacteria 1958
222 Ga0495625_0147147 3300046660 Bacteria 1585
223 Ga0495625_0194197 3300046660 Bacteria 1343
224 Ga0495625_0251957 3300046660 Bacteria 1146
225 Ga0495661_0001544 3300046665 Bacteria 19037
226 Ga0495661_0004327 3300046665 Bacteria 10280
227 Ga0495658_0079387 3300046683 Bacteria 1923
228 Ga0495670_0612601 3300046691 Bacteria 593
229 Ga0495649_0000011 3300046694 Bacteria 416695
230 Ga0495660_0029909 3300046810 Bacteria 3070
231 Ga0495660_0046317 3300046810 Bacteria 2385
232 Ga0495683_0056166 3300047323 Bacteria 1959
233 Ga0495687_000354 3300047443 Bacteria 58314
234 Ga0495687_002058 3300047443 Bacteria 16916
235 Ga0495687_056398 3300047443 Bacteria 1639
236 Ga0495686_0000306 3300047472 Bacteria 83341
237 Ga0495686_0010892 3300047472 Bacteria 6440
238 Ga0495686_0199206 3300047472 Bacteria 1150
239 Ga0495686_0275913 3300047472 Bacteria 936
240 Ga0495686_0612023 3300047472 Bacteria 563
241 Ga0495602_0355764 3300048088 Bacteria 1056
242 Ga0495614_0005778 3300048089 Bacteria 5570
243 Ga0495678_052352 3300049459 Bacteria 1572
244 Ga0495682_0012210 3300049460 Bacteria 3296
245 nmdc:mga0k408_1109_c1 3300050493 Bacteria 14749
246 nmdc:mga0k408_26_c4 3300050493 Bacteria 51744
247 nmdc:mga07m45_54634_c1 3300050496 Bacteria 2256
248 Ga0500635_0000273 3300053080 Bacteria 19606
249 Ga0500635_0002982 3300053080 Bacteria 4215
250 Ga0500647_0200119 3300053091 Bacteria 906
251 Ga0500608_000819 3300053122 Bacteria 11262
252 Ga0500618_000021 3300053125 Bacteria 160813
253 Ga0500642_0350776 3300053130 Bacteria 655
254 Ga0500564_018974 3300053138 Bacteria 3141
255 Ga0500579_114974 3300053143 Bacteria 1334
256 Ga0500616_0057998 3300053153 Bacteria 2016
257 Ga0500622_0001513 3300053156 Bacteria 18450
258 Ga0500624_000135 3300053157 Bacteria 31636
259 Ga0500634_0239421 3300053161 Bacteria 763
260 Ga0587077_056888 3300059493 Bacteria 836
261 Ga0587083_0061565 3300059505 Bacteria 847
262 Ga0587067_039016 3300059640 Bacteria 914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035115 Ga0373941_0044221 Ga0373941_0044221_615_1166 146
2 3300009093 Ga0105240_10373561 Ga0105240_103735612 150
3 3300047443 Ga0495687_056398 Ga0495687_056398_913_1470 150
4 3300009545 Ga0105237_10111105 Ga0105237_101111054 151
5 3300010375 Ga0105239_10825054 Ga0105239_108250542 151
6 3300025914 Ga0207671_10250452 Ga0207671_102504521 151
7 3300047472 Ga0495686_0275913 Ga0495686_0275913_100_594 152
8 3300006353 Ga0075370_10231549 Ga0075370_102315492 155
9 3300033179 Ga0307507_10000111 Ga0307507_1000011192 155
10 3300046665 Ga0495661_0004327 Ga0495661_0004327_6715_7215 156
11 3300046691 Ga0495670_0612601 Ga0495670_0612601_11_484 157
12 3300003316 rootH1_10128277 rootH1_101282774 158
13 3300005614 Ga0068856_100422826 Ga0068856_1004228263 159
14 3300013296 Ga0157374_10002377 Ga0157374_100023774 159
15 3300026078 Ga0207702_10046459 Ga0207702_100464592 159
16 iso_pu_bacteria 2852623160 2852626189 161
17 iso_pu_bacteria 2884933994 2884935271 161
18 iso_pu_bacteria 2977232053 2977234402 161
19 3300003320 rootH2_10000579 rootH2_10000579159 162
20 3300045976 Ga0466967_1428526 Ga0466967_1428526_72_563 162
21 iso_pu_bacteria 2599185184 2599480488 162
22 iso_pu_bacteria 2919437846 2919439460 162
23 iso_pu_bacteria 2928078545 2928081236 162
24 iso_pu_bacteria 2928147474 2928150587 162
25 iso_pu_bacteria 2932082852 2932085410 162
26 3300001991 JGI24743J22301_10015820 JGI24743J22301_100158202 163
27 3300002077 JGI24744J21845_10009357 JGI24744J21845_100093572 163
28 3300003323 rootH1_10033794 rootH1_100337941 163
29 3300005328 Ga0070676_10000138 Ga0070676_100001385 163
30 3300005334 Ga0068869_100158390 Ga0068869_1001583902 163
31 3300005338 Ga0068868_100027027 Ga0068868_1000270274 163
32 3300005339 Ga0070660_101336808 Ga0070660_1013368081 163
33 3300005355 Ga0070671_100726840 Ga0070671_1007268401 163
34 3300005364 Ga0070673_100007603 Ga0070673_1000076036 163
35 3300005459 Ga0068867_100003760 Ga0068867_1000037603 163
36 3300005539 Ga0068853_100018241 Ga0068853_1000182414 163
37 3300005539 Ga0068853_100119832 Ga0068853_1001198322 163
38 3300005548 Ga0070665_100000017 Ga0070665_100000017331 163
39 3300005563 Ga0068855_100024915 Ga0068855_1000249153 163
40 3300005563 Ga0068855_100058452 Ga0068855_1000584526 163
41 3300005614 Ga0068856_101671656 Ga0068856_1016716561 163
42 3300005616 Ga0068852_100002521 Ga0068852_1000025214 163
43 3300005840 Ga0068870_10227317 Ga0068870_102273171 163
44 3300006237 Ga0097621_100004042 Ga0097621_1000040423 163
45 3300006358 Ga0068871_100001920 Ga0068871_1000019208 163
46 3300006881 Ga0068865_100000223 Ga0068865_1000002236 163
47 3300009093 Ga0105240_10007283 Ga0105240_100072839 163
48 3300009174 Ga0105241_10003752 Ga0105241_100037528 163
49 3300009176 Ga0105242_10014530 Ga0105242_100145303 163
50 3300009545 Ga0105237_10001513 Ga0105237_1000151319 163
51 3300009551 Ga0105238_10005009 Ga0105238_1000500913 163
52 3300010375 Ga0105239_10101425 Ga0105239_101014254 163
53 3300010375 Ga0105239_10204786 Ga0105239_102047863 163
54 3300013296 Ga0157374_10004748 Ga0157374_100047486 163
55 3300013296 Ga0157374_10487183 Ga0157374_104871832 163
56 3300013297 Ga0157378_10078042 Ga0157378_100780422 163
57 3300013306 Ga0163162_10000071 Ga0163162_1000007172 163
58 3300013307 Ga0157372_10021745 Ga0157372_100217454 163
59 3300013308 Ga0157375_10005697 Ga0157375_100056976 163
60 3300014969 Ga0157376_10229057 Ga0157376_102290572 163
61 3300025907 Ga0207645_10000956 Ga0207645_100009563 163
62 3300025908 Ga0207643_10271409 Ga0207643_102714092 163
63 3300025909 Ga0207705_10452171 Ga0207705_104521711 163
64 3300025911 Ga0207654_10006889 Ga0207654_100068896 163
65 3300025913 Ga0207695_10020575 Ga0207695_100205757 163
66 3300025914 Ga0207671_10081518 Ga0207671_100815183 163
67 3300025924 Ga0207694_10057536 Ga0207694_100575362 163
68 3300025934 Ga0207686_10102926 Ga0207686_101029263 163
69 3300025938 Ga0207704_10000138 Ga0207704_1000013823 163
70 3300025949 Ga0207667_10781020 Ga0207667_107810202 163
71 3300025960 Ga0207651_10007781 Ga0207651_100077816 163
72 3300026023 Ga0207677_10100700 Ga0207677_101007002 163
73 3300026041 Ga0207639_10011518 Ga0207639_100115182 163
74 3300026041 Ga0207639_10029246 Ga0207639_100292462 163
75 3300026089 Ga0207648_10000495 Ga0207648_1000049512 163
76 3300026121 Ga0207683_10152679 Ga0207683_101526792 163
77 3300026142 Ga0207698_10003110 Ga0207698_100031108 163
78 3300028379 Ga0268266_10000195 Ga0268266_1000019585 163
79 3300037312 Ga0395899_0002293 Ga0395899_0002293_8421_8915 163
80 3300037312 Ga0395899_0676155 Ga0395899_0676155_84_575 163
81 3300037418 Ga0395900_0001731 Ga0395900_0001731_6826_7320 163
82 3300037466 Ga0395898_0004986 Ga0395898_0004986_1250_1744 163
83 3300037471 Ga0395905_0000987 Ga0395905_0000987_15622_16116 163
84 3300038443 Ga0395901_0000822 Ga0395901_0000822_16697_17191 163
85 3300042005 Ga0439448_0000331 Ga0439448_0000331_352_843 163
86 3300046519 Ga0495632_0260936 Ga0495632_0260936_36_527 163
87 3300047443 Ga0495687_000354 Ga0495687_000354_37145_37639 163
88 3300053080 Ga0500635_0002982 Ga0500635_0002982_1221_1712 163
89 3300004799 Ga0058863_11009948 Ga0058863_110099481 164
90 3300005327 Ga0070658_10043109 Ga0070658_100431092 164
91 3300005336 Ga0070680_100063704 Ga0070680_1000637042 164
92 3300005458 Ga0070681_10002600 Ga0070681_1000260011 164
93 3300005535 Ga0070684_100224742 Ga0070684_1002247423 164
94 3300009093 Ga0105240_10200697 Ga0105240_102006973 164
95 3300009093 Ga0105240_10585914 Ga0105240_105859142 164
96 3300025909 Ga0207705_10840690 Ga0207705_108406902 164
97 3300025912 Ga0207707_10020724 Ga0207707_100207244 164
98 3300025917 Ga0207660_10023487 Ga0207660_100234874 164
99 3300025921 Ga0207652_10001318 Ga0207652_1000131823 164
100 3300042004 Ga0439445_0091195 Ga0439445_0091195_252_746 164
101 3300046523 Ga0495644_0143428 Ga0495644_0143428_88_582 164
102 3300047472 Ga0495686_0199206 Ga0495686_0199206_214_708 164
103 3300050496 nmdc:mga07m45_54634_c1 nmdc:mga07m45_54634_c1_1487_1981 164
104 3300053080 Ga0500635_0000273 Ga0500635_0000273_18559_19053 164
105 3300053156 Ga0500622_0001513 Ga0500622_0001513_12009_12503 164
106 3300001989 JGI24739J22299_10214418 JGI24739J22299_102144181 165
107 3300003763 Ga0055529_1012391 Ga0055529_10123912 165
108 3300005288 Ga0065714_10019082 Ga0065714_100190822 165
109 3300005288 Ga0065714_10156303 Ga0065714_101563032 165
110 3300005327 Ga0070658_10000069 Ga0070658_1000006935 165
111 3300005327 Ga0070658_10083928 Ga0070658_100839283 165
112 3300005339 Ga0070660_100186998 Ga0070660_1001869981 165
113 3300005539 Ga0068853_100034736 Ga0068853_1000347363 165
114 3300005539 Ga0068853_100393034 Ga0068853_1003930342 165
115 3300005563 Ga0068855_100012432 Ga0068855_1000124323 165
116 3300005563 Ga0068855_100801779 Ga0068855_1008017792 165
117 3300005563 Ga0068855_101307080 Ga0068855_1013070801 165
118 3300005614 Ga0068856_100104893 Ga0068856_1001048932 165
119 3300005718 Ga0068866_10295470 Ga0068866_102954702 165
120 3300006195 Ga0075366_10000682 Ga0075366_100006827 165
121 3300009093 Ga0105240_10021014 Ga0105240_100210143 165
122 3300009093 Ga0105240_10064747 Ga0105240_100647472 165
123 3300009093 Ga0105240_10410158 Ga0105240_104101582 165
124 3300009093 Ga0105240_10558999 Ga0105240_105589992 165
125 3300009174 Ga0105241_10059718 Ga0105241_100597183 165
126 3300009174 Ga0105241_10066239 Ga0105241_100662393 165
127 3300009174 Ga0105241_10136616 Ga0105241_101366162 165
128 3300009545 Ga0105237_10000782 Ga0105237_100007826 165
129 3300009545 Ga0105237_10034771 Ga0105237_100347713 165
130 3300009545 Ga0105237_10138522 Ga0105237_101385223 165
131 3300009551 Ga0105238_10106396 Ga0105238_101063962 165
132 3300010375 Ga0105239_10011111 Ga0105239_1001111111 165
133 3300010375 Ga0105239_10213232 Ga0105239_102132323 165
134 3300025272 Ga0209455_1002982 Ga0209455_10029823 165
135 3300025899 Ga0207642_10137956 Ga0207642_101379562 165
136 3300025909 Ga0207705_10000032 Ga0207705_1000003257 165
137 3300025911 Ga0207654_10103356 Ga0207654_101033562 165
138 3300025913 Ga0207695_10176899 Ga0207695_101768992 165
139 3300025913 Ga0207695_10365328 Ga0207695_103653282 165
140 3300025914 Ga0207671_10001617 Ga0207671_1000161720 165
141 3300025914 Ga0207671_10274991 Ga0207671_102749911 165
142 3300025919 Ga0207657_10051073 Ga0207657_100510734 165
143 3300025920 Ga0207649_11041735 Ga0207649_110417351 165
144 3300025949 Ga0207667_10054795 Ga0207667_100547953 165
145 3300025949 Ga0207667_10701756 Ga0207667_107017561 165
146 3300025949 Ga0207667_10786694 Ga0207667_107866942 165
147 3300026041 Ga0207639_10136870 Ga0207639_101368702 165
148 3300026041 Ga0207639_10335681 Ga0207639_103356812 165
149 3300026078 Ga0207702_10799109 Ga0207702_107991092 165
150 3300028786 Ga0307517_10000212 Ga0307517_1000021215 165
151 3300028794 Ga0307515_10292698 Ga0307515_102926981 165
152 3300028800 Ga0265338_10026555 Ga0265338_100265553 165
153 3300033180 Ga0307510_10009321 Ga0307510_1000932110 165
154 3300037418 Ga0395900_1181397 Ga0395900_1181397_34_531 165
155 3300037471 Ga0395905_0326835 Ga0395905_0326835_391_888 165
156 3300046462 Ga0495651_0028091 Ga0495651_0028091_371_874 165
157 3300046474 Ga0495605_0101726 Ga0495605_0101726_181_681 165
158 3300046491 Ga0495584_0482153 Ga0495584_0482153_114_611 165
159 3300046507 Ga0495606_0007936 Ga0495606_0007936_2210_2728 165
160 3300046507 Ga0495606_0100576 Ga0495606_0100576_547_1044 165
161 3300046518 Ga0495631_0004004 Ga0495631_0004004_5931_6428 165
162 3300046529 Ga0495652_0170873 Ga0495652_0170873_675_1178 165
163 3300046660 Ga0495625_0194197 Ga0495625_0194197_327_824 165
164 3300046660 Ga0495625_0251957 Ga0495625_0251957_260_766 165
165 3300047323 Ga0495683_0056166 Ga0495683_0056166_1224_1721 165
166 3300050493 nmdc:mga0k408_1109_c1 nmdc:mga0k408_1109_c1_6876_7409 165
167 3300053122 Ga0500608_000819 Ga0500608_000819_8775_9272 165
168 3300053130 Ga0500642_0350776 Ga0500642_0350776_66_563 165
169 3300059493 Ga0587077_056888 Ga0587077_056888_148_645 165
170 3300059505 Ga0587083_0061565 Ga0587083_0061565_176_673 165
171 3300059640 Ga0587067_039016 Ga0587067_039016_181_678 165
172 3300001979 JGI24740J21852_10018607 JGI24740J21852_100186072 166
173 3300001989 JGI24739J22299_10036423 JGI24739J22299_100364232 166
174 3300001989 JGI24739J22299_10105861 JGI24739J22299_101058612 166
175 3300001990 JGI24737J22298_10000211 JGI24737J22298_100002118 166
176 3300002067 JGI24735J21928_10000011 JGI24735J21928_10000011162 166
177 3300002737 JGI25162J39368_1000086 JGI25162J39368_100008633 166
178 3300003320 rootH2_10156055 rootH2_101560553 166
179 3300005288 Ga0065714_10066431 Ga0065714_100664313 166
180 3300005288 Ga0065714_10091796 Ga0065714_100917963 166
181 3300005563 Ga0068855_100000141 Ga0068855_10000014118 166
182 3300005563 Ga0068855_100000489 Ga0068855_10000048944 166
183 3300005578 Ga0068854_100049531 Ga0068854_1000495312 166
184 3300005614 Ga0068856_100026783 Ga0068856_1000267832 166
185 3300005614 Ga0068856_100390018 Ga0068856_1003900182 166
186 3300005616 Ga0068852_100508957 Ga0068852_1005089572 166
187 3300006195 Ga0075366_10000026 Ga0075366_1000002637 166
188 3300009093 Ga0105240_11107456 Ga0105240_111074561 166
189 3300009545 Ga0105237_10019875 Ga0105237_100198757 166
190 3300009545 Ga0105237_10020293 Ga0105237_100202937 166
191 3300009545 Ga0105237_10385459 Ga0105237_103854593 166
192 3300010375 Ga0105239_10001541 Ga0105239_1000154111 166
193 3300010375 Ga0105239_10001835 Ga0105239_1000183521 166
194 3300013104 Ga0157370_10280585 Ga0157370_102805853 166
195 3300013105 Ga0157369_10031646 Ga0157369_100316463 166
196 3300013306 Ga0163162_12061106 Ga0163162_120611061 166
197 3300013307 Ga0157372_10239394 Ga0157372_102393943 166
198 3300014969 Ga0157376_11082027 Ga0157376_110820272 166
199 3300017792 Ga0163161_10021220 Ga0163161_100212204 166
200 3300020080 Ga0206350_11095099 Ga0206350_110950992 166
201 3300025233 Ga0209437_100144 Ga0209437_10014475 166
202 3300025904 Ga0207647_10004699 Ga0207647_1000469911 166
203 3300025913 Ga0207695_10101543 Ga0207695_101015432 166
204 3300025914 Ga0207671_10003176 Ga0207671_100031769 166
205 3300025914 Ga0207671_10044807 Ga0207671_100448073 166
206 3300025949 Ga0207667_10000030 Ga0207667_1000003041 166
207 3300025949 Ga0207667_10000408 Ga0207667_1000040814 166
208 3300025981 Ga0207640_10043527 Ga0207640_100435275 166
209 3300026041 Ga0207639_11523441 Ga0207639_115234411 166
210 3300026078 Ga0207702_10008393 Ga0207702_100083939 166
211 3300026078 Ga0207702_10228224 Ga0207702_102282243 166
212 3300028794 Ga0307515_10001565 Ga0307515_1000156536 166
213 3300028794 Ga0307515_10006038 Ga0307515_100060384 166
214 3300046459 Ga0495629_0167714 Ga0495629_0167714_337_837 166
215 3300046460 Ga0495638_0059069 Ga0495638_0059069_799_1299 166
216 3300046460 Ga0495638_0180129 Ga0495638_0180129_491_991 166
217 3300046471 Ga0495650_0000050 Ga0495650_0000050_19866_20366 166
218 3300046492 Ga0495585_0000198 Ga0495585_0000198_37865_38365 166
219 3300046492 Ga0495585_0002275 Ga0495585_0002275_5458_5958 166
220 3300046501 Ga0495607_0111942 Ga0495607_0111942_268_768 166
221 3300046506 Ga0495583_0014766 Ga0495583_0014766_1512_2012 166
222 3300046507 Ga0495606_0000213 Ga0495606_0000213_15763_16263 166
223 3300046507 Ga0495606_0004695 Ga0495606_0004695_9140_9640 166
224 3300046507 Ga0495606_0042024 Ga0495606_0042024_1309_1809 166
225 3300046507 Ga0495606_0048892 Ga0495606_0048892_676_1230 166
226 3300046507 Ga0495606_0108693 Ga0495606_0108693_66_566 166
227 3300046512 Ga0495610_0007660 Ga0495610_0007660_2596_3096 166
228 3300046513 Ga0495616_0001462 Ga0495616_0001462_6266_6766 166
229 3300046513 Ga0495616_0011068 Ga0495616_0011068_1456_1956 166
230 3300046513 Ga0495616_0222570 Ga0495616_0222570_28_528 166
231 3300046518 Ga0495631_0224100 Ga0495631_0224100_63_563 166
232 3300046519 Ga0495632_0226637 Ga0495632_0226637_251_751 166
233 3300046520 Ga0495637_0195843 Ga0495637_0195843_178_678 166
234 3300046524 Ga0495648_0018887 Ga0495648_0018887_259_759 166
235 3300046524 Ga0495648_0038135 Ga0495648_0038135_1854_2354 166
236 3300046529 Ga0495652_0220410 Ga0495652_0220410_440_940 166
237 3300046530 Ga0495654_0242767 Ga0495654_0242767_181_681 166
238 3300046538 Ga0495609_0002293 Ga0495609_0002293_4634_5134 166
239 3300046538 Ga0495609_0399568 Ga0495609_0399568_17_517 166
240 3300046558 Ga0495633_0000083 Ga0495633_0000083_32167_32667 166
241 3300046558 Ga0495633_0010488 Ga0495633_0010488_370_870 166
242 3300046616 Ga0495668_0000055 Ga0495668_0000055_120466_120966 166
243 3300046616 Ga0495668_0053821 Ga0495668_0053821_1457_1957 166
244 3300046648 Ga0495611_0129542 Ga0495611_0129542_110_610 166
245 3300046660 Ga0495625_0000105 Ga0495625_0000105_117720_118220 166
246 3300046660 Ga0495625_0001180 Ga0495625_0001180_13213_13713 166
247 3300046660 Ga0495625_0008307 Ga0495625_0008307_5930_6430 166
248 3300046660 Ga0495625_0102956 Ga0495625_0102956_905_1405 166
249 3300046660 Ga0495625_0147147 Ga0495625_0147147_945_1445 166
250 3300046665 Ga0495661_0001544 Ga0495661_0001544_9494_9994 166
251 3300046683 Ga0495658_0079387 Ga0495658_0079387_1051_1551 166
252 3300046694 Ga0495649_0000011 Ga0495649_0000011_7838_8338 166
253 3300046810 Ga0495660_0029909 Ga0495660_0029909_1186_1686 166
254 3300046810 Ga0495660_0046317 Ga0495660_0046317_1680_2180 166
255 3300047443 Ga0495687_002058 Ga0495687_002058_9993_10493 166
256 3300047472 Ga0495686_0000306 Ga0495686_0000306_21353_21907 166
257 3300047472 Ga0495686_0010892 Ga0495686_0010892_1299_1802 166
258 3300047472 Ga0495686_0612023 Ga0495686_0612023_40_540 166
259 3300048088 Ga0495602_0355764 Ga0495602_0355764_318_818 166
260 3300048089 Ga0495614_0005778 Ga0495614_0005778_3649_4149 166
261 3300049459 Ga0495678_052352 Ga0495678_052352_1023_1523 166
262 3300049460 Ga0495682_0012210 Ga0495682_0012210_803_1303 166
263 3300050493 nmdc:mga0k408_26_c4 nmdc:mga0k408_26_c4_33487_33987 166
264 3300053091 Ga0500647_0200119 Ga0500647_0200119_272_772 166
265 3300053125 Ga0500618_000021 Ga0500618_000021_61905_62405 166
266 3300053138 Ga0500564_018974 Ga0500564_018974_1929_2429 166
267 3300053143 Ga0500579_114974 Ga0500579_114974_74_574 166
268 3300053153 Ga0500616_0057998 Ga0500616_0057998_964_1464 166
269 3300053157 Ga0500624_000135 Ga0500624_000135_2464_3042 166
270 3300053161 Ga0500634_0239421 Ga0500634_0239421_216_716 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00403

HMA

Heavy-metal-associated domain

52

114

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2roe-assembly1.cif.gz_A solution structure of thermus thermophilus hb8 ttha1718 protein in vitro 0.901 25 90
6ff2-assembly1.cif.gz_B copz metallochaperone 0.8958 23 89
1fvq-assembly1.cif.gz_A solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states 0.893 23 87
4a4j-assembly1.cif.gz_A crosstalk between cu(i) and zn(ii) homeostasis 0.8919 24 90
4a48-assembly1.cif.gz_A crosstalk between cu(i) and zn(ii) homeostasis 0.8872 24 90
ID Description Score Start End Superfamily
af_Q5JLS9_1_60_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9012 28 87 3.30.70.100
af_Q557B5_356_428_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8987 26 90 3.30.70.100
af_Q59385_102_164_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8987 27 90 3.30.70.100
af_A0A1D6NFU6_1_73_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.898 24 89 3.30.70.100
6ff2B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8958 23 89 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3C1UR53-F1-model_v4 Heavy metal translocating P-type ATPase 0.9556 23 92 GO:0005507
GO:0005524
GO:0012505
GO:0016020
GO:0016887
GO:0043682
GO:0055070
AF-A0A651F001-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9499 23 92 GO:0046872
AF-A0A849DWG8-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9477 23 92 GO:0046872
AF-A0A3D3XDU8-F1-model_v4 Heavy metal translocating P-type ATPase 0.9475 23 87 GO:0005507
GO:0005524
GO:0012505
GO:0016020
GO:0016887
GO:0043682
GO:0055070
AF-A0A3M2BL11-F1-model_v4 Copper chaperone 0.9455 23 94 GO:0046872

Feature Viewer

pLDDT pTM Quality
86.98 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map