F376870

General Info

Members Datasets Scaffolds Average Seq Length
270 168 540 414

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100058565|Ga0075434_1000585652
Length 436
Sequence MPLTPQAYALVGLTAIVAGLVAIVVFAMLRFSAAARETRRNLRSGSGXXTETALLSAALQEAVTKLKAQERATAAXXEASERLSGEIISSLTAGLLVVGLEGEVRILNPAGRRVLDIPESLPPEEIARATRLSPGAGPREQPLLDVIDECLRRRSPIVRHAVELPDTGHGATHLGVTVSPLLDEHGGLHGAICLFTDLTAVRDLEEQLRLKDSLATVGELTAGIAHEFRNGLATIQGYSKLLDLNALPPAYRPYVEGIRSETESLSQVVTNFLNFARPAQLTLTRVELRGICERAADEFRADARALGGDIEVQGDFDVIEGDEVLLRQAFSNLLRNALEACAGGSQPPRIAIHSEIDLPQKVSRIAVNDNGPGIAPALRERIFRPFVTSKRTGTGLGLALVQKIIVFHNGRISAGASPLGGASLQITLPVSGSGSQ

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
97 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
98 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.04
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 9.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100058565 3300006871 Bacteria 3829
2 Ga0065712_10000277 3300005290 Bacteria 15777
3 Ga0065715_10000329 3300005293 Bacteria 15916
4 Ga0065715_10001271 3300005293 Bacteria 7097
5 Ga0070690_100002010 3300005330 Bacteria 10839
6 Ga0070670_100008139 3300005331 Bacteria 8924
7 Ga0070670_100037289 3300005331 Unclassified 4183
8 Ga0070666_10007785 3300005335 Bacteria 6617
9 Ga0068868_100047586 3300005338 Bacteria 3362
10 Ga0068868_100138804 3300005338 Bacteria 1994
11 Ga0070660_100085333 3300005339 Bacteria 2483
12 Ga0070660_100092843 3300005339 Bacteria 2382
13 Ga0070668_100032269 3300005347 Bacteria 3985
14 Ga0070669_100051931 3300005353 Bacteria 2998
15 Ga0070675_100000056 3300005354 Bacteria 66985
16 Ga0070675_100043021 3300005354 Bacteria 3690
17 Ga0070671_100020488 3300005355 Bacteria 5394
18 Ga0070673_100220775 3300005364 Bacteria 1640
19 Ga0070688_100003265 3300005365 Bacteria 8314
20 Ga0070688_100012944 3300005365 Bacteria 4690
21 Ga0070688_100134676 3300005365 Bacteria 1671
22 Ga0070667_100031787 3300005367 Bacteria 4400
23 Ga0070709_10004220 3300005434 Bacteria 7747
24 Ga0070713_100005249 3300005436 Bacteria 8831
25 Ga0070700_100008637 3300005441 Bacteria 5553
26 Ga0070694_100005891 3300005444 Bacteria 7436
27 Ga0070708_100261717 3300005445 Bacteria 1626
28 Ga0070678_100011665 3300005456 Bacteria 5432
29 Ga0070681_10002820 3300005458 Bacteria 16042
30 Ga0070685_10006541 3300005466 Bacteria 5941
31 Ga0070707_100068810 3300005468 Bacteria 3408
32 Ga0070707_100086314 3300005468 Bacteria 3035
33 Ga0070698_100023259 3300005471 Bacteria 6479
34 Ga0070698_100066196 3300005471 Bacteria 3638
35 Ga0070699_100004012 3300005518 Bacteria 13013
36 Ga0070699_100100798 3300005518 Bacteria 2531
37 Ga0070679_100029821 3300005530 Bacteria 5383
38 Ga0070679_100040669 3300005530 Bacteria 4625
39 Ga0070679_100257398 3300005530 Bacteria 1701
40 Ga0070697_100071842 3300005536 Bacteria 2839
41 Ga0070697_100124828 3300005536 Bacteria 2156
42 Ga0070697_100161286 3300005536 Bacteria 1894
43 Ga0070672_100003093 3300005543 Bacteria 10740
44 Ga0070686_100001418 3300005544 Bacteria 13534
45 Ga0070696_100082227 3300005546 Bacteria 2283
46 Ga0070665_100007508 3300005548 Bacteria 11086
47 Ga0070665_100008621 3300005548 Bacteria 10319
48 Ga0068854_100014410 3300005578 Bacteria 5212
49 Ga0068859_100002960 3300005617 Bacteria 17232
50 Ga0068859_100056212 3300005617 Bacteria 3960
51 Ga0068864_100038242 3300005618 Unclassified 4097
52 Ga0068864_100071038 3300005618 Bacteria 3030
53 Ga0068863_100016662 3300005841 Bacteria 7052
54 Ga0068863_100030585 3300005841 Bacteria 5141
55 Ga0068863_100061571 3300005841 Bacteria 3549
56 Ga0068858_100084818 3300005842 Bacteria 2946
57 Ga0068858_100121870 3300005842 Unclassified 2439
58 Ga0068860_100020932 3300005843 Bacteria 6337
59 Ga0068862_100111060 3300005844 Bacteria 2406
60 Ga0081455_10011102 3300005937 Bacteria 9067
61 Ga0081539_10033962 3300005985 Bacteria 3095
62 Ga0097621_100004345 3300006237 Bacteria 9853
63 Ga0097621_100009478 3300006237 Bacteria 7068
64 Ga0097621_100032492 3300006237 Bacteria 4149
65 Ga0097621_100147551 3300006237 Bacteria 2015
66 Ga0097621_100205027 3300006237 Bacteria 1713
67 Ga0068871_100009212 3300006358 Bacteria 7140
68 Ga0068871_100012387 3300006358 Bacteria 6285
69 Ga0068871_100127682 3300006358 Bacteria 2154
70 Ga0068871_100177765 3300006358 Bacteria 1828
71 Ga0075428_100175559 3300006844 Bacteria 2321
72 Ga0075433_10051046 3300006852 Bacteria 3601
73 Ga0075433_10087379 3300006852 Bacteria 2753
74 Ga0075433_10128922 3300006852 Bacteria 2247
75 Ga0075433_10236698 3300006852 Unclassified 1621
76 Ga0075434_100008158 3300006871 Bacteria 9714
77 Ga0075434_100013037 3300006871 Bacteria 7893
78 Ga0075434_100285713 3300006871 Bacteria 1669
79 Ga0068865_100052840 3300006881 Bacteria 2817
80 Ga0075436_100000389 3300006914 Bacteria 28152
81 Ga0075436_100023521 3300006914 Bacteria 4232
82 Ga0075436_100098574 3300006914 Bacteria 2034
83 Ga0075436_100130759 3300006914 Bacteria 1760
84 Ga0075436_100186842 3300006914 Bacteria 1466
85 Ga0075436_100207292 3300006914 Bacteria 1389
86 Ga0097620_100002960 3300006931 Bacteria 17232
87 Ga0097620_100056210 3300006931 Bacteria 3960
88 Ga0075435_100000502 3300007076 Bacteria 23850
89 Ga0075435_100005660 3300007076 Bacteria 8759
90 Ga0075435_100035761 3300007076 Bacteria 3943
91 Ga0075435_100051153 3300007076 Bacteria 3327
92 Ga0075435_100175206 3300007076 Bacteria 1811
93 Ga0105240_10005359 3300009093 Bacteria 19137
94 Ga0105240_10150795 3300009093 Bacteria 2769
95 Ga0105245_10005435 3300009098 Bacteria 11192
96 Ga0105247_10009699 3300009101 Bacteria 5839
97 Ga0105247_10052085 3300009101 Bacteria 2523
98 Ga0114129_10003944 3300009147 Bacteria 20965
99 Ga0114129_10004539 3300009147 Bacteria 19600
100 Ga0114129_10006925 3300009147 Bacteria 16126
101 Ga0114129_10027260 3300009147 Bacteria 8088
102 Ga0114129_10054276 3300009147 Bacteria 5618
103 Ga0105241_10171379 3300009174 Bacteria 1793
104 Ga0105242_10156929 3300009176 Bacteria 1989
105 Ga0105248_10001908 3300009177 Bacteria 23128
106 Ga0105248_10018442 3300009177 Bacteria 7711
107 Ga0105248_10064504 3300009177 Bacteria 4112
108 Ga0157378_10006671 3300013297 Bacteria 10085
109 Ga0157375_10032213 3300013308 Bacteria 4969
110 Ga0157375_10129478 3300013308 Bacteria 2642
111 Ga0163163_10004349 3300014325 Bacteria 12062
112 Ga0163163_10018857 3300014325 Bacteria 6471
113 Ga0157380_10121915 3300014326 Bacteria 2210
114 Ga0157379_10015511 3300014968 Bacteria 6686
115 Ga0157379_10017223 3300014968 Bacteria 6365
116 Ga0157379_10070611 3300014968 Bacteria 3124
117 Ga0157379_10107853 3300014968 Bacteria 2500
118 Ga0157379_10141042 3300014968 Bacteria 2172
119 Ga0157376_10102494 3300014969 Bacteria 2503
120 Ga0157376_10294254 3300014969 Bacteria 1534
121 Ga0207710_10006076 3300025900 Bacteria 5174
122 Ga0207680_10002829 3300025903 Bacteria 8132
123 Ga0207707_10040855 3300025912 Bacteria 4050
124 Ga0207695_10113989 3300025913 Bacteria 2679
125 Ga0207662_10006771 3300025918 Bacteria 6200
126 Ga0207657_10004102 3300025919 Bacteria 15471
127 Ga0207652_10057224 3300025921 Bacteria 3357
128 Ga0207652_10069400 3300025921 Bacteria 3060
129 Ga0207681_10024463 3300025923 Bacteria 3877
130 Ga0207681_10036275 3300025923 Bacteria 3252
131 Ga0207650_10035547 3300025925 Bacteria 3619
132 Ga0207650_10080000 3300025925 Bacteria 2477
133 Ga0207659_10000255 3300025926 Bacteria 32640
134 Ga0207659_10058538 3300025926 Bacteria 2766
135 Ga0207700_10005735 3300025928 Bacteria 7457
136 Ga0207644_10052947 3300025931 Bacteria 2919
137 Ga0207706_10077951 3300025933 Bacteria 2914
138 Ga0207686_10003520 3300025934 Bacteria 8406
139 Ga0207691_10070586 3300025940 Bacteria 3153
140 Ga0207691_10252600 3300025940 Bacteria 1522
141 Ga0207711_10013566 3300025941 Bacteria 6767
142 Ga0207711_10136650 3300025941 Bacteria 2202
143 Ga0207711_10183400 3300025941 Bacteria 1904
144 Ga0207661_10149330 3300025944 Bacteria 2019
145 Ga0207651_10060669 3300025960 Unclassified 2627
146 Ga0207651_10176937 3300025960 Bacteria 1688
147 Ga0207640_10030335 3300025981 Bacteria 3329
148 Ga0207640_10164119 3300025981 Unclassified 1647
149 Ga0207658_10104909 3300025986 Bacteria 2222
150 Ga0207658_10120037 3300025986 Bacteria 2094
151 Ga0207677_10087226 3300026023 Bacteria 2258
152 Ga0207703_10197632 3300026035 Bacteria 1785
153 Ga0207703_10239868 3300026035 Bacteria 1629
154 Ga0207708_10023604 3300026075 Bacteria 4650
155 Ga0207641_10009034 3300026088 Bacteria 8233
156 Ga0207641_10023333 3300026088 Bacteria 5098
157 Ga0207648_10041190 3300026089 Bacteria 4057
158 Ga0207648_10139350 3300026089 Bacteria 2138
159 Ga0207676_10049425 3300026095 Unclassified 3272
160 Ga0207675_100126490 3300026118 Bacteria 2421
161 Ga0207675_100308137 3300026118 Bacteria 1543
162 Ga0207683_10020163 3300026121 Bacteria 5699
163 Ga0207428_10148646 3300027907 Bacteria 1784
164 Ga0268266_10015227 3300028379 Bacteria 6604
165 Ga0268265_10104734 3300028380 Bacteria 2294
166 Ga0268265_10231473 3300028380 Unclassified 1624
167 Ga0268264_10099010 3300028381 Bacteria 2530
168 Ga0265332_10046623 3300031238 Unclassified 1866
169 Ga0373930_0005283 3300034816 Unclassified 2142
170 Ga0373938_0001687 3300034957 Unclassified 3536
171 Ga0373929_0002472 3300035085 Unclassified 3399
172 Ga0373944_0054346 3300035089 Unclassified 1269
173 Ga0373949_0006636 3300035090 Unclassified 2544
174 Ga0373951_0000106 3300035091 Bacteria 32539
175 Ga0373952_0004700 3300035092 Bacteria 2482
176 Ga0373932_0000530 3300035112 Bacteria 11706
177 Ga0373941_0017822 3300035115 Unclassified 1952
178 Ga0373953_0018784 3300035117 Unclassified 2563
179 Ga0373960_0001051 3300035121 Bacteria 5961
180 Ga0373943_0003986 3300035170 Bacteria 6720
181 Ga0373955_0022498 3300035172 Bacteria 3199
182 Ga0373942_0000867 3300035207 Bacteria 8282
183 Ga0373961_0002021 3300035241 Bacteria 5430
184 Ga0373962_0000938 3300035242 Bacteria 6713
185 Ga0373924_0002366 3300035410 Bacteria 6342
186 Ga0373924_0110077 3300035410 Bacteria 1190
187 Ga0373947_0094329 3300035725 Unclassified 1871
188 Ga0373937_0086889 3300036401 Bacteria 2894
189 Ga0373925_0011580 3300037068 Bacteria 6379
190 Ga0436365_0885879 3300039437 Bacteria 1795
191 Ga0451576_0014484 3300045051 Bacteria 8773
192 Ga0495608_0069676 3300046511 Bacteria 2297
193 Ga0495645_0005414 3300046543 Bacteria 8756
194 Ga0495645_0029679 3300046543 Bacteria 3978
195 Ga0495635_0040200 3300046663 Bacteria 3232
196 Ga0495658_0051058 3300046683 Bacteria 2342
197 Ga0495658_0143916 3300046683 Bacteria 1460
198 Ga0495613_0005334 3300046689 Bacteria 9655
199 Ga0495600_0130454 3300046809 Bacteria 1634
200 Ga0495604_0016960 3300047317 Bacteria 5825
201 Ga0495674_0018879 3300047319 Bacteria 6413
202 Ga0495674_0059450 3300047319 Bacteria 3338
203 Ga0495675_0050163 3300047444 Bacteria 2653
204 Ga0495684_0000078 3300047471 Bacteria 66716
205 Ga0496100_0003637 3300048903 Bacteria 8058
206 Ga0496101_0001289 3300048904 Bacteria 14971
207 Ga0496102_0072602 3300048905 Bacteria 3163
208 Ga0496102_0236467 3300048905 Unclassified 1723
209 Ga0496104_0011771 3300048907 Bacteria 7848
210 Ga0496104_0206562 3300048907 Bacteria 1876
211 Ga0496104_0264740 3300048907 Bacteria 1632
212 Ga0496105_0066465 3300048908 Bacteria 2977
213 Ga0496105_0134427 3300048908 Bacteria 2038
214 Ga0496106_0064242 3300048909 Bacteria 2792
215 Ga0496107_0159676 3300048910 Bacteria 1670
216 Ga0496108_0014339 3300048911 Bacteria 6470
217 Ga0496109_0061962 3300048912 Bacteria 3420
218 Ga0496110_0182339 3300048913 Bacteria 1906
219 Ga0496112_0004347 3300048915 Bacteria 11981
220 Ga0496112_0104346 3300048915 Bacteria 2805
221 Ga0496113_0003951 3300048916 Bacteria 8999
222 Ga0496114_0011700 3300048917 Bacteria 7016
223 Ga0496114_0328964 3300048917 Bacteria 1351
224 Ga0501033_0034818 3300049570 Bacteria 3775
225 Ga0501036_0004187 3300049572 Bacteria 11621
226 Ga0501037_0182034 3300049573 Unclassified 1491
227 Ga0501040_0023382 3300049576 Unclassified 4144
228 Ga0501041_0005413 3300049577 Bacteria 7476
229 Ga0501046_0038809 3300049580 Bacteria 3819
230 Ga0501048_0016474 3300049582 Bacteria 5449
231 Ga0501068_0017744 3300049584 Bacteria 4119
232 Ga0501072_0052999 3300049588 Bacteria 3194
233 Ga0501075_0000611 3300049591 Bacteria 21846
234 Ga0501076_0003167 3300049592 Bacteria 11473
235 Ga0501077_0007922 3300049593 Bacteria 6564
236 Ga0501079_0005600 3300049741 Bacteria 9372
237 Ga0501080_0282755 3300049742 Unclassified 1508
238 Ga0501083_0027694 3300049744 Bacteria 3909
239 nmdc:mga05p37_10278_c1 3300050507 Bacteria 11113
240 nmdc:mga05p37_41988_c1 3300050507 Bacteria 5618
241 nmdc:mga05p37_423579_c1 3300050507 Bacteria 1548
242 nmdc:mga05p37_68832_c1 3300050507 Bacteria 4353
243 nmdc:mga09592_84560_c1 3300050508 Bacteria 2705
244 nmdc:mga06r32_65624_c1 3300050510 Bacteria 3501
245 nmdc:mga08y16_123512_c1 3300050511 Bacteria 2694
246 nmdc:mga08y16_123730_c1 3300050511 Bacteria 2691
247 nmdc:mga0n895_149153_c1 3300050512 Bacteria 2368
248 nmdc:mga0n895_21565_c1 3300050512 Bacteria 6028
249 nmdc:mga0n895_323431_c1 3300050512 Bacteria 1563
250 nmdc:mga0n895_93438_c1 3300050512 Bacteria 3012
251 nmdc:mga0n895_978_c1 3300050512 Bacteria 20699
252 nmdc:mga0rr50_11599_c1 3300050513 Bacteria 5652
253 nmdc:mga0rr50_122420_c1 3300050513 Bacteria 2073
254 nmdc:mga0rr50_176701_c1 3300050513 Unclassified 1743
255 nmdc:mga0rr50_193641_c1 3300050513 Bacteria 1667
256 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
257 nmdc:mga0rr50_558_c1 3300050513 Bacteria 19971
258 nmdc:mga0rr50_86435_c1 3300050513 Bacteria 2432
259 nmdc:mga08x19_132999_c1 3300050514 Unclassified 1675
260 nmdc:mga08x19_137393_c1 3300050514 Unclassified 1649
261 nmdc:mga08x19_17033_c1 3300050514 Unclassified 4442
262 nmdc:mga08x19_528_c1 3300050514 Bacteria 25443
263 nmdc:mga0a205_179817_c2 3300050515 Bacteria 1117
264 nmdc:mga0a205_39227_c1 3300050515 Bacteria 4558
265 nmdc:mga0a205_66675_c1 3300050515 Bacteria 3478
266 Ga0495601_0018897 3300053077 Bacteria 4199
267 Ga0495619_0025156 3300053085 Bacteria 3821
268 Ga0501084_0009792 3300054114 Bacteria 7922
269 Ga0501082_0011145 3300060353 Bacteria 7728
270 Ga0530510_0001640 3300061734 Bacteria 15129
271 Ga0075434_100058565
272 Ga0065712_10000277
273 Ga0065715_10000329
274 Ga0065715_10001271
275 Ga0070690_100002010
276 Ga0070670_100008139
277 Ga0070670_100037289
278 Ga0070666_10007785
279 Ga0068868_100047586
280 Ga0068868_100138804
281 Ga0070660_100085333
282 Ga0070660_100092843
283 Ga0070668_100032269
284 Ga0070669_100051931
285 Ga0070675_100000056
286 Ga0070675_100043021
287 Ga0070671_100020488
288 Ga0070673_100220775
289 Ga0070688_100003265
290 Ga0070688_100012944
291 Ga0070688_100134676
292 Ga0070667_100031787
293 Ga0070709_10004220
294 Ga0070713_100005249
295 Ga0070700_100008637
296 Ga0070694_100005891
297 Ga0070708_100261717
298 Ga0070678_100011665
299 Ga0070681_10002820
300 Ga0070685_10006541
301 Ga0070707_100068810
302 Ga0070707_100086314
303 Ga0070698_100023259
304 Ga0070698_100066196
305 Ga0070699_100004012
306 Ga0070699_100100798
307 Ga0070679_100029821
308 Ga0070679_100040669
309 Ga0070679_100257398
310 Ga0070697_100071842
311 Ga0070697_100124828
312 Ga0070697_100161286
313 Ga0070672_100003093
314 Ga0070686_100001418
315 Ga0070696_100082227
316 Ga0070665_100007508
317 Ga0070665_100008621
318 Ga0068854_100014410
319 Ga0068859_100002960
320 Ga0068859_100056212
321 Ga0068864_100038242
322 Ga0068864_100071038
323 Ga0068863_100016662
324 Ga0068863_100030585
325 Ga0068863_100061571
326 Ga0068858_100084818
327 Ga0068858_100121870
328 Ga0068860_100020932
329 Ga0068862_100111060
330 Ga0081455_10011102
331 Ga0081539_10033962
332 Ga0097621_100004345
333 Ga0097621_100009478
334 Ga0097621_100032492
335 Ga0097621_100147551
336 Ga0097621_100205027
337 Ga0068871_100009212
338 Ga0068871_100012387
339 Ga0068871_100127682
340 Ga0068871_100177765
341 Ga0075428_100175559
342 Ga0075433_10051046
343 Ga0075433_10087379
344 Ga0075433_10128922
345 Ga0075433_10236698
346 Ga0075434_100008158
347 Ga0075434_100013037
348 Ga0075434_100285713
349 Ga0068865_100052840
350 Ga0075436_100000389
351 Ga0075436_100023521
352 Ga0075436_100098574
353 Ga0075436_100130759
354 Ga0075436_100186842
355 Ga0075436_100207292
356 Ga0097620_100002960
357 Ga0097620_100056210
358 Ga0075435_100000502
359 Ga0075435_100005660
360 Ga0075435_100035761
361 Ga0075435_100051153
362 Ga0075435_100175206
363 Ga0105240_10005359
364 Ga0105240_10150795
365 Ga0105245_10005435
366 Ga0105247_10009699
367 Ga0105247_10052085
368 Ga0114129_10003944
369 Ga0114129_10004539
370 Ga0114129_10006925
371 Ga0114129_10027260
372 Ga0114129_10054276
373 Ga0105241_10171379
374 Ga0105242_10156929
375 Ga0105248_10001908
376 Ga0105248_10018442
377 Ga0105248_10064504
378 Ga0157378_10006671
379 Ga0157375_10032213
380 Ga0157375_10129478
381 Ga0163163_10004349
382 Ga0163163_10018857
383 Ga0157380_10121915
384 Ga0157379_10015511
385 Ga0157379_10017223
386 Ga0157379_10070611
387 Ga0157379_10107853
388 Ga0157379_10141042
389 Ga0157376_10102494
390 Ga0157376_10294254
391 Ga0207710_10006076
392 Ga0207680_10002829
393 Ga0207707_10040855
394 Ga0207695_10113989
395 Ga0207662_10006771
396 Ga0207657_10004102
397 Ga0207652_10057224
398 Ga0207652_10069400
399 Ga0207681_10024463
400 Ga0207681_10036275
401 Ga0207650_10035547
402 Ga0207650_10080000
403 Ga0207659_10000255
404 Ga0207659_10058538
405 Ga0207700_10005735
406 Ga0207644_10052947
407 Ga0207706_10077951
408 Ga0207686_10003520
409 Ga0207691_10070586
410 Ga0207691_10252600
411 Ga0207711_10013566
412 Ga0207711_10136650
413 Ga0207711_10183400
414 Ga0207661_10149330
415 Ga0207651_10060669
416 Ga0207651_10176937
417 Ga0207640_10030335
418 Ga0207640_10164119
419 Ga0207658_10104909
420 Ga0207658_10120037
421 Ga0207677_10087226
422 Ga0207703_10197632
423 Ga0207703_10239868
424 Ga0207708_10023604
425 Ga0207641_10009034
426 Ga0207641_10023333
427 Ga0207648_10041190
428 Ga0207648_10139350
429 Ga0207676_10049425
430 Ga0207675_100126490
431 Ga0207675_100308137
432 Ga0207683_10020163
433 Ga0207428_10148646
434 Ga0268266_10015227
435 Ga0268265_10104734
436 Ga0268265_10231473
437 Ga0268264_10099010
438 Ga0265332_10046623
439 Ga0373930_0005283
440 Ga0373938_0001687
441 Ga0373929_0002472
442 Ga0373944_0054346
443 Ga0373949_0006636
444 Ga0373951_0000106
445 Ga0373952_0004700
446 Ga0373932_0000530
447 Ga0373941_0017822
448 Ga0373953_0018784
449 Ga0373960_0001051
450 Ga0373943_0003986
451 Ga0373955_0022498
452 Ga0373942_0000867
453 Ga0373961_0002021
454 Ga0373962_0000938
455 Ga0373924_0002366
456 Ga0373924_0110077
457 Ga0373947_0094329
458 Ga0373937_0086889
459 Ga0373925_0011580
460 Ga0436365_0885879
461 Ga0451576_0014484
462 Ga0495608_0069676
463 Ga0495645_0005414
464 Ga0495645_0029679
465 Ga0495635_0040200
466 Ga0495658_0051058
467 Ga0495658_0143916
468 Ga0495613_0005334
469 Ga0495600_0130454
470 Ga0495604_0016960
471 Ga0495674_0018879
472 Ga0495674_0059450
473 Ga0495675_0050163
474 Ga0495684_0000078
475 Ga0496100_0003637
476 Ga0496101_0001289
477 Ga0496102_0072602
478 Ga0496102_0236467
479 Ga0496104_0011771
480 Ga0496104_0206562
481 Ga0496104_0264740
482 Ga0496105_0066465
483 Ga0496105_0134427
484 Ga0496106_0064242
485 Ga0496107_0159676
486 Ga0496108_0014339
487 Ga0496109_0061962
488 Ga0496110_0182339
489 Ga0496112_0004347
490 Ga0496112_0104346
491 Ga0496113_0003951
492 Ga0496114_0011700
493 Ga0496114_0328964
494 Ga0501033_0034818
495 Ga0501036_0004187
496 Ga0501037_0182034
497 Ga0501040_0023382
498 Ga0501041_0005413
499 Ga0501046_0038809
500 Ga0501048_0016474
501 Ga0501068_0017744
502 Ga0501072_0052999
503 Ga0501075_0000611
504 Ga0501076_0003167
505 Ga0501077_0007922
506 Ga0501079_0005600
507 Ga0501080_0282755
508 Ga0501083_0027694
509 nmdc:mga05p37_10278_c1
510 nmdc:mga05p37_41988_c1
511 nmdc:mga05p37_423579_c1
512 nmdc:mga05p37_68832_c1
513 nmdc:mga09592_84560_c1
514 nmdc:mga06r32_65624_c1
515 nmdc:mga08y16_123512_c1
516 nmdc:mga08y16_123730_c1
517 nmdc:mga0n895_149153_c1
518 nmdc:mga0n895_21565_c1
519 nmdc:mga0n895_323431_c1
520 nmdc:mga0n895_93438_c1
521 nmdc:mga0n895_978_c1
522 nmdc:mga0rr50_11599_c1
523 nmdc:mga0rr50_122420_c1
524 nmdc:mga0rr50_176701_c1
525 nmdc:mga0rr50_193641_c1
526 nmdc:mga0rr50_45_c1
527 nmdc:mga0rr50_558_c1
528 nmdc:mga0rr50_86435_c1
529 nmdc:mga08x19_132999_c1
530 nmdc:mga08x19_137393_c1
531 nmdc:mga08x19_17033_c1
532 nmdc:mga08x19_528_c1
533 nmdc:mga0a205_179817_c2
534 nmdc:mga0a205_39227_c1
535 nmdc:mga0a205_66675_c1
536 Ga0495601_0018897
537 Ga0495619_0025156
538 Ga0501084_0009792
539 Ga0501082_0011145
540 Ga0530510_0001640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

216

280

0.93

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

321

432

0.87

PF08448

PAS_4

PAS fold

88

203

0.81

Map