F376846

General Info

Members Datasets Scaffolds Average Seq Length
270 163 270 379

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10000001|Ga0075368_100000018
Length 441
Sequence MVSPDPLTRRDQTFEPRSQKLWPLAALPLTVWRNHTPAWPSLARFPRRKLLGASLSRGILLDVMKIGLICPYNIALGGGVKEHILAVQAELLARGHEVYIITPQPRDMDSPETKYKNLIFVGTSTDFNSPLHTTVQVSAGLNDDIDRMLEEHQFDILHFHEPWIPMLSRQILMRSRSINVATFHAKLPETVMSRTLAKVVTPYTKSVLKYIHHYTAVSEAAADYISKLTDEPITIVPNGIDLTYYKAPSAHHDQRRHKTIFYVGRLENRKGVRHLLEAYQLLTAENKNVSLVIAGNGPDRAKLEAMVENLELPNVQFLGYISEDEKLRYLKRADLFCSPALFGESFGIVLLEAMATGLVTVAGDNPGYAAVMKGLGALSLVNPKHHAEFARRLHVLLYEADLRKLWRSWASEQIVQYGYPTIVTQYESVYKKALAAHNRLS

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
58 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
59 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
140 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
149 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
150 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
151 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
157 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
158 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
159 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
162 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.7
Nodule 0
Rhizoplane 0.37
Rhizosphere 74.44
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000876 3300001915 Bacteria 9070
2 JGI24737J22298_10000231 3300001990 Bacteria 18454
3 JGI24735J21928_10000058 3300002067 Bacteria 46343
4 JGI24742J22300_10000008 3300002244 Bacteria 35034
5 rootH2_10139540 3300003320 Bacteria 4182
6 rootL2_10372064 3300003322 Bacteria 2235
7 Ga0070658_10000012 3300005327 Bacteria 277871
8 Ga0070658_10000133 3300005327 Bacteria 65613
9 Ga0070658_10000783 3300005327 Bacteria 27328
10 Ga0070658_10001615 3300005327 Bacteria 19070
11 Ga0070658_10003509 3300005327 Bacteria 12887
12 Ga0070658_10020147 3300005327 Bacteria 5343
13 Ga0070658_10028630 3300005327 Bacteria 4474
14 Ga0070658_10050740 3300005327 Unclassified 3363
15 Ga0070676_10000213 3300005328 Bacteria 24788
16 Ga0070683_100000077 3300005329 Bacteria 67473
17 Ga0070683_100075610 3300005329 Bacteria 3147
18 Ga0070670_100235914 3300005331 Unclassified 1592
19 Ga0070666_10030210 3300005335 Bacteria 3568
20 Ga0070680_100000260 3300005336 Bacteria 34804
21 Ga0070682_100002786 3300005337 Bacteria 9677
22 Ga0070682_100003061 3300005337 Bacteria 9262
23 Ga0070660_100000466 3300005339 Bacteria 26957
24 Ga0070660_100002164 3300005339 Bacteria 13537
25 Ga0070660_100082631 3300005339 Bacteria 2522
26 Ga0070691_10005820 3300005341 Bacteria 5628
27 Ga0070671_100000001 3300005355 Bacteria 1228151
28 Ga0070674_100003596 3300005356 Bacteria 8720
29 Ga0070674_100043324 3300005356 Unclassified 3061
30 Ga0070673_100002589 3300005364 Bacteria 11045
31 Ga0070659_100000897 3300005366 Bacteria 21799
32 Ga0070667_100000001 3300005367 Bacteria 1108638
33 Ga0070667_100007902 3300005367 Bacteria 8824
34 Ga0070678_100000678 3300005456 Bacteria 16767
35 Ga0070681_10023802 3300005458 Bacteria 6165
36 Ga0070681_10164838 3300005458 Unclassified 2139
37 Ga0070681_10314137 3300005458 Bacteria 1476
38 Ga0068867_100179720 3300005459 Unclassified 1681
39 Ga0070685_10003760 3300005466 Bacteria 7676
40 Ga0070679_100000670 3300005530 Bacteria 29193
41 Ga0070679_100034749 3300005530 Bacteria 4998
42 Ga0070679_100125312 3300005530 Bacteria 2551
43 Ga0070684_100000448 3300005535 Bacteria 28197
44 Ga0070684_100027870 3300005535 Bacteria 4772
45 Ga0070686_100121281 3300005544 Bacteria 1795
46 Ga0070665_100041896 3300005548 Bacteria 4603
47 Ga0070665_100076650 3300005548 Unclassified 3350
48 Ga0070665_100100122 3300005548 Bacteria 2902
49 Ga0068855_100000003 3300005563 Bacteria 589862
50 Ga0068855_100000168 3300005563 Bacteria 83242
51 Ga0068855_100152657 3300005563 Unclassified 2625
52 Ga0068857_100000007 3300005577 Bacteria 152197
53 Ga0068857_100165847 3300005577 Bacteria 2006
54 Ga0068856_100000001 3300005614 Bacteria 565602
55 Ga0068856_100004109 3300005614 Bacteria 14544
56 Ga0068856_100031955 3300005614 Bacteria 5151
57 Ga0068859_100252177 3300005617 Bacteria 1855
58 Ga0068863_100022895 3300005841 Bacteria 5971
59 Ga0068860_100019850 3300005843 Bacteria 6518
60 Ga0068860_100083924 3300005843 Bacteria 3030
61 Ga0068862_100105717 3300005844 Bacteria 2467
62 Ga0081455_10000003 3300005937 Bacteria 367763
63 Ga0081539_10004849 3300005985 Bacteria 14387
64 Ga0075365_10000023 3300006038 Bacteria 64393
65 Ga0075365_10000288 3300006038 Bacteria 17430
66 Ga0075368_10000001 3300006042 Bacteria 62048
67 Ga0075363_100000433 3300006048 Bacteria 13049
68 Ga0075364_10006060 3300006051 Bacteria 7078
69 Ga0075364_10016553 3300006051 Bacteria 4588
70 Ga0075364_10071583 3300006051 Unclassified 2284
71 Ga0075367_10000944 3300006178 Bacteria 11821
72 Ga0075367_10025542 3300006178 Unclassified 3342
73 Ga0075369_10000003 3300006186 Bacteria 205269
74 Ga0075369_10000020 3300006186 Bacteria 45510
75 Ga0075366_10000001 3300006195 Bacteria 569172
76 Ga0075366_10000005 3300006195 Bacteria 107438
77 Ga0075366_10000136 3300006195 Bacteria 30742
78 Ga0075370_10004696 3300006353 Bacteria 6669
79 Ga0097620_100252174 3300006931 Bacteria 1855
80 Ga0105240_10000003 3300009093 Bacteria 1183681
81 Ga0105240_10004772 3300009093 Bacteria 20459
82 Ga0105245_10000001 3300009098 Bacteria 939270
83 Ga0105245_10000050 3300009098 Bacteria 128014
84 Ga0105245_10253458 3300009098 Bacteria 1711
85 Ga0105247_10090627 3300009101 Bacteria 1940
86 Ga0105243_10000001 3300009148 Bacteria 1156578
87 Ga0105241_10000007 3300009174 Bacteria 343524
88 Ga0105241_10190932 3300009174 Unclassified 1705
89 Ga0105242_10000011 3300009176 Bacteria 149791
90 Ga0105242_10001716 3300009176 Bacteria 17301
91 Ga0105248_10332630 3300009177 Bacteria 1711
92 Ga0105237_10007779 3300009545 Bacteria 11686
93 Ga0105238_10385621 3300009551 Bacteria 1393
94 Ga0105249_10008588 3300009553 Bacteria 8905
95 Ga0105032_100884 3300009979 Bacteria 2829
96 Ga0105033_100062 3300009986 Bacteria 8248
97 Ga0105033_101572 3300009986 Unclassified 1872
98 Ga0105028_101909 3300009993 Unclassified 2191
99 Ga0105239_10024217 3300010375 Bacteria 6685
100 Ga0105239_10064945 3300010375 Unclassified 4007
101 Ga0157373_10014150 3300013100 Bacteria 5850
102 Ga0157373_10054231 3300013100 Bacteria 2849
103 Ga0157370_10408751 3300013104 Bacteria 1249
104 Ga0157369_10000072 3300013105 Bacteria 140097
105 Ga0157374_10000064 3300013296 Bacteria 108743
106 Ga0157374_10001234 3300013296 Bacteria 21840
107 Ga0157374_10016980 3300013296 Bacteria 6407
108 Ga0157374_10259693 3300013296 Unclassified 1710
109 Ga0157374_10459837 3300013296 Bacteria 1275
110 Ga0157378_10050671 3300013297 Unclassified 3695
111 Ga0163163_10000670 3300014325 Bacteria 29312
112 Ga0163163_10005134 3300014325 Bacteria 11285
113 Ga0163163_10022928 3300014325 Bacteria 5919
114 Ga0157377_10017112 3300014745 Bacteria 3744
115 Ga0157376_10000007 3300014969 Bacteria 368004
116 Ga0207680_10096171 3300025903 Bacteria 1894
117 Ga0207645_10000706 3300025907 Bacteria 27831
118 Ga0207705_10000011 3300025909 Bacteria 517768
119 Ga0207705_10000038 3300025909 Bacteria 193812
120 Ga0207705_10002991 3300025909 Bacteria 12900
121 Ga0207705_10003842 3300025909 Bacteria 11430
122 Ga0207705_10008837 3300025909 Bacteria 7342
123 Ga0207705_10026318 3300025909 Unclassified 4149
124 Ga0207705_10043402 3300025909 Bacteria 3230
125 Ga0207654_10000002 3300025911 Bacteria 1460142
126 Ga0207707_10113591 3300025912 Bacteria 2367
127 Ga0207707_10123768 3300025912 Bacteria 2261
128 Ga0207707_10127699 3300025912 Bacteria 2223
129 Ga0207695_10000005 3300025913 Bacteria 1196715
130 Ga0207671_10016406 3300025914 Bacteria 5758
131 Ga0207660_10001902 3300025917 Bacteria 13905
132 Ga0207657_10001264 3300025919 Bacteria 26993
133 Ga0207657_10006349 3300025919 Bacteria 12278
134 Ga0207657_10054627 3300025919 Bacteria 3453
135 Ga0207657_10078424 3300025919 Unclassified 2781
136 Ga0207652_10000657 3300025921 Bacteria 34000
137 Ga0207652_10085159 3300025921 Bacteria 2770
138 Ga0207652_10163328 3300025921 Bacteria 1997
139 Ga0207687_10000004 3300025927 Bacteria 841177
140 Ga0207687_10000117 3300025927 Bacteria 56652
141 Ga0207687_10045301 3300025927 Bacteria 3040
142 Ga0207687_10201604 3300025927 Unclassified 1555
143 Ga0207644_10000001 3300025931 Bacteria 1243214
144 Ga0207644_10002500 3300025931 Bacteria 11833
145 Ga0207690_10000795 3300025932 Bacteria 20352
146 Ga0207686_10000001 3300025934 Bacteria 1169580
147 Ga0207686_10005367 3300025934 Bacteria 6872
148 Ga0207709_10000002 3300025935 Bacteria 1171536
149 Ga0207669_10008312 3300025937 Bacteria 4862
150 Ga0207669_10059943 3300025937 Unclassified 2330
151 Ga0207661_10000536 3300025944 Bacteria 24325
152 Ga0207661_10005638 3300025944 Bacteria 8833
153 Ga0207661_10065991 3300025944 Bacteria 2939
154 Ga0207679_10301866 3300025945 Bacteria 1381
155 Ga0207667_10000008 3300025949 Bacteria 625138
156 Ga0207667_10000268 3300025949 Bacteria 72064
157 Ga0207667_10062185 3300025949 Unclassified 3905
158 Ga0207667_10127036 3300025949 Bacteria 2626
159 Ga0207651_10000047 3300025960 Bacteria 56486
160 Ga0207712_10000432 3300025961 Bacteria 35770
161 Ga0207658_10000003 3300025986 Bacteria 1151934
162 Ga0207658_10018274 3300025986 Bacteria 4839
163 Ga0207658_10036015 3300025986 Bacteria 3547
164 Ga0207702_10000001 3300026078 Bacteria 895738
165 Ga0207702_10007476 3300026078 Bacteria 9317
166 Ga0207702_10022717 3300026078 Bacteria 5202
167 Ga0207641_10018625 3300026088 Bacteria 5692
168 Ga0207641_10028200 3300026088 Unclassified 4638
169 Ga0207648_10104589 3300026089 Bacteria 2483
170 Ga0207674_10000001 3300026116 Bacteria 616581
171 Ga0207674_10105888 3300026116 Unclassified 2790
172 Ga0207683_10033837 3300026121 Unclassified 4440
173 Ga0207683_10060159 3300026121 Bacteria 3339
174 Ga0209813_10000006 3300027866 Bacteria 113121
175 Ga0268266_10005702 3300028379 Bacteria 11544
176 Ga0268266_10055059 3300028379 Unclassified 3419
177 Ga0268266_10110957 3300028379 Bacteria 2430
178 Ga0268265_10112684 3300028380 Bacteria 2224
179 Ga0268264_10010018 3300028381 Bacteria 7847
180 Ga0268264_10016920 3300028381 Bacteria 5969
181 Ga0265334_10000144 3300028573 Bacteria 44418
182 Ga0265338_10000419 3300028800 Bacteria 76060
183 Ga0265338_10000451 3300028800 Bacteria 73276
184 Ga0265338_10000771 3300028800 Bacteria 54581
185 Ga0265338_10000841 3300028800 Bacteria 51708
186 Ga0265324_10002196 3300029957 Bacteria 10213
187 Ga0265330_10002589 3300031235 Bacteria 9827
188 Ga0265332_10010486 3300031238 Bacteria 4125
189 Ga0265340_10002576 3300031247 Bacteria 10300
190 Ga0265327_10000017 3300031251 Bacteria 445264
191 Ga0265327_10013569 3300031251 Bacteria 5403
192 Ga0265327_10017394 3300031251 Bacteria 4514
193 Ga0395900_0093917 3300037418 Bacteria 3081
194 Ga0395900_0113093 3300037418 Unclassified 2787
195 Ga0395898_0001404 3300037466 Bacteria 34348
196 Ga0395901_0003763 3300038443 Bacteria 15291
197 Ga0395901_0013675 3300038443 Bacteria 8248
198 Ga0451807_1756152 3300041486 Unclassified 1625
199 Ga0495583_0016402 3300046506 Bacteria 3983
200 Ga0495588_0000124 3300046674 Bacteria 130833
201 Ga0495658_0005538 3300046683 Bacteria 6207
202 Ga0495649_0000403 3300046694 Bacteria 37445
203 Ga0495600_0014571 3300046809 Unclassified 4955
204 Ga0496125_0094332 3300048928 Bacteria 2230
205 Ga0496126_0061401 3300048929 Bacteria 3376
206 Ga0501032_0002352 3300049569 Bacteria 14820
207 Ga0501034_0054208 3300049571 Bacteria 4037
208 Ga0501036_0139838 3300049572 Unclassified 2043
209 Ga0501037_0000113 3300049573 Bacteria 75610
210 Ga0501043_0000205 3300049579 Bacteria 54247
211 Ga0501046_0000038 3300049580 Bacteria 159193
212 Ga0501047_0000355 3300049581 Bacteria 51922
213 Ga0501047_0002715 3300049581 Bacteria 16843
214 Ga0501048_0000379 3300049582 Bacteria 30846
215 Ga0501070_0058091 3300049586 Bacteria 3207
216 Ga0501073_0118244 3300049589 Bacteria 1837
217 Ga0501080_0003543 3300049742 Bacteria 13753
218 Ga0501276_000325 3300049773 Unclassified 2806
219 Ga0501035_0000768 3300049822 Bacteria 34474
220 Ga0501035_0003683 3300049822 Bacteria 14608
221 Ga0501044_0171717 3300049823 Bacteria 2139
222 nmdc:mga03n38_18_c1 3300050490 Bacteria 41421
223 nmdc:mga03n38_19006_c1 3300050490 Bacteria 2721
224 nmdc:mga00v17_5005_c1 3300050491 Bacteria 6957
225 nmdc:mga00v17_61725_c1 3300050491 Unclassified 2304
226 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
227 nmdc:mga0yw44_9_c1 3300050492 Bacteria 178503
228 nmdc:mga0k408_102_c1 3300050493 Bacteria 41013
229 nmdc:mga0k408_16472_c1 3300050493 Bacteria 4102
230 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
231 nmdc:mga0k408_3018_c1 3300050493 Bacteria 7042
232 nmdc:mga0k408_36_c1 3300050493 Bacteria 72881
233 nmdc:mga0k408_42_c2 3300050493 Bacteria 47551
234 nmdc:mga0k408_832_c1 3300050493 Bacteria 17000
235 nmdc:mga06z11_16292_c1 3300050494 Unclassified 3344
236 nmdc:mga06z11_1_c1 3300050494 Bacteria 196297
237 nmdc:mga04h51_6_c1 3300050495 Bacteria 126812
238 nmdc:mga07m45_18858_c1 3300050496 Bacteria 3731
239 nmdc:mga07m45_5087_c1 3300050496 Bacteria 6508
240 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
241 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
242 Ga0500610_0000010 3300053079 Bacteria 101459
243 Ga0500610_0016615 3300053079 Bacteria 3514
244 Ga0500643_000011 3300053087 Bacteria 385630
245 Ga0500643_025598 3300053087 Bacteria 1858
246 Ga0500644_0000934 3300053088 Bacteria 9253
247 Ga0500583_0000152 3300053092 Bacteria 28818
248 Ga0500583_0088655 3300053092 Unclassified 1504
249 Ga0500651_0000047 3300053093 Bacteria 83743
250 Ga0500566_0000001 3300053094 Bacteria 1101031
251 Ga0500555_000001 3300053103 Bacteria 1353713
252 Ga0500555_000002 3300053103 Bacteria 1314346
253 Ga0500562_000009 3300053108 Bacteria 187538
254 Ga0500593_000001 3300053117 Bacteria 784404
255 Ga0500594_0000198 3300053118 Bacteria 14950
256 Ga0500614_000001 3300053123 Bacteria 1274484
257 Ga0500614_001431 3300053123 Bacteria 5718
258 Ga0500628_000006 3300053129 Bacteria 154858
259 Ga0500642_0001869 3300053130 Bacteria 6083
260 Ga0500652_000031 3300053131 Bacteria 89798
261 Ga0500561_0000001 3300053137 Bacteria 957685
262 Ga0500568_0022453 3300053139 Bacteria 2698
263 Ga0500577_0003412 3300053142 Bacteria 4129
264 Ga0500589_000008 3300053147 Bacteria 137145
265 Ga0500603_023560 3300053150 Bacteria 1533
266 Ga0500604_0020870 3300053151 Bacteria 1848
267 Ga0500616_0000005 3300053153 Bacteria 961725
268 Ga0500649_000022 3300053722 Bacteria 39643
269 Ga0500570_000007 3300053724 Bacteria 117035
270 Ga0501082_0099297 3300060353 Bacteria 2517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053092 Ga0500583_0088655 Ga0500583_0088655_449_1423 322
2 3300053103 Ga0500555_000001 Ga0500555_000001_919741_920799 351
3 3300013100 Ga0157373_10054231 Ga0157373_100542312 356
4 3300050491 nmdc:mga00v17_61725_c1 nmdc:mga00v17_61725_c1_696_1784 358
5 3300050493 nmdc:mga0k408_36_c1 nmdc:mga0k408_36_c1_14059_15147 358
6 3300053117 Ga0500593_000001 Ga0500593_000001_517640_518728 358
7 3300049569 Ga0501032_0002352 Ga0501032_0002352_13403_14527 359
8 3300049572 Ga0501036_0139838 Ga0501036_0139838_15_1139 359
9 3300049573 Ga0501037_0000113 Ga0501037_0000113_14243_15367 359
10 3300049579 Ga0501043_0000205 Ga0501043_0000205_40767_41891 359
11 3300049580 Ga0501046_0000038 Ga0501046_0000038_65060_66184 359
12 3300049581 Ga0501047_0000355 Ga0501047_0000355_28011_29135 359
13 3300049582 Ga0501048_0000379 Ga0501048_0000379_26066_27190 359
14 3300049586 Ga0501070_0058091 Ga0501070_0058091_1000_2124 359
15 3300049822 Ga0501035_0000768 Ga0501035_0000768_13185_14309 359
16 3300060353 Ga0501082_0099297 Ga0501082_0099297_113_1237 359
17 3300031235 Ga0265330_10002589 Ga0265330_100025897 361
18 3300013296 Ga0157374_10001234 Ga0157374_1000123422 363
19 3300009174 Ga0105241_10190932 Ga0105241_101909321 364
20 3300009979 Ga0105032_100884 Ga0105032_1008843 364
21 3300013296 Ga0157374_10459837 Ga0157374_104598371 364
22 3300005327 Ga0070658_10000783 Ga0070658_1000078314 365
23 3300025909 Ga0207705_10003842 Ga0207705_1000384211 365
24 3300005614 Ga0068856_100000001 Ga0068856_100000001370 366
25 3300026078 Ga0207702_10000001 Ga0207702_10000001918 366
26 3300028800 Ga0265338_10000419 Ga0265338_1000041949 368
27 3300028800 Ga0265338_10000451 Ga0265338_100004515 368
28 3300029957 Ga0265324_10002196 Ga0265324_100021964 368
29 3300031238 Ga0265332_10010486 Ga0265332_100104863 368
30 3300005327 Ga0070658_10028630 Ga0070658_100286304 369
31 3300005530 Ga0070679_100125312 Ga0070679_1001253122 369
32 3300009098 Ga0105245_10253458 Ga0105245_102534582 369
33 3300025909 Ga0207705_10043402 Ga0207705_100434023 369
34 3300025921 Ga0207652_10085159 Ga0207652_100851592 369
35 3300025931 Ga0207644_10002500 Ga0207644_100025003 369
36 3300026088 Ga0207641_10028200 Ga0207641_100282004 369
37 3300009101 Ga0105247_10090627 Ga0105247_100906272 370
38 3300053724 Ga0500570_000007 Ga0500570_000007_35053_36180 370
39 3300049589 Ga0501073_0118244 Ga0501073_0118244_253_1374 371
40 3300049742 Ga0501080_0003543 Ga0501080_0003543_11489_12610 371
41 3300003320 rootH2_10139540 rootH2_101395402 372
42 3300005327 Ga0070658_10050740 Ga0070658_100507402 372
43 3300005356 Ga0070674_100003596 Ga0070674_1000035964 372
44 3300005466 Ga0070685_10003760 Ga0070685_100037602 372
45 3300005548 Ga0070665_100041896 Ga0070665_1000418965 372
46 3300009098 Ga0105245_10000001 Ga0105245_10000001264 372
47 3300025927 Ga0207687_10000004 Ga0207687_100000043 372
48 3300025937 Ga0207669_10008312 Ga0207669_100083124 372
49 3300028379 Ga0268266_10005702 Ga0268266_1000570212 372
50 3300053093 Ga0500651_0000047 Ga0500651_0000047_15074_16213 372
51 3300053123 Ga0500614_001431 Ga0500614_001431_4369_5508 372
52 3300053142 Ga0500577_0003412 Ga0500577_0003412_2659_3780 372
53 3300005327 Ga0070658_10000012 Ga0070658_10000012112 373
54 3300005337 Ga0070682_100003061 Ga0070682_1000030612 373
55 3300005356 Ga0070674_100043324 Ga0070674_1000433242 373
56 3300005364 Ga0070673_100002589 Ga0070673_1000025893 373
57 3300005456 Ga0070678_100000678 Ga0070678_10000067816 373
58 3300005458 Ga0070681_10023802 Ga0070681_100238026 373
59 3300005459 Ga0068867_100179720 Ga0068867_1001797202 373
60 3300005548 Ga0070665_100076650 Ga0070665_1000766502 373
61 3300005841 Ga0068863_100022895 Ga0068863_1000228953 373
62 3300005844 Ga0068862_100105717 Ga0068862_1001057172 373
63 3300005937 Ga0081455_10000003 Ga0081455_10000003222 373
64 3300006038 Ga0075365_10000023 Ga0075365_1000002312 373
65 3300006051 Ga0075364_10006060 Ga0075364_100060605 373
66 3300009093 Ga0105240_10000003 Ga0105240_10000003970 373
67 3300009098 Ga0105245_10000050 Ga0105245_10000050109 373
68 3300009148 Ga0105243_10000001 Ga0105243_10000001321 373
69 3300009176 Ga0105242_10000011 Ga0105242_10000011130 373
70 3300009176 Ga0105242_10001716 Ga0105242_1000171615 373
71 3300009177 Ga0105248_10332630 Ga0105248_103326301 373
72 3300009545 Ga0105237_10007779 Ga0105237_1000777911 373
73 3300009551 Ga0105238_10385621 Ga0105238_103856212 373
74 3300010375 Ga0105239_10024217 Ga0105239_100242176 373
75 3300010375 Ga0105239_10064945 Ga0105239_100649453 373
76 3300013296 Ga0157374_10000064 Ga0157374_10000064109 373
77 3300013296 Ga0157374_10016980 Ga0157374_100169804 373
78 3300013297 Ga0157378_10050671 Ga0157378_100506713 373
79 3300014745 Ga0157377_10017112 Ga0157377_100171122 373
80 3300014969 Ga0157376_10000007 Ga0157376_10000007344 373
81 3300025909 Ga0207705_10000038 Ga0207705_1000003879 373
82 3300025912 Ga0207707_10123768 Ga0207707_101237682 373
83 3300025913 Ga0207695_10000005 Ga0207695_10000005980 373
84 3300025914 Ga0207671_10016406 Ga0207671_100164062 373
85 3300025919 Ga0207657_10078424 Ga0207657_100784242 373
86 3300025927 Ga0207687_10000117 Ga0207687_1000011726 373
87 3300025927 Ga0207687_10045301 Ga0207687_100453012 373
88 3300025927 Ga0207687_10201604 Ga0207687_102016042 373
89 3300025934 Ga0207686_10000001 Ga0207686_10000001821 373
90 3300025934 Ga0207686_10005367 Ga0207686_100053673 373
91 3300025935 Ga0207709_10000002 Ga0207709_10000002939 373
92 3300025937 Ga0207669_10059943 Ga0207669_100599432 373
93 3300025960 Ga0207651_10000047 Ga0207651_100000474 373
94 3300026088 Ga0207641_10018625 Ga0207641_100186255 373
95 3300026089 Ga0207648_10104589 Ga0207648_101045893 373
96 3300026121 Ga0207683_10033837 Ga0207683_100338373 373
97 3300028379 Ga0268266_10055059 Ga0268266_100550593 373
98 3300028380 Ga0268265_10112684 Ga0268265_101126842 373
99 3300028800 Ga0265338_10000841 Ga0265338_1000084117 373
100 3300037418 Ga0395900_0113093 Ga0395900_0113093_714_1850 373
101 3300037466 Ga0395898_0001404 Ga0395898_0001404_13128_14258 373
102 3300038443 Ga0395901_0003763 Ga0395901_0003763_9811_10941 373
103 3300038443 Ga0395901_0013675 Ga0395901_0013675_65_1201 373
104 3300046506 Ga0495583_0016402 Ga0495583_0016402_2670_3797 373
105 3300050491 nmdc:mga00v17_5005_c1 nmdc:mga00v17_5005_c1_2255_3400 373
106 3300050492 nmdc:mga0yw44_9_c1 nmdc:mga0yw44_9_c1_55152_56297 373
107 3300053087 Ga0500643_000011 Ga0500643_000011_125708_126838 373
108 3300002244 JGI24742J22300_10000008 JGI24742J22300_1000000810 374
109 3300005327 Ga0070658_10003509 Ga0070658_1000350914 374
110 3300005327 Ga0070658_10020147 Ga0070658_100201474 374
111 3300005328 Ga0070676_10000213 Ga0070676_1000021313 374
112 3300005329 Ga0070683_100000077 Ga0070683_10000007723 374
113 3300005329 Ga0070683_100075610 Ga0070683_1000756102 374
114 3300005336 Ga0070680_100000260 Ga0070680_10000026042 374
115 3300005337 Ga0070682_100002786 Ga0070682_1000027862 374
116 3300005339 Ga0070660_100000466 Ga0070660_10000046623 374
117 3300005339 Ga0070660_100082631 Ga0070660_1000826311 374
118 3300005341 Ga0070691_10005820 Ga0070691_100058203 374
119 3300005366 Ga0070659_100000897 Ga0070659_10000089719 374
120 3300005367 Ga0070667_100007902 Ga0070667_1000079029 374
121 3300005458 Ga0070681_10164838 Ga0070681_101648382 374
122 3300005458 Ga0070681_10314137 Ga0070681_103141371 374
123 3300005530 Ga0070679_100000670 Ga0070679_10000067028 374
124 3300005530 Ga0070679_100034749 Ga0070679_1000347497 374
125 3300005535 Ga0070684_100000448 Ga0070684_1000004485 374
126 3300005563 Ga0068855_100000168 Ga0068855_10000016816 374
127 3300005563 Ga0068855_100152657 Ga0068855_1001526572 374
128 3300005577 Ga0068857_100000007 Ga0068857_100000007144 374
129 3300005614 Ga0068856_100004109 Ga0068856_10000410913 374
130 3300013104 Ga0157370_10408751 Ga0157370_104087512 374
131 3300014325 Ga0163163_10000670 Ga0163163_100006704 374
132 3300014325 Ga0163163_10022928 Ga0163163_100229286 374
133 3300025907 Ga0207645_10000706 Ga0207645_1000070616 374
134 3300025909 Ga0207705_10002991 Ga0207705_100029915 374
135 3300025909 Ga0207705_10026318 Ga0207705_100263183 374
136 3300025912 Ga0207707_10113591 Ga0207707_101135912 374
137 3300025912 Ga0207707_10127699 Ga0207707_101276992 374
138 3300025917 Ga0207660_10001902 Ga0207660_1000190214 374
139 3300025919 Ga0207657_10006349 Ga0207657_1000634910 374
140 3300025919 Ga0207657_10054627 Ga0207657_100546272 374
141 3300025921 Ga0207652_10000657 Ga0207652_1000065717 374
142 3300025921 Ga0207652_10163328 Ga0207652_101633281 374
143 3300025932 Ga0207690_10000795 Ga0207690_100007958 374
144 3300025944 Ga0207661_10000536 Ga0207661_100005364 374
145 3300025944 Ga0207661_10065991 Ga0207661_100659913 374
146 3300025945 Ga0207679_10301866 Ga0207679_103018662 374
147 3300025949 Ga0207667_10000268 Ga0207667_1000026811 374
148 3300025949 Ga0207667_10062185 Ga0207667_100621852 374
149 3300025986 Ga0207658_10036015 Ga0207658_100360152 374
150 3300026078 Ga0207702_10007476 Ga0207702_100074766 374
151 3300026116 Ga0207674_10000001 Ga0207674_10000001326 374
152 3300026121 Ga0207683_10060159 Ga0207683_100601592 374
153 3300031251 Ga0265327_10000017 Ga0265327_10000017232 374
154 3300031251 Ga0265327_10017394 Ga0265327_100173944 374
155 3300041486 Ga0451807_1756152 Ga0451807_1756152_392_1537 374
156 3300049571 Ga0501034_0054208 Ga0501034_0054208_1664_2800 374
157 3300049581 Ga0501047_0002715 Ga0501047_0002715_7540_8679 374
158 3300049822 Ga0501035_0003683 Ga0501035_0003683_12205_13344 374
159 3300049823 Ga0501044_0171717 Ga0501044_0171717_297_1436 374
160 3300053079 Ga0500610_0000010 Ga0500610_0000010_66351_67478 374
161 3300053079 Ga0500610_0016615 Ga0500610_0016615_488_1615 374
162 3300053087 Ga0500643_025598 Ga0500643_025598_75_1202 374
163 3300053088 Ga0500644_0000934 Ga0500644_0000934_297_1424 374
164 3300053092 Ga0500583_0000152 Ga0500583_0000152_4815_5942 374
165 3300053103 Ga0500555_000002 Ga0500555_000002_334122_335249 374
166 3300053130 Ga0500642_0001869 Ga0500642_0001869_4821_5948 374
167 3300053131 Ga0500652_000031 Ga0500652_000031_39612_40739 374
168 3300053147 Ga0500589_000008 Ga0500589_000008_134051_135178 374
169 3300053153 Ga0500616_0000005 Ga0500616_0000005_457394_458530 374
170 3300005327 Ga0070658_10000133 Ga0070658_1000013351 375
171 3300005327 Ga0070658_10001615 Ga0070658_1000161520 375
172 3300005339 Ga0070660_100002164 Ga0070660_1000021643 375
173 3300005544 Ga0070686_100121281 Ga0070686_1001212812 375
174 3300005577 Ga0068857_100165847 Ga0068857_1001658472 375
175 3300005617 Ga0068859_100252177 Ga0068859_1002521772 375
176 3300005843 Ga0068860_100019850 Ga0068860_1000198502 375
177 3300006038 Ga0075365_10000288 Ga0075365_1000028814 375
178 3300006042 Ga0075368_10000001 Ga0075368_100000018 375
179 3300006048 Ga0075363_100000433 Ga0075363_1000004337 375
180 3300006178 Ga0075367_10000944 Ga0075367_100009447 375
181 3300006186 Ga0075369_10000003 Ga0075369_1000000383 375
182 3300006353 Ga0075370_10004696 Ga0075370_100046962 375
183 3300006931 Ga0097620_100252174 Ga0097620_1002521742 375
184 3300014325 Ga0163163_10005134 Ga0163163_100051348 375
185 3300025909 Ga0207705_10000011 Ga0207705_10000011384 375
186 3300025909 Ga0207705_10008837 Ga0207705_100088372 375
187 3300025919 Ga0207657_10001264 Ga0207657_100012643 375
188 3300025986 Ga0207658_10018274 Ga0207658_100182744 375
189 3300026116 Ga0207674_10105888 Ga0207674_101058882 375
190 3300027866 Ga0209813_10000006 Ga0209813_1000000693 375
191 3300028381 Ga0268264_10010018 Ga0268264_100100189 375
192 3300028573 Ga0265334_10000144 Ga0265334_100001446 375
193 3300028800 Ga0265338_10000771 Ga0265338_1000077155 375
194 3300031247 Ga0265340_10002576 Ga0265340_100025764 375
195 3300031251 Ga0265327_10013569 Ga0265327_100135694 375
196 3300046674 Ga0495588_0000124 Ga0495588_0000124_91884_93017 375
197 3300050490 nmdc:mga03n38_18_c1 nmdc:mga03n38_18_c1_6954_8090 375
198 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_408210_409343 375
199 3300050494 nmdc:mga06z11_1_c1 nmdc:mga06z11_1_c1_159258_160394 375
200 3300050495 nmdc:mga04h51_6_c1 nmdc:mga04h51_6_c1_90069_91205 375
201 3300050496 nmdc:mga07m45_18858_c1 nmdc:mga07m45_18858_c1_1033_2166 375
202 3300050496 nmdc:mga07m45_5087_c1 nmdc:mga07m45_5087_c1_2809_3945 375
203 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_443530_444660 375
204 3300053123 Ga0500614_000001 Ga0500614_000001_89603_90736 375
205 3300053139 Ga0500568_0022453 Ga0500568_0022453_648_1790 375
206 3300053151 Ga0500604_0020870 Ga0500604_0020870_671_1804 375
207 3300053722 Ga0500649_000022 Ga0500649_000022_12555_13688 375
208 3300005331 Ga0070670_100235914 Ga0070670_1002359142 376
209 3300005367 Ga0070667_100000001 Ga0070667_100000001873 376
210 3300005843 Ga0068860_100083924 Ga0068860_1000839242 376
211 3300009553 Ga0105249_10008588 Ga0105249_100085884 376
212 3300025949 Ga0207667_10127036 Ga0207667_101270362 376
213 3300025961 Ga0207712_10000432 Ga0207712_100004326 376
214 3300025986 Ga0207658_10000003 Ga0207658_10000003506 376
215 3300028381 Ga0268264_10016920 Ga0268264_100169205 376
216 3300048928 Ga0496125_0094332 Ga0496125_0094332_586_1773 376
217 3300050493 nmdc:mga0k408_3018_c1 nmdc:mga0k408_3018_c1_2633_3766 376
218 3300005335 Ga0070666_10030210 Ga0070666_100302103 377
219 3300005355 Ga0070671_100000001 Ga0070671_100000001340 377
220 3300005548 Ga0070665_100100122 Ga0070665_1001001222 377
221 3300009986 Ga0105033_100062 Ga0105033_10006210 377
222 3300025903 Ga0207680_10096171 Ga0207680_100961711 377
223 3300025931 Ga0207644_10000001 Ga0207644_100000011098 377
224 3300028379 Ga0268266_10110957 Ga0268266_101109573 377
225 3300053118 Ga0500594_0000198 Ga0500594_0000198_13379_14524 377
226 3300053129 Ga0500628_000006 Ga0500628_000006_38942_40087 377
227 3300001915 JGI24741J21665_1000876 JGI24741J21665_10008763 378
228 3300001990 JGI24737J22298_10000231 JGI24737J22298_1000023141 378
229 3300002067 JGI24735J21928_10000058 JGI24735J21928_1000005821 378
230 3300003322 rootL2_10372064 rootL2_103720642 378
231 3300005535 Ga0070684_100027870 Ga0070684_1000278703 378
232 3300005563 Ga0068855_100000003 Ga0068855_100000003321 378
233 3300005614 Ga0068856_100031955 Ga0068856_1000319556 378
234 3300005985 Ga0081539_10004849 Ga0081539_100048495 378
235 3300006051 Ga0075364_10016553 Ga0075364_100165533 378
236 3300006051 Ga0075364_10071583 Ga0075364_100715832 378
237 3300006178 Ga0075367_10025542 Ga0075367_100255423 378
238 3300006186 Ga0075369_10000020 Ga0075369_1000002024 378
239 3300006195 Ga0075366_10000001 Ga0075366_10000001267 378
240 3300006195 Ga0075366_10000005 Ga0075366_1000000516 378
241 3300006195 Ga0075366_10000136 Ga0075366_1000013619 378
242 3300009093 Ga0105240_10004772 Ga0105240_100047728 378
243 3300009174 Ga0105241_10000007 Ga0105241_10000007337 378
244 3300009986 Ga0105033_101572 Ga0105033_1015722 378
245 3300009993 Ga0105028_101909 Ga0105028_1019092 378
246 3300013100 Ga0157373_10014150 Ga0157373_100141502 378
247 3300013105 Ga0157369_10000072 Ga0157369_10000072129 378
248 3300013296 Ga0157374_10259693 Ga0157374_102596932 378
249 3300025911 Ga0207654_10000002 Ga0207654_100000021209 378
250 3300025944 Ga0207661_10005638 Ga0207661_100056387 378
251 3300025949 Ga0207667_10000008 Ga0207667_10000008313 378
252 3300026078 Ga0207702_10022717 Ga0207702_100227176 378
253 3300037418 Ga0395900_0093917 Ga0395900_0093917_1856_2998 378
254 3300046683 Ga0495658_0005538 Ga0495658_0005538_2131_3279 378
255 3300046694 Ga0495649_0000403 Ga0495649_0000403_30897_32036 378
256 3300046809 Ga0495600_0014571 Ga0495600_0014571_2741_3889 378
257 3300048929 Ga0496126_0061401 Ga0496126_0061401_1414_2559 378
258 3300049773 Ga0501276_000325 Ga0501276_000325_1541_2680 378
259 3300050490 nmdc:mga03n38_19006_c1 nmdc:mga03n38_19006_c1_321_1469 378
260 3300050493 nmdc:mga0k408_102_c1 nmdc:mga0k408_102_c1_2570_3709 378
261 3300050493 nmdc:mga0k408_16472_c1 nmdc:mga0k408_16472_c1_1606_2742 378
262 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_818356_819504 378
263 3300050493 nmdc:mga0k408_42_c2 nmdc:mga0k408_42_c2_22183_23334 378
264 3300050493 nmdc:mga0k408_832_c1 nmdc:mga0k408_832_c1_5740_6879 378
265 3300050494 nmdc:mga06z11_16292_c1 nmdc:mga06z11_16292_c1_1578_2717 378
266 3300050516 nmdc:mga0sz30_8_c1 nmdc:mga0sz30_8_c1_30105_31253 378
267 3300053094 Ga0500566_0000001 Ga0500566_0000001_778693_779841 378
268 3300053108 Ga0500562_000009 Ga0500562_000009_71070_72212 378
269 3300053137 Ga0500561_0000001 Ga0500561_0000001_396809_397948 378
270 3300053150 Ga0500603_023560 Ga0500603_023560_18_1163 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

247

413

0.95

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

77

244

0.91

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

257

399

0.9

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

78

239

0.84

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

215

395

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.875 193 350
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8591 193 350
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8589 193 361
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8388 193 361
2gek-assembly1.cif.gz_A crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp 0.836 1 368
ID Description Score Start End Superfamily
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9273 191 351 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9249 193 352 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9222 191 347 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9214 193 351 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9136 193 352 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1F7R7R7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9635 143 376 GO:0016758
AF-X1K7V7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9421 192 371 GO:0016757
AF-A0A1F7R7R7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9399 143 376 GO:0016758
AF-A0A838GBA6-F1-model_v4 Glycosyltransferase family 4 protein 0.9257 196 374 GO:0016758
AF-X0X5T0-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9196 157 360 GO:0016757

Feature Viewer

pLDDT pTM Quality
86.92 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map