F376843

General Info

Members Datasets Scaffolds Average Seq Length
270 180 540 254

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10223110|Ga0070717_102231104
Length 274
Sequence MLTLLGLPAAASTHAGDIDEMIVLVHWLMAILFVGWGLFFLYVLFRFRKGANPKASYTGAKGKISKGLEVAVAVIEVILLVFYAIPAWAKRVKAFPAENEATVVRVVGEQFAWNVHYPGPDGKFGRTDVKLVAPDNPLGLDRRDPDAKDDVTTINQLYLPVNRPVLIHLSSKDVIHSFGLYEMRVKQDAVPGMSIPVWFIPDTTTDEMRKKLNKPDFDYEITCSQLCGLGHFRMRGFVQVLSAADYQKWMADQEKELQPAVATPAAVPTAPRSN

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.19
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 17.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10223110 3300006028 Unclassified 1657
2 JGI24751J29686_10005770 3300002459 Bacteria 2524
3 Ga0058862_10011738 3300004803 Bacteria 1777
4 Ga0058862_12645855 3300004803 Unclassified 1007
5 Ga0065712_10103209 3300005290 Unclassified 1990
6 Ga0065707_10085132 3300005295 Bacteria 6426
7 Ga0070690_100042976 3300005330 Bacteria 2864
8 Ga0070670_100108148 3300005331 Unclassified 2396
9 Ga0068869_100377106 3300005334 Unclassified 1162
10 Ga0070680_100068878 3300005336 Bacteria 2905
11 Ga0070682_100022409 3300005337 Bacteria 3741
12 Ga0070682_100188575 3300005337 Bacteria 1446
13 Ga0068868_100032766 3300005338 Bacteria 3998
14 Ga0070660_100043306 3300005339 Bacteria 3440
15 Ga0070689_100012538 3300005340 Bacteria 6110
16 Ga0070689_100115523 3300005340 Bacteria 2139
17 Ga0070668_100017730 3300005347 Bacteria 5339
18 Ga0070669_100029234 3300005353 Bacteria 3972
19 Ga0070669_100032868 3300005353 Bacteria 3749
20 Ga0070675_100001537 3300005354 Bacteria 17074
21 Ga0070673_100071637 3300005364 Bacteria 2785
22 Ga0070688_100125104 3300005365 Unclassified 1727
23 Ga0070709_10111748 3300005434 Bacteria 1837
24 Ga0070700_100123643 3300005441 Bacteria 1737
25 Ga0070681_10096194 3300005458 Bacteria 2910
26 Ga0070685_10194166 3300005466 Unclassified 1315
27 Ga0070685_10287006 3300005466 Bacteria 1104
28 Ga0070699_100031590 3300005518 Bacteria 4572
29 Ga0070699_100095635 3300005518 Bacteria 2601
30 Ga0070679_100017287 3300005530 Bacteria 6979
31 Ga0070679_100037637 3300005530 Bacteria 4807
32 Ga0070684_100107642 3300005535 Bacteria 2497
33 Ga0070697_100387535 3300005536 Unclassified 1211
34 Ga0068853_101131660 3300005539 Unclassified 755
35 Ga0070672_100620427 3300005543 Unclassified 943
36 Ga0070686_100025887 3300005544 Bacteria 3534
37 Ga0070696_100127485 3300005546 Bacteria 1848
38 Ga0070665_100015165 3300005548 Bacteria 7737
39 Ga0070704_100234664 3300005549 Unclassified 1498
40 Ga0068855_100023932 3300005563 Bacteria 7314
41 Ga0068857_100161381 3300005577 Bacteria 2034
42 Ga0068854_100112789 3300005578 Bacteria 2053
43 Ga0068859_100116866 3300005617 Bacteria 2732
44 Ga0068859_100195942 3300005617 Bacteria 2105
45 Ga0068859_100348747 3300005617 Bacteria 1575
46 Ga0068866_10148952 3300005718 Bacteria 1353
47 Ga0068861_100019838 3300005719 Bacteria 4805
48 Ga0068861_100158990 3300005719 Bacteria 1862
49 Ga0068851_10118823 3300005834 Bacteria 1418
50 Ga0068858_100033441 3300005842 Unclassified 4771
51 Ga0068858_100087997 3300005842 Bacteria 2889
52 Ga0068858_100172126 3300005842 Bacteria 2042
53 Ga0068858_100182129 3300005842 Bacteria 1984
54 Ga0068858_100256176 3300005842 Bacteria 1663
55 Ga0068858_100292522 3300005842 Bacteria 1553
56 Ga0068860_100033594 3300005843 Bacteria 4921
57 Ga0068862_100118204 3300005844 Bacteria 2334
58 Ga0068862_100131594 3300005844 Bacteria 2213
59 Ga0068862_100238362 3300005844 Unclassified 1653
60 Ga0081455_10377844 3300005937 Unclassified 991
61 Ga0081540_1064403 3300005983 Bacteria 1729
62 Ga0070717_10290366 3300006028 Bacteria 1452
63 Ga0070715_10114160 3300006163 Bacteria 1278
64 Ga0070715_10235052 3300006163 Bacteria 950
65 Ga0070716_100160600 3300006173 Unclassified 1456
66 Ga0070716_100239708 3300006173 Unclassified 1229
67 Ga0097621_100009469 3300006237 Bacteria 7071
68 Ga0097621_100050539 3300006237 Bacteria 3381
69 Ga0097621_100286538 3300006237 Bacteria 1451
70 Ga0068871_100012578 3300006358 Bacteria 6248
71 Ga0068871_100171531 3300006358 Unclassified 1860
72 Ga0068871_100396225 3300006358 Unclassified 1229
73 Ga0075433_10067266 3300006852 Bacteria 3145
74 Ga0075433_10128269 3300006852 Bacteria 2253
75 Ga0075434_100021223 3300006871 Bacteria 6312
76 Ga0075434_100060975 3300006871 Bacteria 3752
77 Ga0075434_100730850 3300006871 Bacteria 1007
78 Ga0075436_100010393 3300006914 Bacteria 6379
79 Ga0097620_100116871 3300006931 Bacteria 2732
80 Ga0097620_100195915 3300006931 Bacteria 2105
81 Ga0097620_100348736 3300006931 Bacteria 1575
82 Ga0075435_100004448 3300007076 Bacteria 9632
83 Ga0075435_100052494 3300007076 Bacteria 3286
84 Ga0075435_100053991 3300007076 Bacteria 3242
85 Ga0111539_10211189 3300009094 Unclassified 2261
86 Ga0111539_10279755 3300009094 Bacteria 1942
87 Ga0105245_10059584 3300009098 Bacteria 3438
88 Ga0105245_10643245 3300009098 Unclassified 1090
89 Ga0105247_10017382 3300009101 Bacteria 4319
90 Ga0114129_10111924 3300009147 Bacteria 3766
91 Ga0114129_10113164 3300009147 Bacteria 3742
92 Ga0114129_10140444 3300009147 Bacteria 3311
93 Ga0105243_10465030 3300009148 Bacteria 1190
94 Ga0105242_10033222 3300009176 Bacteria 4130
95 Ga0105242_10350803 3300009176 Bacteria 1363
96 Ga0105242_10586345 3300009176 Bacteria 1075
97 Ga0105248_10024770 3300009177 Bacteria 6674
98 Ga0105248_10030747 3300009177 Bacteria 5998
99 Ga0105248_10089169 3300009177 Bacteria 3472
100 Ga0105248_10294126 3300009177 Unclassified 1829
101 Ga0105248_10398291 3300009177 Unclassified 1550
102 Ga0105238_10673454 3300009551 Unclassified 1046
103 Ga0105249_10016229 3300009553 Bacteria 6605
104 Ga0105249_10152751 3300009553 Bacteria 2224
105 Ga0157374_10118383 3300013296 Bacteria 2554
106 Ga0157374_10138351 3300013296 Bacteria 2362
107 Ga0157378_10608506 3300013297 Unclassified 1105
108 Ga0163162_10293786 3300013306 Bacteria 1757
109 Ga0157375_10118016 3300013308 Unclassified 2759
110 Ga0157375_10255970 3300013308 Bacteria 1912
111 Ga0163163_10816813 3300014325 Bacteria 996
112 Ga0157380_10034301 3300014326 Bacteria 3913
113 Ga0157380_10556061 3300014326 Unclassified 1127
114 Ga0157377_10041426 3300014745 Bacteria 2555
115 Ga0157379_10046157 3300014968 Bacteria 3888
116 Ga0157376_10033860 3300014969 Bacteria 4118
117 Ga0157376_10104160 3300014969 Bacteria 2486
118 Ga0163161_10536564 3300017792 Unclassified 957
119 Ga0207656_10072012 3300025321 Bacteria 1538
120 Ga0207642_10164544 3300025899 Bacteria 1194
121 Ga0207642_10333683 3300025899 Bacteria 889
122 Ga0207680_10126221 3300025903 Unclassified 1680
123 Ga0207680_10271543 3300025903 Bacteria 1176
124 Ga0207685_10052116 3300025905 Bacteria 1584
125 Ga0207699_10056009 3300025906 Bacteria 2348
126 Ga0207645_10195145 3300025907 Unclassified 1331
127 Ga0207654_10479425 3300025911 Bacteria 876
128 Ga0207707_10140018 3300025912 Bacteria 2116
129 Ga0207662_10298999 3300025918 Bacteria 1069
130 Ga0207657_10043378 3300025919 Bacteria 3962
131 Ga0207652_10166557 3300025921 Bacteria 1976
132 Ga0207681_10094518 3300025923 Bacteria 2142
133 Ga0207694_10366760 3300025924 Bacteria 1194
134 Ga0207659_10001294 3300025926 Bacteria 14955
135 Ga0207700_10287925 3300025928 Bacteria 1415
136 Ga0207644_10391109 3300025931 Bacteria 1135
137 Ga0207706_10017122 3300025933 Bacteria 6536
138 Ga0207706_10171863 3300025933 Bacteria 1904
139 Ga0207709_10488825 3300025935 Unclassified 958
140 Ga0207670_10021814 3300025936 Unclassified 3957
141 Ga0207669_10008545 3300025937 Bacteria 4814
142 Ga0207665_10031837 3300025939 Unclassified 3491
143 Ga0207691_10298670 3300025940 Bacteria 1384
144 Ga0207711_10179790 3300025941 Bacteria 1923
145 Ga0207711_10185737 3300025941 Bacteria 1892
146 Ga0207711_10259594 3300025941 Bacteria 1596
147 Ga0207711_10330031 3300025941 Bacteria 1411
148 Ga0207711_10420763 3300025941 Unclassified 1243
149 Ga0207667_10131233 3300025949 Bacteria 2580
150 Ga0207712_10513540 3300025961 Bacteria 1026
151 Ga0207640_10082191 3300025981 Bacteria 2205
152 Ga0207677_10413136 3300026023 Bacteria 1147
153 Ga0207703_10002242 3300026035 Bacteria 16903
154 Ga0207703_10065818 3300026035 Bacteria 2979
155 Ga0207703_10194583 3300026035 Bacteria 1798
156 Ga0207703_10275782 3300026035 Bacteria 1525
157 Ga0207641_10179295 3300026088 Bacteria 1939
158 Ga0207648_10018889 3300026089 Bacteria 6227
159 Ga0207676_10036797 3300026095 Bacteria 3726
160 Ga0207676_10623132 3300026095 Bacteria 1038
161 Ga0207675_100015362 3300026118 Bacteria 7141
162 Ga0207675_100070825 3300026118 Bacteria 3259
163 Ga0207675_100150562 3300026118 Bacteria 2214
164 Ga0207675_100267634 3300026118 Bacteria 1658
165 Ga0207683_10130767 3300026121 Bacteria 2258
166 Ga0207428_10403623 3300027907 Bacteria 1000
167 Ga0268266_10057208 3300028379 Bacteria 3355
168 Ga0268265_10096270 3300028380 Unclassified 2379
169 Ga0268265_10107418 3300028380 Bacteria 2269
170 Ga0268265_10325890 3300028380 Bacteria 1393
171 Ga0268264_10000914 3300028381 Bacteria 30928
172 Ga0268264_10560439 3300028381 Unclassified 1122
173 Ga0268264_10919633 3300028381 Bacteria 879
174 Ga0265332_10076490 3300031238 Bacteria 1422
175 Ga0265314_10038728 3300031711 Bacteria 3442
176 Ga0265342_10188622 3300031712 Bacteria 1126
177 Ga0307416_100213792 3300032002 Bacteria 1842
178 Ga0373934_0048760 3300035086 Bacteria 1677
179 Ga0373936_0020647 3300035113 Bacteria 2560
180 Ga0373943_0005334 3300035170 Bacteria 5779
181 Ga0373946_0016837 3300035171 Bacteria 2790
182 Ga0373955_0058325 3300035172 Bacteria 2124
183 Ga0373955_0139642 3300035172 Bacteria 1420
184 Ga0373924_0010839 3300035410 Bacteria 3373
185 Ga0373927_0030205 3300035695 Bacteria 3536
186 Ga0373933_0080287 3300035724 Bacteria 1999
187 Ga0373947_0045052 3300035725 Bacteria 2639
188 Ga0373937_0273624 3300036401 Bacteria 1594
189 Ga0373937_0423000 3300036401 Bacteria 1264
190 Ga0373925_0050984 3300037068 Bacteria 3088
191 Ga0495592_0027038 3300046454 Bacteria 4349
192 Ga0495628_0032989 3300046516 Bacteria 4176
193 Ga0495630_0048370 3300046517 Bacteria 3182
194 Ga0495630_0466212 3300046517 Bacteria 968
195 Ga0495665_0127037 3300046531 Bacteria 1335
196 Ga0495640_0090019 3300046533 Bacteria 2026
197 Ga0495640_0129003 3300046533 Bacteria 1638
198 Ga0495645_0273298 3300046543 Bacteria 1114
199 Ga0495634_0264664 3300046642 Bacteria 1048
200 Ga0495634_0303674 3300046642 Unclassified 964
201 Ga0495635_0356740 3300046663 Bacteria 975
202 Ga0495599_0249793 3300046678 Unclassified 1080
203 Ga0495658_0102744 3300046683 Bacteria 1708
204 Ga0495658_0215678 3300046683 Unclassified 1200
205 Ga0495613_0000927 3300046689 Bacteria 22499
206 Ga0495600_0076081 3300046809 Bacteria 2192
207 Ga0495581_0124380 3300047315 Bacteria 1502
208 Ga0495604_0057732 3300047317 Bacteria 2983
209 Ga0495674_0005735 3300047319 Bacteria 11901
210 Ga0495674_0295378 3300047319 Bacteria 1324
211 Ga0495680_0119602 3300047322 Bacteria 1946
212 Ga0495684_0000048 3300047471 Bacteria 89243
213 Ga0496101_0000685 3300048904 Bacteria 20428
214 Ga0496102_0696839 3300048905 Bacteria 939
215 Ga0496104_0214743 3300048907 Bacteria 1835
216 Ga0496104_0447242 3300048907 Bacteria 1204
217 Ga0496105_0042435 3300048908 Bacteria 3750
218 Ga0496105_0286194 3300048908 Bacteria 1328
219 Ga0496107_0236747 3300048910 Bacteria 1359
220 Ga0496108_0029582 3300048911 Bacteria 4538
221 Ga0496109_0562135 3300048912 Bacteria 1076
222 Ga0496110_0068299 3300048913 Bacteria 3146
223 Ga0496111_0212936 3300048914 Bacteria 1435
224 Ga0496114_0070631 3300048917 Bacteria 2933
225 Ga0496114_0110426 3300048917 Unclassified 2355
226 Ga0496114_0242798 3300048917 Unclassified 1584
227 Ga0501036_0035823 3300049572 Bacteria 4200
228 Ga0501036_0051854 3300049572 Bacteria 3474
229 Ga0501039_0043031 3300049575 Bacteria 3489
230 Ga0501040_0006107 3300049576 Bacteria 7814
231 Ga0501041_0006178 3300049577 Bacteria 7001
232 Ga0501042_0010389 3300049578 Bacteria 6241
233 Ga0501043_0061223 3300049579 Bacteria 2956
234 Ga0501046_0007776 3300049580 Bacteria 9404
235 Ga0501068_0210468 3300049584 Bacteria 1234
236 Ga0501071_0008592 3300049587 Bacteria 6750
237 Ga0501074_0218045 3300049590 Unclassified 1359
238 Ga0501075_0001743 3300049591 Bacteria 14308
239 Ga0501076_0001162 3300049592 Bacteria 17406
240 Ga0501077_0008036 3300049593 Bacteria 6521
241 Ga0501079_0028989 3300049741 Bacteria 4249
242 Ga0501079_0212502 3300049741 Bacteria 1511
243 Ga0501080_0072928 3300049742 Bacteria 3194
244 Ga0501081_0055339 3300049743 Bacteria 2741
245 Ga0501045_0028244 3300049824 Bacteria 4046
246 nmdc:mga05p37_22241_c1 3300050507 Bacteria 7687
247 nmdc:mga05p37_29063_c1 3300050507 Bacteria 6746
248 nmdc:mga05p37_316459_c1 3300050507 Unclassified 1848
249 nmdc:mga05p37_625762_c1 3300050507 Bacteria 1210
250 nmdc:mga06r32_1143810_c1 3300050510 Unclassified 726
251 nmdc:mga08y16_170699_c1 3300050511 Unclassified 2259
252 nmdc:mga08y16_224901_c1 3300050511 Bacteria 1942
253 nmdc:mga0n895_108320_c1 3300050512 Bacteria 2793
254 nmdc:mga0n895_16763_c1 3300050512 Bacteria 6733
255 nmdc:mga0n895_188368_c1 3300050512 Unclassified 2094
256 nmdc:mga0n895_45134_c1 3300050512 Bacteria 4299
257 nmdc:mga0rr50_22625_c1 3300050513 Bacteria 4318
258 nmdc:mga08x19_111660_c1 3300050514 Bacteria 1824
259 nmdc:mga08x19_17643_c1 3300050514 Bacteria 4371
260 nmdc:mga08x19_66034_c1 3300050514 Unclassified 2350
261 nmdc:mga0a205_122842_c1 3300050515 Bacteria 2496
262 nmdc:mga0a205_59591_c1 3300050515 Bacteria 3687
263 Ga0495601_0082246 3300053077 Bacteria 2067
264 Ga0495601_0153745 3300053077 Bacteria 1502
265 Ga0495619_0001582 3300053085 Bacteria 14969
266 Ga0495619_0028066 3300053085 Bacteria 3629
267 Ga0501084_0133752 3300054114 Bacteria 2087
268 Ga0501082_0012981 3300060353 Bacteria 7161
269 Ga0501082_0052057 3300060353 Bacteria 3529
270 Ga0530510_0023942 3300061734 Bacteria 4355
271 Ga0070717_10223110
272 JGI24751J29686_10005770
273 Ga0058862_10011738
274 Ga0058862_12645855
275 Ga0065712_10103209
276 Ga0065707_10085132
277 Ga0070690_100042976
278 Ga0070670_100108148
279 Ga0068869_100377106
280 Ga0070680_100068878
281 Ga0070682_100022409
282 Ga0070682_100188575
283 Ga0068868_100032766
284 Ga0070660_100043306
285 Ga0070689_100012538
286 Ga0070689_100115523
287 Ga0070668_100017730
288 Ga0070669_100029234
289 Ga0070669_100032868
290 Ga0070675_100001537
291 Ga0070673_100071637
292 Ga0070688_100125104
293 Ga0070709_10111748
294 Ga0070700_100123643
295 Ga0070681_10096194
296 Ga0070685_10194166
297 Ga0070685_10287006
298 Ga0070699_100031590
299 Ga0070699_100095635
300 Ga0070679_100017287
301 Ga0070679_100037637
302 Ga0070684_100107642
303 Ga0070697_100387535
304 Ga0068853_101131660
305 Ga0070672_100620427
306 Ga0070686_100025887
307 Ga0070696_100127485
308 Ga0070665_100015165
309 Ga0070704_100234664
310 Ga0068855_100023932
311 Ga0068857_100161381
312 Ga0068854_100112789
313 Ga0068859_100116866
314 Ga0068859_100195942
315 Ga0068859_100348747
316 Ga0068866_10148952
317 Ga0068861_100019838
318 Ga0068861_100158990
319 Ga0068851_10118823
320 Ga0068858_100033441
321 Ga0068858_100087997
322 Ga0068858_100172126
323 Ga0068858_100182129
324 Ga0068858_100256176
325 Ga0068858_100292522
326 Ga0068860_100033594
327 Ga0068862_100118204
328 Ga0068862_100131594
329 Ga0068862_100238362
330 Ga0081455_10377844
331 Ga0081540_1064403
332 Ga0070717_10290366
333 Ga0070715_10114160
334 Ga0070715_10235052
335 Ga0070716_100160600
336 Ga0070716_100239708
337 Ga0097621_100009469
338 Ga0097621_100050539
339 Ga0097621_100286538
340 Ga0068871_100012578
341 Ga0068871_100171531
342 Ga0068871_100396225
343 Ga0075433_10067266
344 Ga0075433_10128269
345 Ga0075434_100021223
346 Ga0075434_100060975
347 Ga0075434_100730850
348 Ga0075436_100010393
349 Ga0097620_100116871
350 Ga0097620_100195915
351 Ga0097620_100348736
352 Ga0075435_100004448
353 Ga0075435_100052494
354 Ga0075435_100053991
355 Ga0111539_10211189
356 Ga0111539_10279755
357 Ga0105245_10059584
358 Ga0105245_10643245
359 Ga0105247_10017382
360 Ga0114129_10111924
361 Ga0114129_10113164
362 Ga0114129_10140444
363 Ga0105243_10465030
364 Ga0105242_10033222
365 Ga0105242_10350803
366 Ga0105242_10586345
367 Ga0105248_10024770
368 Ga0105248_10030747
369 Ga0105248_10089169
370 Ga0105248_10294126
371 Ga0105248_10398291
372 Ga0105238_10673454
373 Ga0105249_10016229
374 Ga0105249_10152751
375 Ga0157374_10118383
376 Ga0157374_10138351
377 Ga0157378_10608506
378 Ga0163162_10293786
379 Ga0157375_10118016
380 Ga0157375_10255970
381 Ga0163163_10816813
382 Ga0157380_10034301
383 Ga0157380_10556061
384 Ga0157377_10041426
385 Ga0157379_10046157
386 Ga0157376_10033860
387 Ga0157376_10104160
388 Ga0163161_10536564
389 Ga0207656_10072012
390 Ga0207642_10164544
391 Ga0207642_10333683
392 Ga0207680_10126221
393 Ga0207680_10271543
394 Ga0207685_10052116
395 Ga0207699_10056009
396 Ga0207645_10195145
397 Ga0207654_10479425
398 Ga0207707_10140018
399 Ga0207662_10298999
400 Ga0207657_10043378
401 Ga0207652_10166557
402 Ga0207681_10094518
403 Ga0207694_10366760
404 Ga0207659_10001294
405 Ga0207700_10287925
406 Ga0207644_10391109
407 Ga0207706_10017122
408 Ga0207706_10171863
409 Ga0207709_10488825
410 Ga0207670_10021814
411 Ga0207669_10008545
412 Ga0207665_10031837
413 Ga0207691_10298670
414 Ga0207711_10179790
415 Ga0207711_10185737
416 Ga0207711_10259594
417 Ga0207711_10330031
418 Ga0207711_10420763
419 Ga0207667_10131233
420 Ga0207712_10513540
421 Ga0207640_10082191
422 Ga0207677_10413136
423 Ga0207703_10002242
424 Ga0207703_10065818
425 Ga0207703_10194583
426 Ga0207703_10275782
427 Ga0207641_10179295
428 Ga0207648_10018889
429 Ga0207676_10036797
430 Ga0207676_10623132
431 Ga0207675_100015362
432 Ga0207675_100070825
433 Ga0207675_100150562
434 Ga0207675_100267634
435 Ga0207683_10130767
436 Ga0207428_10403623
437 Ga0268266_10057208
438 Ga0268265_10096270
439 Ga0268265_10107418
440 Ga0268265_10325890
441 Ga0268264_10000914
442 Ga0268264_10560439
443 Ga0268264_10919633
444 Ga0265332_10076490
445 Ga0265314_10038728
446 Ga0265342_10188622
447 Ga0307416_100213792
448 Ga0373934_0048760
449 Ga0373936_0020647
450 Ga0373943_0005334
451 Ga0373946_0016837
452 Ga0373955_0058325
453 Ga0373955_0139642
454 Ga0373924_0010839
455 Ga0373927_0030205
456 Ga0373933_0080287
457 Ga0373947_0045052
458 Ga0373937_0273624
459 Ga0373937_0423000
460 Ga0373925_0050984
461 Ga0495592_0027038
462 Ga0495628_0032989
463 Ga0495630_0048370
464 Ga0495630_0466212
465 Ga0495665_0127037
466 Ga0495640_0090019
467 Ga0495640_0129003
468 Ga0495645_0273298
469 Ga0495634_0264664
470 Ga0495634_0303674
471 Ga0495635_0356740
472 Ga0495599_0249793
473 Ga0495658_0102744
474 Ga0495658_0215678
475 Ga0495613_0000927
476 Ga0495600_0076081
477 Ga0495581_0124380
478 Ga0495604_0057732
479 Ga0495674_0005735
480 Ga0495674_0295378
481 Ga0495680_0119602
482 Ga0495684_0000048
483 Ga0496101_0000685
484 Ga0496102_0696839
485 Ga0496104_0214743
486 Ga0496104_0447242
487 Ga0496105_0042435
488 Ga0496105_0286194
489 Ga0496107_0236747
490 Ga0496108_0029582
491 Ga0496109_0562135
492 Ga0496110_0068299
493 Ga0496111_0212936
494 Ga0496114_0070631
495 Ga0496114_0110426
496 Ga0496114_0242798
497 Ga0501036_0035823
498 Ga0501036_0051854
499 Ga0501039_0043031
500 Ga0501040_0006107
501 Ga0501041_0006178
502 Ga0501042_0010389
503 Ga0501043_0061223
504 Ga0501046_0007776
505 Ga0501068_0210468
506 Ga0501071_0008592
507 Ga0501074_0218045
508 Ga0501075_0001743
509 Ga0501076_0001162
510 Ga0501077_0008036
511 Ga0501079_0028989
512 Ga0501079_0212502
513 Ga0501080_0072928
514 Ga0501081_0055339
515 Ga0501045_0028244
516 nmdc:mga05p37_22241_c1
517 nmdc:mga05p37_29063_c1
518 nmdc:mga05p37_316459_c1
519 nmdc:mga05p37_625762_c1
520 nmdc:mga06r32_1143810_c1
521 nmdc:mga08y16_170699_c1
522 nmdc:mga08y16_224901_c1
523 nmdc:mga0n895_108320_c1
524 nmdc:mga0n895_16763_c1
525 nmdc:mga0n895_188368_c1
526 nmdc:mga0n895_45134_c1
527 nmdc:mga0rr50_22625_c1
528 nmdc:mga08x19_111660_c1
529 nmdc:mga08x19_17643_c1
530 nmdc:mga08x19_66034_c1
531 nmdc:mga0a205_122842_c1
532 nmdc:mga0a205_59591_c1
533 Ga0495601_0082246
534 Ga0495601_0153745
535 Ga0495619_0001582
536 Ga0495619_0028066
537 Ga0501084_0133752
538 Ga0501082_0012981
539 Ga0501082_0052057
540 Ga0530510_0023942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

102

241

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.9347 155 229
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.9308 155 229
6pty-assembly2.cif.gz_B soluble model of human cua (tt3lh) 0.9296 155 229
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.9287 155 229
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.9209 155 229
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9324 156 237 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9301 155 229 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9185 101 238 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9132 94 240 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8872 90 240 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7C7WHT2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9638 71 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A7Y4TJV2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9594 77 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A7W1TTH5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9583 82 241 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A2V6L428-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9575 100 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A3B9LF19-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9523 68 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Map