F376795

General Info

Members Datasets Scaffolds Average Seq Length
270 178 526 69

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100736637|Ga0070698_1007366373
Length 72
Sequence MTGTIELLYILVRGQKAKMDERGASAVEYGLLIAGIAALIVAVVFLFGNVIKGIFTDTCTAVSQSATLKTCS

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
118 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
119 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 4.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 0
Rhizoplane 10.74
Rhizosphere 77.41
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100736637 3300005471 Bacteria 928
2 JGI24737J22298_10036768 3300001990 Bacteria 1511
3 JGI24743J22301_10103494 3300001991 Bacteria 615
4 Ga0058863_11934220 3300004799 Bacteria 523
5 Ga0070658_10004529 3300005327 Bacteria 11303
6 Ga0070658_11167470 3300005327 Bacteria 669
7 Ga0070683_100000126 3300005329 Bacteria 50119
8 Ga0070690_100428223 3300005330 Bacteria 977
9 Ga0070666_10519906 3300005335 Bacteria 864
10 Ga0070680_100336191 3300005336 Bacteria 1283
11 Ga0070682_100029775 3300005337 Bacteria 3290
12 Ga0068868_100194728 3300005338 Bacteria 1687
13 Ga0070660_100556760 3300005339 Bacteria 957
14 Ga0070660_101144499 3300005339 Bacteria 659
15 Ga0070687_100510350 3300005343 Bacteria 811
16 Ga0070661_100689125 3300005344 Bacteria 832
17 Ga0070692_10008431 3300005345 Bacteria 4600
18 Ga0070668_100171094 3300005347 Bacteria 1769
19 Ga0070675_100123187 3300005354 Bacteria 2204
20 Ga0070671_100561316 3300005355 Bacteria 985
21 Ga0070674_100180855 3300005356 Bacteria 1615
22 Ga0070673_100835160 3300005364 Bacteria 852
23 Ga0070667_100014758 3300005367 Bacteria 6455
24 Ga0070667_100015173 3300005367 Bacteria 6364
25 Ga0070667_102150943 3300005367 Bacteria 526
26 Ga0070678_100190222 3300005456 Bacteria 1687
27 Ga0070681_10373293 3300005458 Bacteria 1337
28 Ga0070685_10132193 3300005466 Bacteria 1562
29 Ga0070698_100042404 3300005471 Bacteria 4667
30 Ga0070684_100003372 3300005535 Bacteria 11966
31 Ga0070684_100810140 3300005535 Bacteria 876
32 Ga0068853_100113794 3300005539 Bacteria 2406
33 Ga0070686_100561950 3300005544 Bacteria 894
34 Ga0070693_100183166 3300005547 Bacteria 1349
35 Ga0070665_100002972 3300005548 Bacteria 18317
36 Ga0070665_100914266 3300005548 Bacteria 890
37 Ga0070665_102085948 3300005548 Bacteria 572
38 Ga0068855_100029531 3300005563 Bacteria 6553
39 Ga0068857_100006160 3300005577 Bacteria 10254
40 Ga0068856_100074819 3300005614 Bacteria 3354
41 Ga0070702_100005787 3300005615 Bacteria 5794
42 Ga0068859_101288827 3300005617 Bacteria 805
43 Ga0068864_100071883 3300005618 Bacteria 3014
44 Ga0068860_100262676 3300005843 Bacteria 1683
45 Ga0075365_10159238 3300006038 Bacteria 1572
46 Ga0075365_10335251 3300006038 Bacteria 1066
47 Ga0075368_10538749 3300006042 Bacteria 524
48 Ga0075363_100027140 3300006048 Bacteria 2934
49 Ga0075363_101027758 3300006048 Bacteria 509
50 Ga0075364_10097959 3300006051 Bacteria 1951
51 Ga0075364_10270963 3300006051 Bacteria 1155
52 Ga0075364_10359621 3300006051 Bacteria 992
53 Ga0075364_10827738 3300006051 Bacteria 631
54 Ga0075367_10174112 3300006178 Bacteria 1341
55 Ga0075367_11089579 3300006178 Bacteria 511
56 Ga0097621_100504651 3300006237 Bacteria 1096
57 Ga0097621_102191311 3300006237 Bacteria 529
58 Ga0068871_100720894 3300006358 Bacteria 915
59 Ga0068865_100034408 3300006881 Bacteria 3399
60 Ga0097620_101289041 3300006931 Bacteria 805
61 Ga0075435_101814234 3300007076 Bacteria 535
62 Ga0111539_11211767 3300009094 Bacteria 877
63 Ga0111539_11512738 3300009094 Bacteria 778
64 Ga0105245_10003456 3300009098 Bacteria 14153
65 Ga0105245_10353577 3300009098 Bacteria 1456
66 Ga0105247_10163994 3300009101 Bacteria 1473
67 Ga0105243_10040241 3300009148 Bacteria 3648
68 Ga0105243_10324356 3300009148 Bacteria 1404
69 Ga0105243_11367997 3300009148 Bacteria 727
70 Ga0105241_10101427 3300009174 Bacteria 2288
71 Ga0105242_11061607 3300009176 Bacteria 822
72 Ga0105242_11883928 3300009176 Bacteria 638
73 Ga0105242_12085312 3300009176 Bacteria 611
74 Ga0105248_10358449 3300009177 Bacteria 1642
75 Ga0105248_11615183 3300009177 Bacteria 734
76 Ga0105237_10161378 3300009545 Bacteria 2240
77 Ga0105238_11730943 3300009551 Bacteria 656
78 Ga0105249_10005938 3300009553 Bacteria 10576
79 Ga0105249_10898794 3300009553 Bacteria 952
80 Ga0105239_10006186 3300010375 Bacteria 13929
81 Ga0105246_10001923 3300011119 Bacteria 12517
82 Ga0105246_10827011 3300011119 Bacteria 824
83 Ga0105246_10995434 3300011119 Bacteria 759
84 Ga0105246_11216028 3300011119 Bacteria 694
85 Ga0105246_12541134 3300011119 Unclassified 505
86 Ga0157322_1025105 3300012490 Bacteria 601
87 Ga0157371_10844612 3300013102 Bacteria 692
88 Ga0157369_10219764 3300013105 Bacteria 1989
89 Ga0157369_10840455 3300013105 Bacteria 943
90 Ga0157374_10576555 3300013296 Bacteria 1134
91 Ga0157378_12395970 3300013297 Bacteria 580
92 Ga0163162_10016537 3300013306 Bacteria 7209
93 Ga0163162_11333563 3300013306 Bacteria 816
94 Ga0157372_10003081 3300013307 Bacteria 17948
95 Ga0157375_10219478 3300013308 Bacteria 2060
96 Ga0157375_10443352 3300013308 Bacteria 1464
97 Ga0157375_11529481 3300013308 Bacteria 788
98 Ga0157375_12649117 3300013308 Bacteria 599
99 Ga0157375_13617258 3300013308 Bacteria 514
100 Ga0163163_10065398 3300014325 Bacteria 3610
101 Ga0163163_10280159 3300014325 Bacteria 1719
102 Ga0163163_11938223 3300014325 Bacteria 649
103 Ga0163163_12191662 3300014325 Bacteria 612
104 Ga0163163_12642192 3300014325 Bacteria 559
105 Ga0157380_10124490 3300014326 Bacteria 2189
106 Ga0157379_10015464 3300014968 Bacteria 6696
107 Ga0157379_11696900 3300014968 Bacteria 619
108 Ga0157376_10739036 3300014969 Bacteria 992
109 Ga0157376_11243057 3300014969 Bacteria 774
110 Ga0163161_10505786 3300017792 Bacteria 984
111 Ga0163161_10987194 3300017792 Bacteria 718
112 Ga0163161_11989680 3300017792 Bacteria 517
113 Ga0206356_10566478 3300020070 Bacteria 557
114 Ga0206356_10888774 3300020070 Bacteria 639
115 Ga0206354_10123209 3300020081 Bacteria 799
116 Ga0206353_10500639 3300020082 Bacteria 1068
117 Ga0207680_10469712 3300025903 Bacteria 894
118 Ga0207647_10132447 3300025904 Bacteria 1465
119 Ga0207647_10153373 3300025904 Bacteria 1346
120 Ga0207705_10059666 3300025909 Bacteria 2754
121 Ga0207705_10999727 3300025909 Bacteria 646
122 Ga0207654_10191249 3300025911 Bacteria 1341
123 Ga0207707_10244879 3300025912 Bacteria 1558
124 Ga0207707_10419655 3300025912 Bacteria 1147
125 Ga0207671_10209034 3300025914 Bacteria 1526
126 Ga0207662_10470719 3300025918 Bacteria 862
127 Ga0207657_10479950 3300025919 Bacteria 974
128 Ga0207649_10069731 3300025920 Bacteria 2240
129 Ga0207652_11166220 3300025921 Bacteria 672
130 Ga0207694_11152923 3300025924 Bacteria 656
131 Ga0207659_10105572 3300025926 Bacteria 2132
132 Ga0207687_10033302 3300025927 Bacteria 3495
133 Ga0207644_10717239 3300025931 Bacteria 834
134 Ga0207686_10764563 3300025934 Bacteria 772
135 Ga0207709_10065276 3300025935 Bacteria 2288
136 Ga0207709_11169795 3300025935 Bacteria 633
137 Ga0207704_10049821 3300025938 Bacteria 2523
138 Ga0207711_10199204 3300025941 Bacteria 1827
139 Ga0207661_10000930 3300025944 Bacteria 19226
140 Ga0207661_11291552 3300025944 Bacteria 671
141 Ga0207667_10053742 3300025949 Bacteria 4237
142 Ga0207651_10990497 3300025960 Bacteria 751
143 Ga0207712_10027301 3300025961 Bacteria 3810
144 Ga0207712_10978121 3300025961 Bacteria 750
145 Ga0207712_11624831 3300025961 Bacteria 579
146 Ga0207668_10694748 3300025972 Bacteria 894
147 Ga0207658_10201914 3300025986 Bacteria 1660
148 Ga0207658_10291087 3300025986 Bacteria 1403
149 Ga0207677_10106224 3300026023 Bacteria 2079
150 Ga0207677_11299580 3300026023 Bacteria 668
151 Ga0207639_10043449 3300026041 Bacteria 3374
152 Ga0207678_11084066 3300026067 Bacteria 709
153 Ga0207702_10040743 3300026078 Bacteria 3893
154 Ga0207676_10174633 3300026095 Bacteria 1875
155 Ga0207674_10001114 3300026116 Bacteria 34893
156 Ga0207675_102510087 3300026118 Bacteria 526
157 Ga0207683_10956214 3300026121 Bacteria 795
158 Ga0207428_10501491 3300027907 Bacteria 881
159 Ga0268266_10001783 3300028379 Bacteria 24420
160 Ga0268266_10183674 3300028379 Bacteria 1906
161 Ga0268266_10190103 3300028379 Bacteria 1874
162 Ga0268264_10004375 3300028381 Bacteria 12058
163 Ga0268264_10057226 3300028381 Bacteria 3261
164 Ga0268264_11513441 3300028381 Bacteria 682
165 Ga0307405_10535491 3300031731 Bacteria 945
166 Ga0307409_102064830 3300031995 Bacteria 600
167 Ga0451787_555676 3300041441 Bacteria 513
168 Ga0451791_1190777 3300041451 Bacteria 504
169 Ga0451793_1918295 3300041452 Bacteria 592
170 Ga0451802_1138399 3300041460 Bacteria 925
171 Ga0451802_2089049 3300041460 Bacteria 750
172 Ga0451839_1043069 3300041496 Bacteria 613
173 Ga0451843_1078008 3300041509 Bacteria 594
174 Ga0451855_0544137 3300041511 Bacteria 643
175 Ga0439459_0144617 3300042438 Unclassified 617
176 Ga0466963_0656857 3300044694 Unclassified 740
177 Ga0451576_0168187 3300045051 Bacteria 2288
178 Ga0466967_0024530 3300045976 Bacteria 4960
179 Ga0466967_0284728 3300045976 Bacteria 1586
180 Ga0466967_0684500 3300045976 Bacteria 1015
181 Ga0495640_0082939 3300046533 Bacteria 2128
182 Ga0495658_0113003 3300046683 Bacteria 1635
183 Ga0495680_0106278 3300047322 Bacteria 2086
184 Ga0495593_0652688 3300047673 Bacteria 528
185 Ga0496102_0009434 3300048905 Bacteria 8383
186 Ga0496103_0121769 3300048906 Bacteria 1662
187 Ga0496103_0372914 3300048906 Bacteria 917
188 Ga0496104_0003531 3300048907 Bacteria 13479
189 Ga0496105_0094601 3300048908 Bacteria 2467
190 Ga0496107_0095628 3300048910 Bacteria 2173
191 Ga0496108_0040204 3300048911 Bacteria 3897
192 Ga0496108_0218123 3300048911 Bacteria 1657
193 Ga0496108_1106381 3300048911 Bacteria 673
194 Ga0496109_0043549 3300048912 Bacteria 4069
195 Ga0496109_0092522 3300048912 Bacteria 2797
196 Ga0496109_0467919 3300048912 Bacteria 1190
197 Ga0496109_0700000 3300048912 Bacteria 951
198 Ga0496109_1034777 3300048912 Bacteria 758
199 Ga0496109_2060071 3300048912 Bacteria 502
200 Ga0496110_0008572 3300048913 Bacteria 8232
201 Ga0496110_0376500 3300048913 Bacteria 1294
202 Ga0496110_0839065 3300048913 Bacteria 824
203 Ga0496111_0008843 3300048914 Bacteria 6691
204 Ga0496111_0538938 3300048914 Bacteria 857
205 Ga0496112_1815013 3300048915 Bacteria 522
206 Ga0496113_1057230 3300048916 Bacteria 638
207 Ga0496114_0041331 3300048917 Bacteria 3820
208 Ga0496115_0011931 3300048918 Bacteria 6525
209 Ga0501034_0102860 3300049571 Bacteria 2850
210 Ga0501036_0046793 3300049572 Bacteria 3663
211 Ga0501037_0694807 3300049573 Bacteria 677
212 Ga0501039_0038069 3300049575 Bacteria 3715
213 Ga0501040_0191379 3300049576 Bacteria 1451
214 Ga0501042_0233789 3300049578 Bacteria 1326
215 Ga0501043_0386378 3300049579 Bacteria 1059
216 Ga0501047_0842834 3300049581 Bacteria 731
217 Ga0501067_0013663 3300049583 Bacteria 4496
218 Ga0501068_0013154 3300049584 Bacteria 4705
219 Ga0501069_0355740 3300049585 Bacteria 863
220 Ga0501070_0007277 3300049586 Bacteria 9396
221 Ga0501070_0057224 3300049586 Bacteria 3232
222 Ga0501071_0241471 3300049587 Bacteria 1362
223 Ga0501072_0024290 3300049588 Bacteria 4714
224 Ga0501072_0137135 3300049588 Bacteria 1950
225 Ga0501073_0010381 3300049589 Bacteria 6830
226 Ga0501074_0019875 3300049590 Bacteria 4878
227 Ga0501075_0193994 3300049591 Bacteria 1549
228 Ga0501076_0619276 3300049592 Bacteria 893
229 Ga0501077_0012411 3300049593 Bacteria 5335
230 Ga0501079_0024539 3300049741 Bacteria 4627
231 Ga0501079_1626182 3300049741 Bacteria 508
232 Ga0501080_0030549 3300049742 Bacteria 5020
233 Ga0501081_0982733 3300049743 Bacteria 638
234 Ga0501083_0005692 3300049744 Bacteria 8821
235 Ga0501083_0844672 3300049744 Bacteria 596
236 Ga0501035_0356594 3300049822 Bacteria 1223
237 nmdc:mga03n38_105091_c1 3300050490 Bacteria 1367
238 nmdc:mga03n38_184882_c1 3300050490 Bacteria 1070
239 nmdc:mga03n38_496815_c1 3300050490 Bacteria 684
240 nmdc:mga03n38_636875_c1 3300050490 Bacteria 610
241 nmdc:mga00v17_194417_c1 3300050491 Bacteria 1311
242 nmdc:mga00v17_32858_c1 3300050491 Bacteria 2032
243 nmdc:mga00v17_954900_c1 3300050491 Bacteria 541
244 nmdc:mga0yw44_11758_c1 3300050492 Bacteria 4536
245 nmdc:mga0yw44_1238423_c1 3300050492 Bacteria 503
246 nmdc:mga0yw44_218342_c1 3300050492 Bacteria 1263
247 nmdc:mga0yw44_411358_c1 3300050492 Bacteria 915
248 nmdc:mga0yw44_42325_c1 3300050492 Bacteria 2716
249 nmdc:mga06z11_137651_c1 3300050494 Bacteria 1377
250 nmdc:mga06z11_990783_c1 3300050494 Bacteria 512
251 nmdc:mga07m45_111726_c1 3300050496 Bacteria 1574
252 nmdc:mga07m45_396719_c1 3300050496 Bacteria 801
253 nmdc:mga08y16_953718_c1 3300050511 Bacteria 841
254 nmdc:mga0rr50_1552972_c1 3300050513 Bacteria 559
255 Ga0501084_0089571 3300054114 Bacteria 2583
256 Ga0501084_1395396 3300054114 Bacteria 587
257 Ga0587080_041001 3300059503 Bacteria 844
258 Ga0587083_0058802 3300059505 Bacteria 860
259 Ga0587125_071309 3300059607 Bacteria 525
260 Ga0587069_019257 3300059642 Bacteria 1007
261 Ga0587107_075989 3300059652 Bacteria 622
262 Ga0587110_038362 3300059654 Bacteria 608
263 Ga0501082_0032257 3300060353 Bacteria 4517
264 Ga0070698_100736637
265 JGI24737J22298_10036768
266 JGI24743J22301_10103494
267 Ga0058863_11934220
268 Ga0070658_10004529
269 Ga0070658_11167470
270 Ga0070683_100000126
271 Ga0070690_100428223
272 Ga0070666_10519906
273 Ga0070680_100336191
274 Ga0070682_100029775
275 Ga0068868_100194728
276 Ga0070660_100556760
277 Ga0070660_101144499
278 Ga0070687_100510350
279 Ga0070661_100689125
280 Ga0070692_10008431
281 Ga0070668_100171094
282 Ga0070675_100123187
283 Ga0070671_100561316
284 Ga0070674_100180855
285 Ga0070673_100835160
286 Ga0070667_100014758
287 Ga0070667_100015173
288 Ga0070667_102150943
289 Ga0070678_100190222
290 Ga0070681_10373293
291 Ga0070685_10132193
292 Ga0070698_100042404
293 Ga0070684_100003372
294 Ga0070684_100810140
295 Ga0068853_100113794
296 Ga0070686_100561950
297 Ga0070693_100183166
298 Ga0070665_100002972
299 Ga0070665_100914266
300 Ga0070665_102085948
301 Ga0068855_100029531
302 Ga0068857_100006160
303 Ga0068856_100074819
304 Ga0070702_100005787
305 Ga0068859_101288827
306 Ga0068864_100071883
307 Ga0068860_100262676
308 Ga0075365_10159238
309 Ga0075365_10335251
310 Ga0075368_10538749
311 Ga0075363_100027140
312 Ga0075363_101027758
313 Ga0075364_10097959
314 Ga0075364_10270963
315 Ga0075364_10359621
316 Ga0075364_10827738
317 Ga0075367_10174112
318 Ga0075367_11089579
319 Ga0097621_100504651
320 Ga0097621_102191311
321 Ga0068871_100720894
322 Ga0068865_100034408
323 Ga0097620_101289041
324 Ga0075435_101814234
325 Ga0111539_11211767
326 Ga0111539_11512738
327 Ga0105245_10003456
328 Ga0105245_10353577
329 Ga0105247_10163994
330 Ga0105243_10040241
331 Ga0105243_10324356
332 Ga0105243_11367997
333 Ga0105241_10101427
334 Ga0105242_11061607
335 Ga0105242_11883928
336 Ga0105242_12085312
337 Ga0105248_10358449
338 Ga0105248_11615183
339 Ga0105237_10161378
340 Ga0105238_11730943
341 Ga0105249_10005938
342 Ga0105249_10898794
343 Ga0105239_10006186
344 Ga0105246_10001923
345 Ga0105246_10827011
346 Ga0105246_10995434
347 Ga0105246_11216028
348 Ga0105246_12541134
349 Ga0157322_1025105
350 Ga0157371_10844612
351 Ga0157369_10219764
352 Ga0157369_10840455
353 Ga0157374_10576555
354 Ga0157378_12395970
355 Ga0163162_10016537
356 Ga0163162_11333563
357 Ga0157372_10003081
358 Ga0157375_10219478
359 Ga0157375_10443352
360 Ga0157375_11529481
361 Ga0157375_12649117
362 Ga0157375_13617258
363 Ga0163163_10065398
364 Ga0163163_10280159
365 Ga0163163_11938223
366 Ga0163163_12191662
367 Ga0163163_12642192
368 Ga0157380_10124490
369 Ga0157379_10015464
370 Ga0157379_11696900
371 Ga0157376_10739036
372 Ga0157376_11243057
373 Ga0163161_10505786
374 Ga0163161_10987194
375 Ga0163161_11989680
376 Ga0206356_10566478
377 Ga0206356_10888774
378 Ga0206354_10123209
379 Ga0206353_10500639
380 Ga0207680_10469712
381 Ga0207647_10132447
382 Ga0207647_10153373
383 Ga0207705_10059666
384 Ga0207705_10999727
385 Ga0207654_10191249
386 Ga0207707_10244879
387 Ga0207707_10419655
388 Ga0207671_10209034
389 Ga0207662_10470719
390 Ga0207657_10479950
391 Ga0207649_10069731
392 Ga0207652_11166220
393 Ga0207694_11152923
394 Ga0207659_10105572
395 Ga0207687_10033302
396 Ga0207644_10717239
397 Ga0207686_10764563
398 Ga0207709_10065276
399 Ga0207709_11169795
400 Ga0207704_10049821
401 Ga0207711_10199204
402 Ga0207661_10000930
403 Ga0207661_11291552
404 Ga0207667_10053742
405 Ga0207651_10990497
406 Ga0207712_10027301
407 Ga0207712_10978121
408 Ga0207712_11624831
409 Ga0207668_10694748
410 Ga0207658_10201914
411 Ga0207658_10291087
412 Ga0207677_10106224
413 Ga0207677_11299580
414 Ga0207639_10043449
415 Ga0207678_11084066
416 Ga0207702_10040743
417 Ga0207676_10174633
418 Ga0207674_10001114
419 Ga0207675_102510087
420 Ga0207683_10956214
421 Ga0207428_10501491
422 Ga0268266_10001783
423 Ga0268266_10183674
424 Ga0268266_10190103
425 Ga0268264_10004375
426 Ga0268264_10057226
427 Ga0268264_11513441
428 Ga0307405_10535491
429 Ga0307409_102064830
430 Ga0451787_555676
431 Ga0451791_1190777
432 Ga0451793_1918295
433 Ga0451802_1138399
434 Ga0451802_2089049
435 Ga0451839_1043069
436 Ga0451843_1078008
437 Ga0451855_0544137
438 Ga0439459_0144617
439 Ga0466963_0656857
440 Ga0451576_0168187
441 Ga0466967_0024530
442 Ga0466967_0284728
443 Ga0466967_0684500
444 Ga0495640_0082939
445 Ga0495658_0113003
446 Ga0495680_0106278
447 Ga0495593_0652688
448 Ga0496102_0009434
449 Ga0496103_0121769
450 Ga0496103_0372914
451 Ga0496104_0003531
452 Ga0496105_0094601
453 Ga0496107_0095628
454 Ga0496108_0040204
455 Ga0496108_0218123
456 Ga0496108_1106381
457 Ga0496109_0043549
458 Ga0496109_0092522
459 Ga0496109_0467919
460 Ga0496109_0700000
461 Ga0496109_1034777
462 Ga0496109_2060071
463 Ga0496110_0008572
464 Ga0496110_0376500
465 Ga0496110_0839065
466 Ga0496111_0008843
467 Ga0496111_0538938
468 Ga0496112_1815013
469 Ga0496113_1057230
470 Ga0496114_0041331
471 Ga0496115_0011931
472 Ga0501034_0102860
473 Ga0501036_0046793
474 Ga0501037_0694807
475 Ga0501039_0038069
476 Ga0501040_0191379
477 Ga0501042_0233789
478 Ga0501043_0386378
479 Ga0501047_0842834
480 Ga0501067_0013663
481 Ga0501068_0013154
482 Ga0501069_0355740
483 Ga0501070_0007277
484 Ga0501070_0057224
485 Ga0501071_0241471
486 Ga0501072_0024290
487 Ga0501072_0137135
488 Ga0501073_0010381
489 Ga0501074_0019875
490 Ga0501075_0193994
491 Ga0501076_0619276
492 Ga0501077_0012411
493 Ga0501079_0024539
494 Ga0501079_1626182
495 Ga0501080_0030549
496 Ga0501081_0982733
497 Ga0501083_0005692
498 Ga0501083_0844672
499 Ga0501035_0356594
500 nmdc:mga03n38_105091_c1
501 nmdc:mga03n38_184882_c1
502 nmdc:mga03n38_496815_c1
503 nmdc:mga03n38_636875_c1
504 nmdc:mga00v17_194417_c1
505 nmdc:mga00v17_32858_c1
506 nmdc:mga00v17_954900_c1
507 nmdc:mga0yw44_11758_c1
508 nmdc:mga0yw44_1238423_c1
509 nmdc:mga0yw44_218342_c1
510 nmdc:mga0yw44_411358_c1
511 nmdc:mga0yw44_42325_c1
512 nmdc:mga06z11_137651_c1
513 nmdc:mga06z11_990783_c1
514 nmdc:mga07m45_111726_c1
515 nmdc:mga07m45_396719_c1
516 nmdc:mga08y16_953718_c1
517 nmdc:mga0rr50_1552972_c1
518 Ga0501084_0089571
519 Ga0501084_1395396
520 Ga0587080_041001
521 Ga0587083_0058802
522 Ga0587125_071309
523 Ga0587069_019257
524 Ga0587107_075989
525 Ga0587110_038362
526 Ga0501082_0032257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04964

Flp_Fap

Flp/Fap pilin component

17

62

0.93

Map