F376794

General Info

Members Datasets Scaffolds Average Seq Length
270 161 540 385

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100015240|Ga0070698_1000152403
Length 413
Sequence MAASGAVCLEAQAGNQAFDERRPVKFMLNDSQVLAIRKRFPVLANKIYLNSCSQGALSDAVEDGLREYVASWHEHGSPWDIWVEQYEAARAQFAGLIGATAAEVAILPYASAGINSVASALGFDQRKKVVLGEFEFPTMGHVWLAQQKRGAHVEFVSAVGDRIPTAGYERAIDRNTVIVPVTGVCFMNGFRSAVADIVRLARANGALVMLDDYQDCGTRPVNVRAADLDFYVTGTLKYLLGPPGLAFLYVRRELIESLQPTITGWFAQADPFAFDVKHLDRASSARRFEAGSPPVPNIYAAMRGIGLLQEIGLENISAHIANLVRVLLTGIQELGVRAKTPPDSVGPLCVLQCRHADALVQKLSASGIVCSSRRDGLRLSFHVYNTLGDVQRVLQVLEENLNLLSTCATLRAD

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.04
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 23.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100015240 3300005471 Bacteria 8129
2 JGI24751J29686_10007041 3300002459 Unclassified 2297
3 Ga0070683_100003343 3300005329 Bacteria 12979
4 Ga0070683_100024959 3300005329 Bacteria 5361
5 Ga0070683_100043669 3300005329 Bacteria 4131
6 Ga0070670_100001545 3300005331 Bacteria 18559
7 Ga0070670_100229182 3300005331 Unclassified 1617
8 Ga0068869_100016370 3300005334 Bacteria 4996
9 Ga0070666_10020257 3300005335 Bacteria 4299
10 Ga0070680_100051993 3300005336 Bacteria 3344
11 Ga0068868_100053384 3300005338 Bacteria 3184
12 Ga0070689_100006261 3300005340 Bacteria 8215
13 Ga0070661_100000662 3300005344 Bacteria 25322
14 Ga0070675_100156861 3300005354 Bacteria 1955
15 Ga0070674_100042906 3300005356 Bacteria 3075
16 Ga0070673_100052620 3300005364 Unclassified 3196
17 Ga0070688_100048553 3300005365 Unclassified 2638
18 Ga0070667_100026162 3300005367 Bacteria 4853
19 Ga0070709_10001290 3300005434 Bacteria 13693
20 Ga0070709_10066007 3300005434 Unclassified 2319
21 Ga0070709_10089274 3300005434 Bacteria 2029
22 Ga0070709_10157806 3300005434 Unclassified 1574
23 Ga0070714_100000065 3300005435 Bacteria 96459
24 Ga0070714_100014254 3300005435 Bacteria 6383
25 Ga0070714_100083810 3300005435 Bacteria 2781
26 Ga0070713_100006798 3300005436 Bacteria 7969
27 Ga0070713_100007178 3300005436 Bacteria 7796
28 Ga0070713_100035582 3300005436 Unclassified 4010
29 Ga0070713_100073220 3300005436 Bacteria 2899
30 Ga0070713_100088100 3300005436 Unclassified 2664
31 Ga0070710_10048925 3300005437 Unclassified 2363
32 Ga0070710_10049113 3300005437 Unclassified 2359
33 Ga0070711_100001160 3300005439 Bacteria 14179
34 Ga0070711_100002001 3300005439 Bacteria 11472
35 Ga0070711_100004773 3300005439 Bacteria 8031
36 Ga0070711_100007579 3300005439 Bacteria 6603
37 Ga0070711_100012182 3300005439 Bacteria 5368
38 Ga0070705_100087270 3300005440 Bacteria 1933
39 Ga0070694_100016205 3300005444 Bacteria 4691
40 Ga0070708_100001107 3300005445 Bacteria 20564
41 Ga0070708_100006427 3300005445 Bacteria 9357
42 Ga0070708_100153117 3300005445 Bacteria 2145
43 Ga0070663_100000715 3300005455 Bacteria 17884
44 Ga0070662_100009110 3300005457 Bacteria 6480
45 Ga0070662_100011719 3300005457 Bacteria 5788
46 Ga0068867_100007850 3300005459 Bacteria 7542
47 Ga0070685_10008314 3300005466 Bacteria 5326
48 Ga0070706_100005169 3300005467 Bacteria 12456
49 Ga0070706_100104372 3300005467 Unclassified 2636
50 Ga0070706_100146412 3300005467 Bacteria 2206
51 Ga0070707_100001217 3300005468 Bacteria 25310
52 Ga0070707_100004167 3300005468 Bacteria 13544
53 Ga0070707_100005113 3300005468 Bacteria 12298
54 Ga0070707_100022885 3300005468 Bacteria 5908
55 Ga0070707_100251168 3300005468 Bacteria 1721
56 Ga0070698_100004724 3300005471 Bacteria 14959
57 Ga0070698_100007550 3300005471 Bacteria 11758
58 Ga0070698_100072275 3300005471 Bacteria 3458
59 Ga0070698_100183866 3300005471 Bacteria 2028
60 Ga0070699_100001125 3300005518 Bacteria 24919
61 Ga0070699_100013964 3300005518 Bacteria 6908
62 Ga0070699_100066220 3300005518 Unclassified 3135
63 Ga0070679_100012905 3300005530 Bacteria 8000
64 Ga0070684_100003638 3300005535 Bacteria 11614
65 Ga0070684_100031069 3300005535 Bacteria 4544
66 Ga0070697_100000920 3300005536 Bacteria 22158
67 Ga0070697_100012048 3300005536 Bacteria 6768
68 Ga0068853_100030781 3300005539 Bacteria 4534
69 Ga0070672_100000721 3300005543 Bacteria 19582
70 Ga0070696_100020387 3300005546 Bacteria 4494
71 Ga0070665_100065831 3300005548 Bacteria 3634
72 Ga0070664_100008939 3300005564 Bacteria 8121
73 Ga0068857_100001085 3300005577 Bacteria 21090
74 Ga0068857_100119887 3300005577 Bacteria 2368
75 Ga0068852_100038350 3300005616 Bacteria 4026
76 Ga0068859_100085714 3300005617 Unclassified 3196
77 Ga0068864_100001258 3300005618 Bacteria 21066
78 Ga0068851_10058964 3300005834 Bacteria 1963
79 Ga0068851_10081273 3300005834 Unclassified 1693
80 Ga0068870_10008155 3300005840 Bacteria 4697
81 Ga0068863_100000791 3300005841 Bacteria 31794
82 Ga0068858_100072477 3300005842 Unclassified 3196
83 Ga0068860_100112928 3300005843 Unclassified 2598
84 Ga0070717_10005114 3300006028 Bacteria 9569
85 Ga0070717_10007152 3300006028 Bacteria 8272
86 Ga0070717_10083897 3300006028 Unclassified 2680
87 Ga0070717_10133678 3300006028 Unclassified 2135
88 Ga0070715_10027562 3300006163 Bacteria 2271
89 Ga0070715_10031540 3300006163 Bacteria 2152
90 Ga0070716_100000639 3300006173 Bacteria 14880
91 Ga0070716_100016373 3300006173 Bacteria 3825
92 Ga0070716_100118232 3300006173 Unclassified 1654
93 Ga0070712_100002509 3300006175 Bacteria 11315
94 Ga0070712_100006631 3300006175 Bacteria 7196
95 Ga0070712_100021323 3300006175 Unclassified 4254
96 Ga0070712_100037004 3300006175 Unclassified 3324
97 Ga0070712_100074863 3300006175 Bacteria 2434
98 Ga0097621_100048749 3300006237 Bacteria 3438
99 Ga0075434_100002176 3300006871 Bacteria 17084
100 Ga0075436_100040578 3300006914 Bacteria 3211
101 Ga0097620_100085716 3300006931 Unclassified 3196
102 Ga0075435_100036215 3300007076 Bacteria 3920
103 Ga0105240_10151882 3300009093 Bacteria 2757
104 Ga0105245_10049382 3300009098 Bacteria 3768
105 Ga0105247_10039075 3300009101 Bacteria 2899
106 Ga0105241_10017450 3300009174 Bacteria 5277
107 Ga0105248_10025145 3300009177 Bacteria 6619
108 Ga0105248_10041246 3300009177 Bacteria 5174
109 Ga0105248_10164910 3300009177 Unclassified 2498
110 Ga0105248_10226081 3300009177 Unclassified 2106
111 Ga0105237_10134797 3300009545 Unclassified 2464
112 Ga0105237_10190686 3300009545 Bacteria 2050
113 Ga0105238_10045932 3300009551 Bacteria 4411
114 Ga0105238_10062000 3300009551 Bacteria 3741
115 Ga0105238_10121924 3300009551 Unclassified 2586
116 Ga0105249_10356452 3300009553 Unclassified 1483
117 Ga0105239_10068514 3300010375 Bacteria 3899
118 Ga0105246_10165028 3300011119 Bacteria 1691
119 Ga0157373_10024682 3300013100 Bacteria 4354
120 Ga0157369_10010722 3300013105 Bacteria 10429
121 Ga0157369_10238549 3300013105 Unclassified 1899
122 Ga0157369_10345590 3300013105 Bacteria 1545
123 Ga0157374_10028239 3300013296 Bacteria 5068
124 Ga0157374_10231483 3300013296 Unclassified 1815
125 Ga0157378_10031777 3300013297 Unclassified 4663
126 Ga0157378_10152074 3300013297 Bacteria 2157
127 Ga0163162_10106975 3300013306 Bacteria 2892
128 Ga0163162_10141576 3300013306 Bacteria 2519
129 Ga0157375_10029744 3300013308 Bacteria 5141
130 Ga0163163_10000910 3300014325 Bacteria 25074
131 Ga0163163_10141264 3300014325 Bacteria 2450
132 Ga0163163_10167329 3300014325 Unclassified 2245
133 Ga0163163_10182300 3300014325 Bacteria 2147
134 Ga0157377_10013046 3300014745 Unclassified 4196
135 Ga0157379_10012586 3300014968 Bacteria 7389
136 Ga0157379_10021863 3300014968 Bacteria 5667
137 Ga0157376_10165362 3300014969 Bacteria 2010
138 Ga0157376_10438418 3300014969 Unclassified 1271
139 Ga0213875_10000780 3300021388 Bacteria 23789
140 Ga0228598_1000626 3300024227 Bacteria 7429
141 Ga0207699_10011457 3300025906 Unclassified 4479
142 Ga0207699_10025655 3300025906 Eukaryota 3238
143 Ga0207699_10061365 3300025906 Bacteria 2261
144 Ga0207699_10148594 3300025906 Bacteria 1548
145 Ga0207645_10003992 3300025907 Bacteria 11002
146 Ga0207643_10002899 3300025908 Bacteria 9265
147 Ga0207684_10000542 3300025910 Bacteria 46478
148 Ga0207684_10013136 3300025910 Bacteria 7169
149 Ga0207654_10022094 3300025911 Bacteria 3390
150 Ga0207707_10011412 3300025912 Bacteria 7738
151 Ga0207671_10021680 3300025914 Bacteria 4869
152 Ga0207693_10000489 3300025915 Bacteria 35827
153 Ga0207693_10002037 3300025915 Bacteria 17725
154 Ga0207693_10002323 3300025915 Bacteria 16524
155 Ga0207693_10003126 3300025915 Bacteria 14255
156 Ga0207693_10064990 3300025915 Bacteria 2857
157 Ga0207663_10001046 3300025916 Bacteria 12703
158 Ga0207663_10004310 3300025916 Bacteria 7063
159 Ga0207663_10022296 3300025916 Unclassified 3618
160 Ga0207663_10207596 3300025916 Unclassified 1417
161 Ga0207662_10141854 3300025918 Unclassified 1522
162 Ga0207657_10005266 3300025919 Bacteria 13549
163 Ga0207649_10000745 3300025920 Bacteria 21385
164 Ga0207646_10000424 3300025922 Bacteria 56486
165 Ga0207646_10003553 3300025922 Bacteria 17515
166 Ga0207646_10040370 3300025922 Bacteria 4196
167 Ga0207646_10179371 3300025922 Bacteria 1913
168 Ga0207646_10222582 3300025922 Bacteria 1705
169 Ga0207694_10028784 3300025924 Unclassified 4237
170 Ga0207650_10000252 3300025925 Bacteria 58117
171 Ga0207659_10019189 3300025926 Unclassified 4495
172 Ga0207700_10001441 3300025928 Bacteria 13496
173 Ga0207700_10002332 3300025928 Bacteria 10880
174 Ga0207700_10014608 3300025928 Bacteria 5151
175 Ga0207700_10113175 3300025928 Unclassified 2187
176 Ga0207664_10000532 3300025929 Bacteria 27088
177 Ga0207664_10007614 3300025929 Bacteria 7513
178 Ga0207664_10009183 3300025929 Bacteria 6928
179 Ga0207664_10063729 3300025929 Bacteria 2947
180 Ga0207644_10024828 3300025931 Bacteria 4117
181 Ga0207644_10059050 3300025931 Unclassified 2773
182 Ga0207665_10000199 3300025939 Bacteria 40137
183 Ga0207665_10001373 3300025939 Bacteria 16408
184 Ga0207665_10027846 3300025939 Bacteria 3733
185 Ga0207691_10000160 3300025940 Bacteria 63013
186 Ga0207711_10040345 3300025941 Bacteria 3971
187 Ga0207661_10000377 3300025944 Bacteria 28639
188 Ga0207661_10008613 3300025944 Bacteria 7288
189 Ga0207661_10074310 3300025944 Bacteria 2786
190 Ga0207679_10000039 3300025945 Bacteria 127661
191 Ga0207679_10076164 3300025945 Bacteria 2548
192 Ga0207651_10016539 3300025960 Unclassified 4324
193 Ga0207658_10007601 3300025986 Bacteria 7382
194 Ga0207658_10013611 3300025986 Bacteria 5564
195 Ga0207677_10035673 3300026023 Bacteria 3233
196 Ga0207677_10176967 3300026023 Unclassified 1674
197 Ga0207703_10043092 3300026035 Unclassified 3621
198 Ga0207703_10117608 3300026035 Bacteria 2277
199 Ga0207639_10050683 3300026041 Unclassified 3154
200 Ga0207678_10041756 3300026067 Bacteria 3976
201 Ga0207702_10038011 3300026078 Bacteria 4032
202 Ga0207641_10000025 3300026088 Bacteria 247727
203 Ga0207648_10014248 3300026089 Bacteria 7352
204 Ga0207676_10000104 3300026095 Bacteria 74872
205 Ga0207674_10004015 3300026116 Bacteria 17868
206 Ga0207674_10118299 3300026116 Bacteria 2620
207 Ga0207698_10178940 3300026142 Unclassified 1876
208 Ga0268266_10010354 3300028379 Bacteria 8157
209 Ga0268266_10040816 3300028379 Bacteria 3956
210 Ga0268265_10027356 3300028380 Bacteria 4069
211 Ga0268264_10044365 3300028381 Bacteria 3688
212 Ga0268264_10064947 3300028381 Unclassified 3073
213 Ga0307515_10028572 3300028794 Bacteria 9475
214 Ga0265770_1005909 3300030878 Bacteria 1692
215 Ga0265760_10000025 3300031090 Bacteria 64249
216 Ga0265760_10011104 3300031090 Bacteria 2572
217 Ga0265339_10015690 3300031249 Bacteria 4535
218 Ga0265316_10021888 3300031344 Bacteria 5404
219 Ga0265314_10034884 3300031711 Bacteria 3671
220 Ga0373944_0055020 3300035089 Unclassified 1263
221 Ga0373923_0087133 3300035111 Unclassified 1361
222 Ga0373936_0000390 3300035113 Bacteria 14909
223 Ga0373954_0003568 3300035118 Bacteria 6613
224 Ga0373956_0006456 3300035119 Unclassified 4702
225 Ga0373943_0000092 3300035170 Bacteria 33178
226 Ga0373935_0001269 3300035692 Bacteria 13918
227 Ga0373927_0000056 3300035695 Bacteria 81041
228 Ga0373947_0000369 3300035725 Bacteria 25404
229 Ga0373937_0063332 3300036401 Bacteria 3401
230 Ga0373925_0003309 3300037068 Bacteria 12522
231 Ga0436364_0202263 3300037853 Bacteria 63132
232 Ga0439446_0003166 3300042156 Bacteria 4054
233 Ga0453683_0007350 3300044673 Bacteria 7481
234 Ga0453683_0047534 3300044673 Bacteria 2691
235 Ga0453684_0022379 3300044712 Bacteria 9380
236 Ga0453684_0152104 3300044712 Unclassified 2748
237 Ga0451576_0176130 3300045051 Unclassified 2233
238 Ga0495580_0000182 3300046472 Bacteria 47252
239 Ga0495580_0004940 3300046472 Bacteria 11145
240 Ga0495580_0019927 3300046472 Unclassified 4973
241 Ga0495580_0155648 3300046472 Bacteria 1583
242 Ga0495630_0070216 3300046517 Bacteria 2635
243 Ga0495674_0022260 3300047319 Bacteria 5845
244 Ga0495674_0053006 3300047319 Unclassified 3568
245 Ga0495674_0059271 3300047319 Unclassified 3344
246 Ga0496100_0020730 3300048903 Bacteria 3947
247 Ga0496102_0001589 3300048905 Bacteria 20046
248 Ga0496102_0118913 3300048905 Unclassified 2467
249 Ga0496102_0345934 3300048905 Unclassified 1400
250 Ga0496103_0049329 3300048906 Bacteria 2603
251 Ga0496104_0091915 3300048907 Unclassified 2901
252 Ga0496104_0203413 3300048907 Unclassified 1892
253 Ga0496106_0039959 3300048909 Unclassified 3512
254 Ga0496106_0268145 3300048909 Bacteria 1367
255 Ga0496107_0065546 3300048910 Bacteria 2633
256 Ga0496108_0009445 3300048911 Bacteria 7900
257 Ga0496109_0000072 3300048912 Bacteria 107549
258 Ga0496109_0081312 3300048912 Unclassified 2985
259 Ga0496110_0000790 3300048913 Bacteria 22100
260 Ga0496111_0022019 3300048914 Bacteria 4457
261 Ga0496112_0000043 3300048915 Bacteria 87684
262 Ga0496113_0082721 3300048916 Unclassified 2462
263 Ga0496115_0028291 3300048918 Unclassified 4392
264 Ga0496115_0272814 3300048918 Bacteria 1389
265 nmdc:mga0n895_2312_c1 3300050512 Bacteria 14831
266 nmdc:mga0rr50_28384_c1 3300050513 Bacteria 3933
267 nmdc:mga08x19_74685_c1 3300050514 Bacteria 2215
268 Ga0590071_009030 3300059421 Bacteria 2343
269 Ga0590075_003675 3300059424 Bacteria 3640
270 Ga0590077_000076 3300059426 Bacteria 24905
271 Ga0070698_100015240
272 JGI24751J29686_10007041
273 Ga0070683_100003343
274 Ga0070683_100024959
275 Ga0070683_100043669
276 Ga0070670_100001545
277 Ga0070670_100229182
278 Ga0068869_100016370
279 Ga0070666_10020257
280 Ga0070680_100051993
281 Ga0068868_100053384
282 Ga0070689_100006261
283 Ga0070661_100000662
284 Ga0070675_100156861
285 Ga0070674_100042906
286 Ga0070673_100052620
287 Ga0070688_100048553
288 Ga0070667_100026162
289 Ga0070709_10001290
290 Ga0070709_10066007
291 Ga0070709_10089274
292 Ga0070709_10157806
293 Ga0070714_100000065
294 Ga0070714_100014254
295 Ga0070714_100083810
296 Ga0070713_100006798
297 Ga0070713_100007178
298 Ga0070713_100035582
299 Ga0070713_100073220
300 Ga0070713_100088100
301 Ga0070710_10048925
302 Ga0070710_10049113
303 Ga0070711_100001160
304 Ga0070711_100002001
305 Ga0070711_100004773
306 Ga0070711_100007579
307 Ga0070711_100012182
308 Ga0070705_100087270
309 Ga0070694_100016205
310 Ga0070708_100001107
311 Ga0070708_100006427
312 Ga0070708_100153117
313 Ga0070663_100000715
314 Ga0070662_100009110
315 Ga0070662_100011719
316 Ga0068867_100007850
317 Ga0070685_10008314
318 Ga0070706_100005169
319 Ga0070706_100104372
320 Ga0070706_100146412
321 Ga0070707_100001217
322 Ga0070707_100004167
323 Ga0070707_100005113
324 Ga0070707_100022885
325 Ga0070707_100251168
326 Ga0070698_100004724
327 Ga0070698_100007550
328 Ga0070698_100072275
329 Ga0070698_100183866
330 Ga0070699_100001125
331 Ga0070699_100013964
332 Ga0070699_100066220
333 Ga0070679_100012905
334 Ga0070684_100003638
335 Ga0070684_100031069
336 Ga0070697_100000920
337 Ga0070697_100012048
338 Ga0068853_100030781
339 Ga0070672_100000721
340 Ga0070696_100020387
341 Ga0070665_100065831
342 Ga0070664_100008939
343 Ga0068857_100001085
344 Ga0068857_100119887
345 Ga0068852_100038350
346 Ga0068859_100085714
347 Ga0068864_100001258
348 Ga0068851_10058964
349 Ga0068851_10081273
350 Ga0068870_10008155
351 Ga0068863_100000791
352 Ga0068858_100072477
353 Ga0068860_100112928
354 Ga0070717_10005114
355 Ga0070717_10007152
356 Ga0070717_10083897
357 Ga0070717_10133678
358 Ga0070715_10027562
359 Ga0070715_10031540
360 Ga0070716_100000639
361 Ga0070716_100016373
362 Ga0070716_100118232
363 Ga0070712_100002509
364 Ga0070712_100006631
365 Ga0070712_100021323
366 Ga0070712_100037004
367 Ga0070712_100074863
368 Ga0097621_100048749
369 Ga0075434_100002176
370 Ga0075436_100040578
371 Ga0097620_100085716
372 Ga0075435_100036215
373 Ga0105240_10151882
374 Ga0105245_10049382
375 Ga0105247_10039075
376 Ga0105241_10017450
377 Ga0105248_10025145
378 Ga0105248_10041246
379 Ga0105248_10164910
380 Ga0105248_10226081
381 Ga0105237_10134797
382 Ga0105237_10190686
383 Ga0105238_10045932
384 Ga0105238_10062000
385 Ga0105238_10121924
386 Ga0105249_10356452
387 Ga0105239_10068514
388 Ga0105246_10165028
389 Ga0157373_10024682
390 Ga0157369_10010722
391 Ga0157369_10238549
392 Ga0157369_10345590
393 Ga0157374_10028239
394 Ga0157374_10231483
395 Ga0157378_10031777
396 Ga0157378_10152074
397 Ga0163162_10106975
398 Ga0163162_10141576
399 Ga0157375_10029744
400 Ga0163163_10000910
401 Ga0163163_10141264
402 Ga0163163_10167329
403 Ga0163163_10182300
404 Ga0157377_10013046
405 Ga0157379_10012586
406 Ga0157379_10021863
407 Ga0157376_10165362
408 Ga0157376_10438418
409 Ga0213875_10000780
410 Ga0228598_1000626
411 Ga0207699_10011457
412 Ga0207699_10025655
413 Ga0207699_10061365
414 Ga0207699_10148594
415 Ga0207645_10003992
416 Ga0207643_10002899
417 Ga0207684_10000542
418 Ga0207684_10013136
419 Ga0207654_10022094
420 Ga0207707_10011412
421 Ga0207671_10021680
422 Ga0207693_10000489
423 Ga0207693_10002037
424 Ga0207693_10002323
425 Ga0207693_10003126
426 Ga0207693_10064990
427 Ga0207663_10001046
428 Ga0207663_10004310
429 Ga0207663_10022296
430 Ga0207663_10207596
431 Ga0207662_10141854
432 Ga0207657_10005266
433 Ga0207649_10000745
434 Ga0207646_10000424
435 Ga0207646_10003553
436 Ga0207646_10040370
437 Ga0207646_10179371
438 Ga0207646_10222582
439 Ga0207694_10028784
440 Ga0207650_10000252
441 Ga0207659_10019189
442 Ga0207700_10001441
443 Ga0207700_10002332
444 Ga0207700_10014608
445 Ga0207700_10113175
446 Ga0207664_10000532
447 Ga0207664_10007614
448 Ga0207664_10009183
449 Ga0207664_10063729
450 Ga0207644_10024828
451 Ga0207644_10059050
452 Ga0207665_10000199
453 Ga0207665_10001373
454 Ga0207665_10027846
455 Ga0207691_10000160
456 Ga0207711_10040345
457 Ga0207661_10000377
458 Ga0207661_10008613
459 Ga0207661_10074310
460 Ga0207679_10000039
461 Ga0207679_10076164
462 Ga0207651_10016539
463 Ga0207658_10007601
464 Ga0207658_10013611
465 Ga0207677_10035673
466 Ga0207677_10176967
467 Ga0207703_10043092
468 Ga0207703_10117608
469 Ga0207639_10050683
470 Ga0207678_10041756
471 Ga0207702_10038011
472 Ga0207641_10000025
473 Ga0207648_10014248
474 Ga0207676_10000104
475 Ga0207674_10004015
476 Ga0207674_10118299
477 Ga0207698_10178940
478 Ga0268266_10010354
479 Ga0268266_10040816
480 Ga0268265_10027356
481 Ga0268264_10044365
482 Ga0268264_10064947
483 Ga0307515_10028572
484 Ga0265770_1005909
485 Ga0265760_10000025
486 Ga0265760_10011104
487 Ga0265339_10015690
488 Ga0265316_10021888
489 Ga0265314_10034884
490 Ga0373944_0055020
491 Ga0373923_0087133
492 Ga0373936_0000390
493 Ga0373954_0003568
494 Ga0373956_0006456
495 Ga0373943_0000092
496 Ga0373935_0001269
497 Ga0373927_0000056
498 Ga0373947_0000369
499 Ga0373937_0063332
500 Ga0373925_0003309
501 Ga0436364_0202263
502 Ga0439446_0003166
503 Ga0453683_0007350
504 Ga0453683_0047534
505 Ga0453684_0022379
506 Ga0453684_0152104
507 Ga0451576_0176130
508 Ga0495580_0000182
509 Ga0495580_0004940
510 Ga0495580_0019927
511 Ga0495580_0155648
512 Ga0495630_0070216
513 Ga0495674_0022260
514 Ga0495674_0053006
515 Ga0495674_0059271
516 Ga0496100_0020730
517 Ga0496102_0001589
518 Ga0496102_0118913
519 Ga0496102_0345934
520 Ga0496103_0049329
521 Ga0496104_0091915
522 Ga0496104_0203413
523 Ga0496106_0039959
524 Ga0496106_0268145
525 Ga0496107_0065546
526 Ga0496108_0009445
527 Ga0496109_0000072
528 Ga0496109_0081312
529 Ga0496110_0000790
530 Ga0496111_0022019
531 Ga0496112_0000043
532 Ga0496113_0082721
533 Ga0496115_0028291
534 Ga0496115_0272814
535 nmdc:mga0n895_2312_c1
536 nmdc:mga0rr50_28384_c1
537 nmdc:mga08x19_74685_c1
538 Ga0590071_009030
539 Ga0590075_003675
540 Ga0590077_000076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

53

393

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1elu-assembly1.cif.gz_B complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. 0.9115 12 368
1n2t-assembly1.cif.gz_B c-des mutant k223a with gly covalenty linked to the plp-cofactor 0.9035 9 368
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.8983 4 374
6c9e-assembly1.cif.gz_A crystal structure of cysteine desulfurase from legionella pneumophila philadelphia 1 0.897 2 374
6o11-assembly1.cif.gz_A-2 e. coli cysteine desulfurase sufs c364a with a cys-aldimine intermediate 0.896 1 374
ID Description Score Start End Superfamily
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9245 33 276 3.40.640.10
1elqB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.899 31 282 3.40.640.10
af_Q60358_310_394_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8966 290 372 3.90.1150.10
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8932 33 276 3.40.640.10
1qz9A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8912 283 374 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A2N9MAW8-F1-model_v4 Aminotransferase class V 0.9827 38 379 GO:0008483
AF-A0A2N9MAW8-F1-model_v4 Aminotransferase class V 0.977 38 379 GO:0008483
AF-A0A4V3EWF5-F1-model_v4 deleted 0.9768 4 378
AF-B8KTX9-F1-model_v4 Aminotransferase, class V 0.9757 4 379 GO:0008483
AF-A0A535AV81-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9739 121 379 GO:0008483

Map