F376773

General Info

Members Datasets Scaffolds Average Seq Length
270 163 540 202

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100423998|Ga0070694_1004239981
Length 216
Sequence MSRRKVDQMATPSWKVSGQYYETCSCDFVCPCLPAGLTARPSKGSCTFAMAFSVDRGSYGALSLDGLGFIVLGFTPEEMGKGNWSVGLIADNRATAEQRDAIAAIASGAAGGPMAALSGLVGKFLGVESAPIQFDRRGVNWSVKASGFVDMAAEGVRGLNPNSSEPIHLDHTGHPAADRFALARASSSRVQALGLAWEDLSGKNNGQYAPFSWGNA

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.37
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.22
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 21.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100423998 3300005444 Unclassified 1046
2 MBSR1b_contig_9745715 2162886012 Unclassified 870
3 Ga0065715_10138738 3300005293 Bacteria 1887
4 Ga0070670_100087741 3300005331 Bacteria 2674
5 Ga0068869_100021592 3300005334 Bacteria 4430
6 Ga0070682_100179066 3300005337 Bacteria 1479
7 Ga0068868_100367622 3300005338 Unclassified 1235
8 Ga0070689_100130728 3300005340 Bacteria 2013
9 Ga0070687_100123593 3300005343 Bacteria 1484
10 Ga0070692_10310288 3300005345 Unclassified 966
11 Ga0070669_100013696 3300005353 Bacteria 5765
12 Ga0070669_100038309 3300005353 Bacteria 3480
13 Ga0070669_100519112 3300005353 Bacteria 990
14 Ga0070675_100000464 3300005354 Bacteria 27701
15 Ga0070675_100026686 3300005354 Bacteria 4635
16 Ga0070675_100105428 3300005354 Bacteria 2378
17 Ga0070674_100039859 3300005356 Bacteria 3175
18 Ga0070673_100042519 3300005364 Bacteria 3504
19 Ga0070673_100121104 3300005364 Bacteria 2183
20 Ga0070688_100477133 3300005365 Bacteria 937
21 Ga0070688_100582629 3300005365 Unclassified 854
22 Ga0070659_100664400 3300005366 Bacteria 899
23 Ga0070701_10023773 3300005438 Bacteria 2956
24 Ga0070705_100089590 3300005440 Bacteria 1913
25 Ga0070705_100428306 3300005440 Bacteria 987
26 Ga0070700_100014876 3300005441 Bacteria 4399
27 Ga0070700_100272209 3300005441 Bacteria 1224
28 Ga0070700_100373125 3300005441 Bacteria 1065
29 Ga0070694_100226084 3300005444 Bacteria 1406
30 Ga0070694_100387708 3300005444 Bacteria 1091
31 Ga0070708_100371210 3300005445 Bacteria 1349
32 Ga0070708_100666193 3300005445 Unclassified 980
33 Ga0070678_100136031 3300005456 Bacteria 1960
34 Ga0070678_100215808 3300005456 Unclassified 1592
35 Ga0068867_100006079 3300005459 Bacteria 8556
36 Ga0068867_100452089 3300005459 Bacteria 1095
37 Ga0070685_10606551 3300005466 Unclassified 788
38 Ga0070707_100064132 3300005468 Bacteria 3527
39 Ga0070707_100388054 3300005468 Unclassified 1356
40 Ga0070698_100539936 3300005471 Bacteria 1105
41 Ga0070699_100005837 3300005518 Bacteria 10760
42 Ga0070672_100033848 3300005543 Bacteria 3873
43 Ga0070672_100058765 3300005543 Bacteria 3024
44 Ga0070672_100066992 3300005543 Bacteria 2844
45 Ga0070672_100189102 3300005543 Unclassified 1718
46 Ga0070686_100068914 3300005544 Bacteria 2309
47 Ga0070686_100593274 3300005544 Unclassified 872
48 Ga0070695_100018480 3300005545 Bacteria 4234
49 Ga0070695_100418327 3300005545 Bacteria 1020
50 Ga0070696_100023657 3300005546 Bacteria 4176
51 Ga0070696_100086322 3300005546 Bacteria 2228
52 Ga0070696_100585698 3300005546 Unclassified 898
53 Ga0070704_100279693 3300005549 Unclassified 1382
54 Ga0070664_100174104 3300005564 Bacteria 1910
55 Ga0068854_100159604 3300005578 Bacteria 1745
56 Ga0068856_100265348 3300005614 Bacteria 1733
57 Ga0070702_100298702 3300005615 Bacteria 1113
58 Ga0068859_100019722 3300005617 Bacteria 6771
59 Ga0068859_100249137 3300005617 Bacteria 1867
60 Ga0068859_101145445 3300005617 Bacteria 856
61 Ga0068864_100079538 3300005618 Bacteria 2870
62 Ga0068864_100147821 3300005618 Unclassified 2126
63 Ga0068866_10016158 3300005718 Bacteria 3331
64 Ga0068861_100019021 3300005719 Bacteria 4901
65 Ga0068861_100055329 3300005719 Bacteria 3025
66 Ga0068861_100241111 3300005719 Unclassified 1537
67 Ga0068861_100246132 3300005719 Bacteria 1523
68 Ga0068861_100662485 3300005719 Bacteria 965
69 Ga0068870_10193396 3300005840 Bacteria 1229
70 Ga0068863_100106400 3300005841 Unclassified 2669
71 Ga0068858_100059648 3300005842 Bacteria 3526
72 Ga0068858_100071750 3300005842 Bacteria 3212
73 Ga0068860_100018662 3300005843 Bacteria 6745
74 Ga0068860_100113342 3300005843 Bacteria 2592
75 Ga0068862_100210904 3300005844 Bacteria 1755
76 Ga0068862_100222429 3300005844 Bacteria 1710
77 Ga0068862_100377694 3300005844 Bacteria 1321
78 Ga0070717_10981091 3300006028 Bacteria 769
79 Ga0070712_100359817 3300006175 Bacteria 1193
80 Ga0097621_100000316 3300006237 Bacteria 32770
81 Ga0097621_100714194 3300006237 Bacteria 924
82 Ga0068871_100001707 3300006358 Bacteria 14766
83 Ga0068871_100074787 3300006358 Bacteria 2795
84 Ga0075428_100447751 3300006844 Bacteria 1383
85 Ga0075431_100008605 3300006847 Bacteria 10219
86 Ga0075431_100565047 3300006847 Bacteria 1124
87 Ga0075433_10054464 3300006852 Unclassified 3490
88 Ga0075434_100002386 3300006871 Bacteria 16491
89 Ga0075434_100405991 3300006871 Bacteria 1383
90 Ga0075429_100009954 3300006880 Bacteria 8239
91 Ga0068865_100004418 3300006881 Bacteria 8478
92 Ga0068865_100112978 3300006881 Bacteria 2007
93 Ga0075436_100266196 3300006914 Bacteria 1223
94 Ga0097620_100019722 3300006931 Bacteria 6771
95 Ga0097620_100249137 3300006931 Bacteria 1867
96 Ga0097620_101145706 3300006931 Bacteria 856
97 Ga0097620_101468160 3300006931 Bacteria 752
98 Ga0075435_100098313 3300007076 Bacteria 2423
99 Ga0075435_100285182 3300007076 Unclassified 1410
100 Ga0111539_10158484 3300009094 Unclassified 2648
101 Ga0111539_10201507 3300009094 Bacteria 2321
102 Ga0111539_10955954 3300009094 Bacteria 996
103 Ga0111539_10970489 3300009094 Bacteria 988
104 Ga0105245_10099336 3300009098 Bacteria 2690
105 Ga0105245_10526061 3300009098 Bacteria 1202
106 Ga0105247_10524501 3300009101 Bacteria 867
107 Ga0114129_10477129 3300009147 Bacteria 1632
108 Ga0114129_11291780 3300009147 Unclassified 905
109 Ga0105243_10093120 3300009148 Bacteria 2486
110 Ga0105248_10324913 3300009177 Bacteria 1733
111 Ga0105249_10714272 3300009553 Bacteria 1063
112 Ga0105246_10043141 3300011119 Bacteria 3059
113 Ga0157370_10094187 3300013104 Bacteria 2810
114 Ga0157378_10904328 3300013297 Bacteria 913
115 Ga0157375_10452371 3300013308 Bacteria 1450
116 Ga0163163_10033516 3300014325 Bacteria 4969
117 Ga0157380_10899343 3300014326 Bacteria 911
118 Ga0157379_10484007 3300014968 Unclassified 1145
119 Ga0157376_10339403 3300014969 Unclassified 1434
120 Ga0157376_11345528 3300014969 Unclassified 745
121 Ga0163161_10262383 3300017792 Unclassified 1349
122 Ga0207697_10160851 3300025315 Unclassified 979
123 Ga0207682_10081804 3300025893 Bacteria 1385
124 Ga0207682_10158498 3300025893 Unclassified 1024
125 Ga0207645_10009220 3300025907 Bacteria 6835
126 Ga0207645_10036669 3300025907 Bacteria 3149
127 Ga0207645_10359852 3300025907 Bacteria 975
128 Ga0207643_10182299 3300025908 Bacteria 1271
129 Ga0207643_10332525 3300025908 Bacteria 951
130 Ga0207660_10391141 3300025917 Bacteria 1119
131 Ga0207662_10170407 3300025918 Bacteria 1396
132 Ga0207646_10049685 3300025922 Bacteria 3756
133 Ga0207646_10216148 3300025922 Bacteria 1731
134 Ga0207681_10031349 3300025923 Bacteria 3471
135 Ga0207681_10230336 3300025923 Bacteria 1438
136 Ga0207681_10823563 3300025923 Unclassified 776
137 Ga0207650_10323489 3300025925 Unclassified 1263
138 Ga0207659_10072220 3300025926 Bacteria 2522
139 Ga0207659_10424326 3300025926 Bacteria 1116
140 Ga0207659_10529876 3300025926 Unclassified 1000
141 Ga0207659_10583219 3300025926 Unclassified 952
142 Ga0207687_10228021 3300025927 Bacteria 1470
143 Ga0207706_10144455 3300025933 Unclassified 2093
144 Ga0207706_10660370 3300025933 Bacteria 895
145 Ga0207686_10009561 3300025934 Bacteria 5259
146 Ga0207686_10213999 3300025934 Unclassified 1387
147 Ga0207686_10503780 3300025934 Bacteria 940
148 Ga0207709_10013547 3300025935 Bacteria 4497
149 Ga0207709_10111663 3300025935 Unclassified 1829
150 Ga0207709_10129755 3300025935 Bacteria 1716
151 Ga0207670_10100404 3300025936 Bacteria 2066
152 Ga0207670_10238800 3300025936 Unclassified 1399
153 Ga0207670_10431482 3300025936 Unclassified 1059
154 Ga0207669_10051225 3300025937 Bacteria 2472
155 Ga0207704_10004686 3300025938 Bacteria 6272
156 Ga0207704_10015084 3300025938 Bacteria 3926
157 Ga0207704_10170620 3300025938 Bacteria 1560
158 Ga0207691_10065007 3300025940 Bacteria 3303
159 Ga0207691_10085782 3300025940 Bacteria 2826
160 Ga0207691_10110789 3300025940 Unclassified 2441
161 Ga0207691_10111884 3300025940 Bacteria 2427
162 Ga0207711_10850493 3300025941 Bacteria 849
163 Ga0207689_10001561 3300025942 Bacteria 21706
164 Ga0207689_10455937 3300025942 Unclassified 1069
165 Ga0207661_10009943 3300025944 Bacteria 6833
166 Ga0207679_10508533 3300025945 Bacteria 1076
167 Ga0207679_10794337 3300025945 Bacteria 863
168 Ga0207651_10011956 3300025960 Bacteria 4884
169 Ga0207651_10063416 3300025960 Bacteria 2580
170 Ga0207712_10522188 3300025961 Unclassified 1018
171 Ga0207668_10056424 3300025972 Bacteria 2736
172 Ga0207640_10169381 3300025981 Bacteria 1626
173 Ga0207658_10425910 3300025986 Bacteria 1171
174 Ga0207703_10010161 3300026035 Bacteria 7378
175 Ga0207703_10072232 3300026035 Bacteria 2852
176 Ga0207708_10023095 3300026075 Bacteria 4698
177 Ga0207708_10230914 3300026075 Bacteria 1485
178 Ga0207708_10340313 3300026075 Unclassified 1228
179 Ga0207702_10323287 3300026078 Bacteria 1470
180 Ga0207641_10817332 3300026088 Bacteria 923
181 Ga0207648_10021328 3300026089 Bacteria 5823
182 Ga0207648_10146641 3300026089 Unclassified 2082
183 Ga0207648_10316709 3300026089 Bacteria 1401
184 Ga0207676_10027223 3300026095 Bacteria 4257
185 Ga0207676_10048156 3300026095 Bacteria 3308
186 Ga0207674_10044977 3300026116 Bacteria 4544
187 Ga0207675_100010616 3300026118 Bacteria 8625
188 Ga0207675_100048179 3300026118 Bacteria 3978
189 Ga0207675_100059846 3300026118 Bacteria 3555
190 Ga0207683_10024683 3300026121 Bacteria 5179
191 Ga0207683_10171242 3300026121 Bacteria 1966
192 Ga0207683_10751117 3300026121 Unclassified 905
193 Ga0209971_1073402 3300027682 Unclassified 831
194 Ga0207428_10098416 3300027907 Bacteria 2263
195 Ga0268265_10322626 3300028380 Bacteria 1399
196 Ga0268265_10415123 3300028380 Unclassified 1248
197 Ga0268264_10007315 3300028381 Bacteria 9231
198 Ga0268264_10735370 3300028381 Unclassified 982
199 Ga0307408_100374648 3300031548 Bacteria 1215
200 Ga0307413_10111081 3300031824 Unclassified 1835
201 Ga0307410_10404664 3300031852 Bacteria 1103
202 Ga0307406_10252029 3300031901 Bacteria 1330
203 Ga0307412_10282580 3300031911 Unclassified 1304
204 Ga0307409_100066244 3300031995 Bacteria 2847
205 Ga0307409_100378438 3300031995 Unclassified 1345
206 Ga0307416_100001608 3300032002 Bacteria 12420
207 Ga0307416_100191423 3300032002 Bacteria 1930
208 Ga0307416_100223790 3300032002 Bacteria 1807
209 Ga0307416_100310378 3300032002 Bacteria 1573
210 Ga0307416_100975331 3300032002 Bacteria 950
211 Ga0307414_10218759 3300032004 Bacteria 1562
212 Ga0307411_10366358 3300032005 Unclassified 1180
213 Ga0307415_100002012 3300032126 Bacteria 10015
214 Ga0307415_100099586 3300032126 Bacteria 2128
215 Ga0373939_0251051 3300035114 Bacteria 688
216 Ga0373960_0067396 3300035121 Bacteria 1099
217 Ga0373942_0171100 3300035207 Bacteria 707
218 Ga0373937_0326688 3300036401 Bacteria 1452
219 Ga0451577_0252997 3300042876 Bacteria 1595
220 Ga0453683_0401463 3300044673 Bacteria 884
221 Ga0451576_0110237 3300045051 Bacteria 2864
222 Ga0451576_0165922 3300045051 Bacteria 2305
223 Ga0451576_0406854 3300045051 Bacteria 1427
224 Ga0466967_0623354 3300045976 Unclassified 1065
225 Ga0495629_0140750 3300046459 Bacteria 1679
226 Ga0495584_0061431 3300046491 Bacteria 1889
227 Ga0495644_0042135 3300046523 Bacteria 1719
228 Ga0495644_0180277 3300046523 Unclassified 812
229 Ga0495663_0090039 3300046525 Unclassified 999
230 Ga0495621_0014779 3300046539 Bacteria 2478
231 Ga0495633_0040384 3300046558 Bacteria 2223
232 Ga0495667_0195663 3300046559 Unclassified 1295
233 Ga0495656_0059737 3300046615 Bacteria 1660
234 Ga0495656_0150127 3300046615 Unclassified 1125
235 Ga0495659_0009084 3300046664 Bacteria 3169
236 Ga0495659_0011960 3300046664 Bacteria 2801
237 Ga0495659_0184569 3300046664 Unclassified 851
238 Ga0495647_0119659 3300046681 Bacteria 1107
239 Ga0495669_0016977 3300046684 Bacteria 3122
240 Ga0495669_0049290 3300046684 Bacteria 1885
241 Ga0495669_0164928 3300046684 Bacteria 1052
242 Ga0496102_0384970 3300048905 Bacteria 1320
243 Ga0496104_0023087 3300048907 Bacteria 5717
244 Ga0496110_0033027 3300048913 Plasmid 4474
245 Ga0496111_0106361 3300048914 Bacteria 2065
246 Ga0496112_0001137 3300048915 Bacteria 19815
247 Ga0496112_0190382 3300048915 Bacteria 2014
248 Ga0501295_004574 3300049518 Bacteria 1810
249 Ga0501041_0448607 3300049577 Bacteria 819
250 Ga0501257_076760 3300049686 Bacteria 858
251 Ga0501081_0162048 3300049743 Bacteria 1612
252 Ga0501083_0124176 3300049744 Bacteria 1692
253 Ga0501283_011055 3300049779 Bacteria 1337
254 nmdc:mga05p37_1013935_c1 3300050507 Unclassified 880
255 nmdc:mga05p37_380822_c1 3300050507 Bacteria 1653
256 nmdc:mga08y16_162437_c1 3300050511 Bacteria 2321
257 nmdc:mga08y16_192028_c1 3300050511 Bacteria 2118
258 nmdc:mga08y16_488452_c1 3300050511 Bacteria 1252
259 nmdc:mga08y16_570279_c1 3300050511 Bacteria 1144
260 nmdc:mga08y16_789508_c1 3300050511 Bacteria 943
261 nmdc:mga0n895_337950_c1 3300050512 Bacteria 1526
262 nmdc:mga0n895_85404_c1 3300050512 Bacteria 3151
263 nmdc:mga0rr50_273698_c1 3300050513 Unclassified 1408
264 nmdc:mga0rr50_27703_c1 3300050513 Bacteria 3972
265 nmdc:mga0a205_66412_c1 3300050515 Unclassified 3485
266 Ga0495595_0416692 3300053084 Unclassified 681
267 Ga0495619_0141310 3300053085 Bacteria 1658
268 Ga0590077_000153 3300059426 Bacteria 19272
269 Ga0587073_0059996 3300059492 Unclassified 889
270 2834644318 2834641062 Bacteria 5559922
271 Ga0070694_100423998
272 MBSR1b_contig_9745715
273 Ga0065715_10138738
274 Ga0070670_100087741
275 Ga0068869_100021592
276 Ga0070682_100179066
277 Ga0068868_100367622
278 Ga0070689_100130728
279 Ga0070687_100123593
280 Ga0070692_10310288
281 Ga0070669_100013696
282 Ga0070669_100038309
283 Ga0070669_100519112
284 Ga0070675_100000464
285 Ga0070675_100026686
286 Ga0070675_100105428
287 Ga0070674_100039859
288 Ga0070673_100042519
289 Ga0070673_100121104
290 Ga0070688_100477133
291 Ga0070688_100582629
292 Ga0070659_100664400
293 Ga0070701_10023773
294 Ga0070705_100089590
295 Ga0070705_100428306
296 Ga0070700_100014876
297 Ga0070700_100272209
298 Ga0070700_100373125
299 Ga0070694_100226084
300 Ga0070694_100387708
301 Ga0070708_100371210
302 Ga0070708_100666193
303 Ga0070678_100136031
304 Ga0070678_100215808
305 Ga0068867_100006079
306 Ga0068867_100452089
307 Ga0070685_10606551
308 Ga0070707_100064132
309 Ga0070707_100388054
310 Ga0070698_100539936
311 Ga0070699_100005837
312 Ga0070672_100033848
313 Ga0070672_100058765
314 Ga0070672_100066992
315 Ga0070672_100189102
316 Ga0070686_100068914
317 Ga0070686_100593274
318 Ga0070695_100018480
319 Ga0070695_100418327
320 Ga0070696_100023657
321 Ga0070696_100086322
322 Ga0070696_100585698
323 Ga0070704_100279693
324 Ga0070664_100174104
325 Ga0068854_100159604
326 Ga0068856_100265348
327 Ga0070702_100298702
328 Ga0068859_100019722
329 Ga0068859_100249137
330 Ga0068859_101145445
331 Ga0068864_100079538
332 Ga0068864_100147821
333 Ga0068866_10016158
334 Ga0068861_100019021
335 Ga0068861_100055329
336 Ga0068861_100241111
337 Ga0068861_100246132
338 Ga0068861_100662485
339 Ga0068870_10193396
340 Ga0068863_100106400
341 Ga0068858_100059648
342 Ga0068858_100071750
343 Ga0068860_100018662
344 Ga0068860_100113342
345 Ga0068862_100210904
346 Ga0068862_100222429
347 Ga0068862_100377694
348 Ga0070717_10981091
349 Ga0070712_100359817
350 Ga0097621_100000316
351 Ga0097621_100714194
352 Ga0068871_100001707
353 Ga0068871_100074787
354 Ga0075428_100447751
355 Ga0075431_100008605
356 Ga0075431_100565047
357 Ga0075433_10054464
358 Ga0075434_100002386
359 Ga0075434_100405991
360 Ga0075429_100009954
361 Ga0068865_100004418
362 Ga0068865_100112978
363 Ga0075436_100266196
364 Ga0097620_100019722
365 Ga0097620_100249137
366 Ga0097620_101145706
367 Ga0097620_101468160
368 Ga0075435_100098313
369 Ga0075435_100285182
370 Ga0111539_10158484
371 Ga0111539_10201507
372 Ga0111539_10955954
373 Ga0111539_10970489
374 Ga0105245_10099336
375 Ga0105245_10526061
376 Ga0105247_10524501
377 Ga0114129_10477129
378 Ga0114129_11291780
379 Ga0105243_10093120
380 Ga0105248_10324913
381 Ga0105249_10714272
382 Ga0105246_10043141
383 Ga0157370_10094187
384 Ga0157378_10904328
385 Ga0157375_10452371
386 Ga0163163_10033516
387 Ga0157380_10899343
388 Ga0157379_10484007
389 Ga0157376_10339403
390 Ga0157376_11345528
391 Ga0163161_10262383
392 Ga0207697_10160851
393 Ga0207682_10081804
394 Ga0207682_10158498
395 Ga0207645_10009220
396 Ga0207645_10036669
397 Ga0207645_10359852
398 Ga0207643_10182299
399 Ga0207643_10332525
400 Ga0207660_10391141
401 Ga0207662_10170407
402 Ga0207646_10049685
403 Ga0207646_10216148
404 Ga0207681_10031349
405 Ga0207681_10230336
406 Ga0207681_10823563
407 Ga0207650_10323489
408 Ga0207659_10072220
409 Ga0207659_10424326
410 Ga0207659_10529876
411 Ga0207659_10583219
412 Ga0207687_10228021
413 Ga0207706_10144455
414 Ga0207706_10660370
415 Ga0207686_10009561
416 Ga0207686_10213999
417 Ga0207686_10503780
418 Ga0207709_10013547
419 Ga0207709_10111663
420 Ga0207709_10129755
421 Ga0207670_10100404
422 Ga0207670_10238800
423 Ga0207670_10431482
424 Ga0207669_10051225
425 Ga0207704_10004686
426 Ga0207704_10015084
427 Ga0207704_10170620
428 Ga0207691_10065007
429 Ga0207691_10085782
430 Ga0207691_10110789
431 Ga0207691_10111884
432 Ga0207711_10850493
433 Ga0207689_10001561
434 Ga0207689_10455937
435 Ga0207661_10009943
436 Ga0207679_10508533
437 Ga0207679_10794337
438 Ga0207651_10011956
439 Ga0207651_10063416
440 Ga0207712_10522188
441 Ga0207668_10056424
442 Ga0207640_10169381
443 Ga0207658_10425910
444 Ga0207703_10010161
445 Ga0207703_10072232
446 Ga0207708_10023095
447 Ga0207708_10230914
448 Ga0207708_10340313
449 Ga0207702_10323287
450 Ga0207641_10817332
451 Ga0207648_10021328
452 Ga0207648_10146641
453 Ga0207648_10316709
454 Ga0207676_10027223
455 Ga0207676_10048156
456 Ga0207674_10044977
457 Ga0207675_100010616
458 Ga0207675_100048179
459 Ga0207675_100059846
460 Ga0207683_10024683
461 Ga0207683_10171242
462 Ga0207683_10751117
463 Ga0209971_1073402
464 Ga0207428_10098416
465 Ga0268265_10322626
466 Ga0268265_10415123
467 Ga0268264_10007315
468 Ga0268264_10735370
469 Ga0307408_100374648
470 Ga0307413_10111081
471 Ga0307410_10404664
472 Ga0307406_10252029
473 Ga0307412_10282580
474 Ga0307409_100066244
475 Ga0307409_100378438
476 Ga0307416_100001608
477 Ga0307416_100191423
478 Ga0307416_100223790
479 Ga0307416_100310378
480 Ga0307416_100975331
481 Ga0307414_10218759
482 Ga0307411_10366358
483 Ga0307415_100002012
484 Ga0307415_100099586
485 Ga0373939_0251051
486 Ga0373960_0067396
487 Ga0373942_0171100
488 Ga0373937_0326688
489 Ga0451577_0252997
490 Ga0453683_0401463
491 Ga0451576_0110237
492 Ga0451576_0165922
493 Ga0451576_0406854
494 Ga0466967_0623354
495 Ga0495629_0140750
496 Ga0495584_0061431
497 Ga0495644_0042135
498 Ga0495644_0180277
499 Ga0495663_0090039
500 Ga0495621_0014779
501 Ga0495633_0040384
502 Ga0495667_0195663
503 Ga0495656_0059737
504 Ga0495656_0150127
505 Ga0495659_0009084
506 Ga0495659_0011960
507 Ga0495659_0184569
508 Ga0495647_0119659
509 Ga0495669_0016977
510 Ga0495669_0049290
511 Ga0495669_0164928
512 Ga0496102_0384970
513 Ga0496104_0023087
514 Ga0496110_0033027
515 Ga0496111_0106361
516 Ga0496112_0001137
517 Ga0496112_0190382
518 Ga0501295_004574
519 Ga0501041_0448607
520 Ga0501257_076760
521 Ga0501081_0162048
522 Ga0501083_0124176
523 Ga0501283_011055
524 nmdc:mga05p37_1013935_c1
525 nmdc:mga05p37_380822_c1
526 nmdc:mga08y16_162437_c1
527 nmdc:mga08y16_192028_c1
528 nmdc:mga08y16_488452_c1
529 nmdc:mga08y16_570279_c1
530 nmdc:mga08y16_789508_c1
531 nmdc:mga0n895_337950_c1
532 nmdc:mga0n895_85404_c1
533 nmdc:mga0rr50_273698_c1
534 nmdc:mga0rr50_27703_c1
535 nmdc:mga0a205_66412_c1
536 Ga0495595_0416692
537 Ga0495619_0141310
538 Ga0590077_000153
539 Ga0587073_0059996
540 2834644318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07040

DUF1326

Protein of unknown function (DUF1326)

22

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8css-assembly1.cif.gz_C human mitochondrial small subunit assembly intermediate (state d) 0.6015 74 123
6vda-assembly1.cif.gz_A-2 metal-bound c-terminal domain of czcd transporter from thermotoga maritima 0.5936 72 123
6gp6-assembly1.cif.gz_A mamm ctd - copper form 0.5934 76 123
7pnw-assembly1.cif.gz_C mouse mitochondrial ribosome small subunit lacking m5u modification 0.5933 76 123
6gp6-assembly1.cif.gz_B mamm ctd - copper form 0.5721 72 123
ID Description Score Start End Superfamily
af_O76639_293_347_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7052 124 147 2.30.29.30
af_Q9VCC3_31_165_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.6034 76 123 3.30.1380.20
af_A0A1D6IE07_266_395_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.5905 60 121 3.40.20.10
af_A0A0G2K9G3_48_179_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5858 76 123 3.30.300.20
af_O17369_42_305_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.585 124 191 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A838P7S2-F1-model_v4 DUF1326 domain-containing protein 0.9952 2 208
AF-A0A838P7S2-F1-model_v4 DUF1326 domain-containing protein 0.9857 2 208
AF-A0A6N8IPW1-F1-model_v4 DUF1326 domain-containing protein 0.9839 5 207
AF-A0A535HGQ4-F1-model_v4 DUF1326 domain-containing protein 0.979 5 207
AF-A0A7W1BJ22-F1-model_v4 DUF1326 domain-containing protein 0.9778 1 115

Map