F376153

General Info

Members Datasets Scaffolds Average Seq Length
269 154 538 168

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10146906|Ga0099794_101469062
Length 186
Sequence MTHEDYRRALESATREYEDLGATRQAIDKRLAELAQTIGTLSKLIGLTPTVPLGLTDAVRLIMRGGVPMTPVEVRDRLHAIGFDVSKYSNDLAAVHTILKRLNESGELRFIPRSPGKHQYTWNRPTTPVALGPDIVAFMRDNASERDAMRAGERPRPHRGPQRGSRAGVARRAEDVEIRGEVSATR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.69
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 30.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10146906 3300007265 Bacteria 1196
2 Ga0065712_10098087 3300005290 Bacteria 2130
3 Ga0070658_10192509 3300005327 Bacteria 1719
4 Ga0070683_100552506 3300005329 Unclassified 1101
5 Ga0070670_100046596 3300005331 Bacteria 3729
6 Ga0070670_100077526 3300005331 Unclassified 2855
7 Ga0070670_100186366 3300005331 Bacteria 1802
8 Ga0068869_100557900 3300005334 Unclassified 963
9 Ga0070682_101525977 3300005337 Bacteria 575
10 Ga0068868_100245101 3300005338 Bacteria 1507
11 Ga0070689_100315530 3300005340 Bacteria 1304
12 Ga0070689_101716552 3300005340 Bacteria 571
13 Ga0070675_100001658 3300005354 Bacteria 16459
14 Ga0070675_100220339 3300005354 Unclassified 1652
15 Ga0070675_101648191 3300005354 Unclassified 592
16 Ga0070671_101115537 3300005355 Unclassified 693
17 Ga0070674_100401764 3300005356 Unclassified 1120
18 Ga0070673_100542083 3300005364 Bacteria 1056
19 Ga0070688_100014231 3300005365 Bacteria 4504
20 Ga0070688_100319096 3300005365 Bacteria 1128
21 Ga0070667_100312287 3300005367 Bacteria 1417
22 Ga0070714_100005373 3300005435 Bacteria 9776
23 Ga0070700_101290120 3300005441 Unclassified 613
24 Ga0070694_100003593 3300005444 Bacteria 9266
25 Ga0070708_101029879 3300005445 Bacteria 772
26 Ga0070678_100268330 3300005456 Unclassified 1438
27 Ga0070681_10256472 3300005458 Bacteria 1661
28 Ga0068867_100067200 3300005459 Unclassified 2672
29 Ga0070685_11274442 3300005466 Unclassified 561
30 Ga0070707_100014505 3300005468 Bacteria 7385
31 Ga0070707_100881543 3300005468 Unclassified 859
32 Ga0070707_101470482 3300005468 Bacteria 648
33 Ga0070698_100306463 3300005471 Unclassified 1519
34 Ga0070699_100520891 3300005518 Bacteria 1081
35 Ga0070699_101048668 3300005518 Bacteria 748
36 Ga0070679_100009478 3300005530 Bacteria 9210
37 Ga0070697_101088564 3300005536 Unclassified 711
38 Ga0068853_100910520 3300005539 Unclassified 845
39 Ga0070686_100978477 3300005544 Unclassified 693
40 Ga0070695_100013443 3300005545 Bacteria 4920
41 Ga0070695_100432628 3300005545 Unclassified 1004
42 Ga0070696_100763873 3300005546 Bacteria 793
43 Ga0070693_100648764 3300005547 Bacteria 767
44 Ga0070665_100002974 3300005548 Bacteria 18312
45 Ga0070665_100006812 3300005548 Bacteria 11618
46 Ga0070704_100059850 3300005549 Unclassified 2719
47 Ga0070704_100750579 3300005549 Unclassified 869
48 Ga0070704_101379014 3300005549 Unclassified 646
49 Ga0068855_100410872 3300005563 Bacteria 1482
50 Ga0070664_100308075 3300005564 Bacteria 1432
51 Ga0070664_100708646 3300005564 Bacteria 938
52 Ga0070664_101238885 3300005564 Bacteria 704
53 Ga0070664_101560112 3300005564 Unclassified 625
54 Ga0068852_100880093 3300005616 Unclassified 912
55 Ga0068852_100923601 3300005616 Bacteria 890
56 Ga0068859_100291838 3300005617 Bacteria 1724
57 Ga0068859_101240344 3300005617 Bacteria 821
58 Ga0068859_101432274 3300005617 Bacteria 762
59 Ga0068864_100201409 3300005618 Bacteria 1829
60 Ga0068864_100331742 3300005618 Bacteria 1431
61 Ga0068864_100940113 3300005618 Bacteria 855
62 Ga0068864_101197924 3300005618 Unclassified 758
63 Ga0068870_10227726 3300005840 Bacteria 1144
64 Ga0068863_100039571 3300005841 Bacteria 4485
65 Ga0068863_100094775 3300005841 Bacteria 2833
66 Ga0068863_100143661 3300005841 Bacteria 2282
67 Ga0068858_100018546 3300005842 Bacteria 6515
68 Ga0068858_100296242 3300005842 Bacteria 1543
69 Ga0068858_100470094 3300005842 Bacteria 1213
70 Ga0068858_100764768 3300005842 Bacteria 941
71 Ga0068860_101038915 3300005843 Unclassified 838
72 Ga0068862_101207146 3300005844 Unclassified 755
73 Ga0070716_100084602 3300006173 Bacteria 1903
74 Ga0070716_100183467 3300006173 Unclassified 1376
75 Ga0097621_100002793 3300006237 Bacteria 11955
76 Ga0097621_100115657 3300006237 Unclassified 2270
77 Ga0097621_100595068 3300006237 Bacteria 1010
78 Ga0068871_100022311 3300006358 Unclassified 4880
79 Ga0068871_100054565 3300006358 Bacteria 3243
80 Ga0068871_100180809 3300006358 Bacteria 1812
81 Ga0068871_100588703 3300006358 Bacteria 1011
82 Ga0075428_100072824 3300006844 Unclassified 3752
83 Ga0075428_100191131 3300006844 Unclassified 2214
84 Ga0075428_100558392 3300006844 Bacteria 1224
85 Ga0075428_102190453 3300006844 Bacteria 570
86 Ga0075430_100601560 3300006846 Bacteria 907
87 Ga0075430_100677017 3300006846 Bacteria 850
88 Ga0075431_100008478 3300006847 Bacteria 10294
89 Ga0075431_100194998 3300006847 Bacteria 2074
90 Ga0075433_10164174 3300006852 Bacteria 1977
91 Ga0075434_100004381 3300006871 Bacteria 12718
92 Ga0075434_100836939 3300006871 Unclassified 936
93 Ga0075429_100081957 3300006880 Unclassified 2813
94 Ga0075429_100645152 3300006880 Unclassified 928
95 Ga0075429_100703148 3300006880 Bacteria 885
96 Ga0068865_100009626 3300006881 Bacteria 5994
97 Ga0068865_100949125 3300006881 Unclassified 750
98 Ga0075436_100010316 3300006914 Bacteria 6399
99 Ga0075436_100031116 3300006914 Bacteria 3673
100 Ga0075436_100496382 3300006914 Bacteria 892
101 Ga0097620_100195281 3300006931 Bacteria 2108
102 Ga0097620_100291862 3300006931 Bacteria 1724
103 Ga0097620_101240541 3300006931 Bacteria 821
104 Ga0097620_101432804 3300006931 Bacteria 762
105 Ga0075435_100136416 3300007076 Bacteria 2056
106 Ga0075435_100141881 3300007076 Unclassified 2016
107 Ga0075435_100493282 3300007076 Unclassified 1059
108 Ga0105240_10166636 3300009093 Bacteria 2613
109 Ga0105240_10347319 3300009093 Unclassified 1684
110 Ga0105245_10052254 3300009098 Bacteria 3665
111 Ga0105247_10008856 3300009101 Bacteria 6135
112 Ga0105247_10429029 3300009101 Bacteria 948
113 Ga0114129_10029981 3300009147 Bacteria 7703
114 Ga0114129_10064162 3300009147 Bacteria 5125
115 Ga0114129_10064677 3300009147 Bacteria 5104
116 Ga0114129_10123786 3300009147 Bacteria 3556
117 Ga0114129_10533008 3300009147 Unclassified 1529
118 Ga0114129_11404175 3300009147 Bacteria 861
119 Ga0105241_10412203 3300009174 Bacteria 1187
120 Ga0105242_10013033 3300009176 Bacteria 6416
121 Ga0105242_10106133 3300009176 Bacteria 2387
122 Ga0105242_11359414 3300009176 Unclassified 736
123 Ga0105248_10001067 3300009177 Bacteria 30324
124 Ga0105248_10006525 3300009177 Bacteria 12791
125 Ga0105248_10051364 3300009177 Bacteria 4626
126 Ga0105248_10172765 3300009177 Bacteria 2436
127 Ga0105248_10516578 3300009177 Bacteria 1347
128 Ga0105248_11065010 3300009177 Bacteria 914
129 Ga0105238_10904277 3300009551 Bacteria 901
130 Ga0105246_10746989 3300011119 Bacteria 862
131 Ga0157374_10276583 3300013296 Bacteria 1657
132 Ga0157374_10607070 3300013296 Unclassified 1104
133 Ga0157374_10921112 3300013296 Bacteria 892
134 Ga0163162_10060512 3300013306 Bacteria 3822
135 Ga0163162_10707044 3300013306 Unclassified 1129
136 Ga0157375_10447433 3300013308 Bacteria 1457
137 Ga0157375_10460901 3300013308 Unclassified 1436
138 Ga0157375_10925870 3300013308 Bacteria 1014
139 Ga0163163_10000003 3300014325 Bacteria 455102
140 Ga0163163_10003465 3300014325 Bacteria 13411
141 Ga0163163_10031989 3300014325 Bacteria 5080
142 Ga0163163_10140814 3300014325 Unclassified 2454
143 Ga0163163_10504587 3300014325 Unclassified 1272
144 Ga0163163_11457791 3300014325 Bacteria 746
145 Ga0157377_10012205 3300014745 Bacteria 4314
146 Ga0157379_10180997 3300014968 Bacteria 1904
147 Ga0157379_11299554 3300014968 Bacteria 702
148 Ga0157376_10056891 3300014969 Bacteria 3270
149 Ga0157376_10135321 3300014969 Unclassified 2204
150 Ga0157376_10256425 3300014969 Unclassified 1636
151 Ga0157376_10683159 3300014969 Bacteria 1030
152 Ga0207642_10026565 3300025899 Unclassified 2358
153 Ga0207710_10055749 3300025900 Bacteria 1782
154 Ga0207705_10146993 3300025909 Bacteria 1764
155 Ga0207707_10261885 3300025912 Bacteria 1500
156 Ga0207695_10118119 3300025913 Bacteria 2623
157 Ga0207695_10120873 3300025913 Bacteria 2587
158 Ga0207695_10279588 3300025913 Bacteria 1563
159 Ga0207657_10001598 3300025919 Bacteria 24352
160 Ga0207652_10192234 3300025921 Bacteria 1836
161 Ga0207652_10651161 3300025921 Unclassified 942
162 Ga0207646_10100564 3300025922 Unclassified 2592
163 Ga0207646_10213569 3300025922 Archaea 1742
164 Ga0207650_10191348 3300025925 Bacteria 1635
165 Ga0207659_10000180 3300025926 Bacteria 37729
166 Ga0207687_10345476 3300025927 Bacteria 1211
167 Ga0207664_10047156 3300025929 Bacteria 3384
168 Ga0207686_10070513 3300025934 Unclassified 2246
169 Ga0207669_10456137 3300025937 Unclassified 1014
170 Ga0207704_10012052 3300025938 Bacteria 4279
171 Ga0207665_10166555 3300025939 Unclassified 1589
172 Ga0207711_10161342 3300025941 Bacteria 2029
173 Ga0207711_10203482 3300025941 Bacteria 1807
174 Ga0207711_10523048 3300025941 Bacteria 1106
175 Ga0207679_10196577 3300025945 Bacteria 1681
176 Ga0207679_10890134 3300025945 Bacteria 814
177 Ga0207677_10158114 3300026023 Bacteria 1757
178 Ga0207677_10533436 3300026023 Bacteria 1020
179 Ga0207703_10021052 3300026035 Bacteria 5103
180 Ga0207703_10242589 3300026035 Bacteria 1620
181 Ga0207703_10383832 3300026035 Bacteria 1300
182 Ga0207703_11349586 3300026035 Bacteria 686
183 Ga0207639_11838621 3300026041 Bacteria 566
184 Ga0207708_10961012 3300026075 Unclassified 741
185 Ga0207641_10082357 3300026088 Bacteria 2796
186 Ga0207641_10510540 3300026088 Bacteria 1168
187 Ga0207641_10570753 3300026088 Bacteria 1105
188 Ga0207641_11569417 3300026088 Unclassified 660
189 Ga0207648_10253489 3300026089 Unclassified 1569
190 Ga0207676_10033624 3300026095 Bacteria 3875
191 Ga0207676_10151200 3300026095 Bacteria 1999
192 Ga0207683_10323534 3300026121 Unclassified 1413
193 Ga0207698_10847251 3300026142 Unclassified 919
194 Ga0268266_10022716 3300028379 Bacteria 5340
195 Ga0268266_10037289 3300028379 Unclassified 4142
196 Ga0268264_11009025 3300028381 Unclassified 839
197 Ga0373934_0003007 3300035086 Bacteria 6158
198 Ga0373934_0092372 3300035086 Unclassified 1221
199 Ga0373934_0122973 3300035086 Bacteria 1056
200 Ga0373923_0195867 3300035111 Bacteria 933
201 Ga0373953_0231159 3300035117 Unclassified 802
202 Ga0373954_0014386 3300035118 Unclassified 3529
203 Ga0373956_0084668 3300035119 Unclassified 1458
204 Ga0373957_0075240 3300035120 Bacteria 1326
205 Ga0373955_0001323 3300035172 Bacteria 10510
206 Ga0373962_0281941 3300035242 Unclassified 585
207 Ga0373935_0844348 3300035692 Unclassified 677
208 Ga0373933_0016030 3300035724 Bacteria 4186
209 Ga0373937_0001043 3300036401 Bacteria 23402
210 Ga0373937_0051448 3300036401 Bacteria 3776
211 Ga0373937_0238264 3300036401 Unclassified 1714
212 Ga0373937_1078088 3300036401 Unclassified 752
213 Ga0373925_0196132 3300037068 Unclassified 1604
214 Ga0451839_0089761 3300041496 Bacteria 1029
215 Ga0451849_1264010 3300041505 Unclassified 573
216 Ga0439448_0210240 3300042005 Unclassified 683
217 Ga0451577_0027723 3300042876 Bacteria 5126
218 Ga0451576_0019408 3300045051 Bacteria 7421
219 Ga0466967_0099671 3300045976 Bacteria 2654
220 Ga0495592_0155483 3300046454 Bacteria 1578
221 Ga0495592_0283138 3300046454 Bacteria 1084
222 Ga0495603_0095043 3300046455 Unclassified 1741
223 Ga0495651_0401216 3300046462 Bacteria 895
224 Ga0495582_0040471 3300046473 Bacteria 2567
225 Ga0495628_0830780 3300046516 Unclassified 645
226 Ga0495652_0610796 3300046529 Unclassified 743
227 Ga0495587_0446787 3300046536 Bacteria 716
228 Ga0495635_0032500 3300046663 Bacteria 3620
229 Ga0495647_0082448 3300046681 Unclassified 1306
230 Ga0495647_0159389 3300046681 Bacteria 971
231 Ga0495658_0139425 3300046683 Bacteria 1482
232 Ga0495684_0047848 3300047471 Bacteria 3270
233 Ga0496103_0095928 3300048906 Bacteria 1874
234 Ga0496104_0208572 3300048907 Bacteria 1866
235 Ga0496104_0299925 3300048907 Bacteria 1519
236 Ga0496104_0455715 3300048907 Bacteria 1191
237 Ga0496105_0343469 3300048908 Bacteria 1193
238 Ga0496105_0787772 3300048908 Bacteria 724
239 Ga0496106_0474755 3300048909 Bacteria 1005
240 Ga0496107_0221993 3300048910 Bacteria 1406
241 Ga0496108_0084181 3300048911 Bacteria 2699
242 Ga0496109_0101839 3300048912 Bacteria 2666
243 Ga0496110_0200769 3300048913 Bacteria 1812
244 Ga0496111_0066960 3300048914 Bacteria 2609
245 Ga0496112_0036009 3300048915 Bacteria 4824
246 Ga0496112_0104934 3300048915 Bacteria 2796
247 Ga0496112_0197170 3300048915 Bacteria 1974
248 Ga0496113_0191569 3300048916 Bacteria 1623
249 Ga0496114_0604993 3300048917 Bacteria 966
250 Ga0496114_0941543 3300048917 Unclassified 746
251 nmdc:mga05p37_1223078_c1 3300050507 Bacteria 774
252 nmdc:mga05p37_288763_c1 3300050507 Bacteria 1953
253 nmdc:mga05p37_30508_c1 3300050507 Unclassified 4271
254 nmdc:mga05p37_50798_c1 3300050507 Bacteria 5100
255 nmdc:mga05p37_667980_c1 3300050507 Bacteria 1160
256 nmdc:mga09592_123870_c1 3300050508 Unclassified 2221
257 nmdc:mga0qj67_1030213_c1 3300050509 Bacteria 645
258 nmdc:mga0qj67_131547_c1 3300050509 Unclassified 2027
259 nmdc:mga06r32_483774_c1 3300050510 Bacteria 1216
260 nmdc:mga06r32_914437_c1 3300050510 Unclassified 833
261 nmdc:mga08y16_53997_c1 3300050511 Bacteria 4200
262 nmdc:mga0rr50_386835_c1 3300050513 Unclassified 1180
263 nmdc:mga0rr50_473834_c1 3300050513 Bacteria 1063
264 nmdc:mga08x19_296368_c1 3300050514 Bacteria 1123
265 nmdc:mga08x19_63022_c1 3300050514 Bacteria 2405
266 nmdc:mga0a205_710358_c1 3300050515 Unclassified 855
267 Ga0495601_0196144 3300053077 Unclassified 1320
268 Ga0495601_0676309 3300053077 Unclassified 659
269 Ga0495619_0053016 3300053085 Bacteria 2682
270 Ga0099794_10146906
271 Ga0065712_10098087
272 Ga0070658_10192509
273 Ga0070683_100552506
274 Ga0070670_100046596
275 Ga0070670_100077526
276 Ga0070670_100186366
277 Ga0068869_100557900
278 Ga0070682_101525977
279 Ga0068868_100245101
280 Ga0070689_100315530
281 Ga0070689_101716552
282 Ga0070675_100001658
283 Ga0070675_100220339
284 Ga0070675_101648191
285 Ga0070671_101115537
286 Ga0070674_100401764
287 Ga0070673_100542083
288 Ga0070688_100014231
289 Ga0070688_100319096
290 Ga0070667_100312287
291 Ga0070714_100005373
292 Ga0070700_101290120
293 Ga0070694_100003593
294 Ga0070708_101029879
295 Ga0070678_100268330
296 Ga0070681_10256472
297 Ga0068867_100067200
298 Ga0070685_11274442
299 Ga0070707_100014505
300 Ga0070707_100881543
301 Ga0070707_101470482
302 Ga0070698_100306463
303 Ga0070699_100520891
304 Ga0070699_101048668
305 Ga0070679_100009478
306 Ga0070697_101088564
307 Ga0068853_100910520
308 Ga0070686_100978477
309 Ga0070695_100013443
310 Ga0070695_100432628
311 Ga0070696_100763873
312 Ga0070693_100648764
313 Ga0070665_100002974
314 Ga0070665_100006812
315 Ga0070704_100059850
316 Ga0070704_100750579
317 Ga0070704_101379014
318 Ga0068855_100410872
319 Ga0070664_100308075
320 Ga0070664_100708646
321 Ga0070664_101238885
322 Ga0070664_101560112
323 Ga0068852_100880093
324 Ga0068852_100923601
325 Ga0068859_100291838
326 Ga0068859_101240344
327 Ga0068859_101432274
328 Ga0068864_100201409
329 Ga0068864_100331742
330 Ga0068864_100940113
331 Ga0068864_101197924
332 Ga0068870_10227726
333 Ga0068863_100039571
334 Ga0068863_100094775
335 Ga0068863_100143661
336 Ga0068858_100018546
337 Ga0068858_100296242
338 Ga0068858_100470094
339 Ga0068858_100764768
340 Ga0068860_101038915
341 Ga0068862_101207146
342 Ga0070716_100084602
343 Ga0070716_100183467
344 Ga0097621_100002793
345 Ga0097621_100115657
346 Ga0097621_100595068
347 Ga0068871_100022311
348 Ga0068871_100054565
349 Ga0068871_100180809
350 Ga0068871_100588703
351 Ga0075428_100072824
352 Ga0075428_100191131
353 Ga0075428_100558392
354 Ga0075428_102190453
355 Ga0075430_100601560
356 Ga0075430_100677017
357 Ga0075431_100008478
358 Ga0075431_100194998
359 Ga0075433_10164174
360 Ga0075434_100004381
361 Ga0075434_100836939
362 Ga0075429_100081957
363 Ga0075429_100645152
364 Ga0075429_100703148
365 Ga0068865_100009626
366 Ga0068865_100949125
367 Ga0075436_100010316
368 Ga0075436_100031116
369 Ga0075436_100496382
370 Ga0097620_100195281
371 Ga0097620_100291862
372 Ga0097620_101240541
373 Ga0097620_101432804
374 Ga0075435_100136416
375 Ga0075435_100141881
376 Ga0075435_100493282
377 Ga0105240_10166636
378 Ga0105240_10347319
379 Ga0105245_10052254
380 Ga0105247_10008856
381 Ga0105247_10429029
382 Ga0114129_10029981
383 Ga0114129_10064162
384 Ga0114129_10064677
385 Ga0114129_10123786
386 Ga0114129_10533008
387 Ga0114129_11404175
388 Ga0105241_10412203
389 Ga0105242_10013033
390 Ga0105242_10106133
391 Ga0105242_11359414
392 Ga0105248_10001067
393 Ga0105248_10006525
394 Ga0105248_10051364
395 Ga0105248_10172765
396 Ga0105248_10516578
397 Ga0105248_11065010
398 Ga0105238_10904277
399 Ga0105246_10746989
400 Ga0157374_10276583
401 Ga0157374_10607070
402 Ga0157374_10921112
403 Ga0163162_10060512
404 Ga0163162_10707044
405 Ga0157375_10447433
406 Ga0157375_10460901
407 Ga0157375_10925870
408 Ga0163163_10000003
409 Ga0163163_10003465
410 Ga0163163_10031989
411 Ga0163163_10140814
412 Ga0163163_10504587
413 Ga0163163_11457791
414 Ga0157377_10012205
415 Ga0157379_10180997
416 Ga0157379_11299554
417 Ga0157376_10056891
418 Ga0157376_10135321
419 Ga0157376_10256425
420 Ga0157376_10683159
421 Ga0207642_10026565
422 Ga0207710_10055749
423 Ga0207705_10146993
424 Ga0207707_10261885
425 Ga0207695_10118119
426 Ga0207695_10120873
427 Ga0207695_10279588
428 Ga0207657_10001598
429 Ga0207652_10192234
430 Ga0207652_10651161
431 Ga0207646_10100564
432 Ga0207646_10213569
433 Ga0207650_10191348
434 Ga0207659_10000180
435 Ga0207687_10345476
436 Ga0207664_10047156
437 Ga0207686_10070513
438 Ga0207669_10456137
439 Ga0207704_10012052
440 Ga0207665_10166555
441 Ga0207711_10161342
442 Ga0207711_10203482
443 Ga0207711_10523048
444 Ga0207679_10196577
445 Ga0207679_10890134
446 Ga0207677_10158114
447 Ga0207677_10533436
448 Ga0207703_10021052
449 Ga0207703_10242589
450 Ga0207703_10383832
451 Ga0207703_11349586
452 Ga0207639_11838621
453 Ga0207708_10961012
454 Ga0207641_10082357
455 Ga0207641_10510540
456 Ga0207641_10570753
457 Ga0207641_11569417
458 Ga0207648_10253489
459 Ga0207676_10033624
460 Ga0207676_10151200
461 Ga0207683_10323534
462 Ga0207698_10847251
463 Ga0268266_10022716
464 Ga0268266_10037289
465 Ga0268264_11009025
466 Ga0373934_0003007
467 Ga0373934_0092372
468 Ga0373934_0122973
469 Ga0373923_0195867
470 Ga0373953_0231159
471 Ga0373954_0014386
472 Ga0373956_0084668
473 Ga0373957_0075240
474 Ga0373955_0001323
475 Ga0373962_0281941
476 Ga0373935_0844348
477 Ga0373933_0016030
478 Ga0373937_0001043
479 Ga0373937_0051448
480 Ga0373937_0238264
481 Ga0373937_1078088
482 Ga0373925_0196132
483 Ga0451839_0089761
484 Ga0451849_1264010
485 Ga0439448_0210240
486 Ga0451577_0027723
487 Ga0451576_0019408
488 Ga0466967_0099671
489 Ga0495592_0155483
490 Ga0495592_0283138
491 Ga0495603_0095043
492 Ga0495651_0401216
493 Ga0495582_0040471
494 Ga0495628_0830780
495 Ga0495652_0610796
496 Ga0495587_0446787
497 Ga0495635_0032500
498 Ga0495647_0082448
499 Ga0495647_0159389
500 Ga0495658_0139425
501 Ga0495684_0047848
502 Ga0496103_0095928
503 Ga0496104_0208572
504 Ga0496104_0299925
505 Ga0496104_0455715
506 Ga0496105_0343469
507 Ga0496105_0787772
508 Ga0496106_0474755
509 Ga0496107_0221993
510 Ga0496108_0084181
511 Ga0496109_0101839
512 Ga0496110_0200769
513 Ga0496111_0066960
514 Ga0496112_0036009
515 Ga0496112_0104934
516 Ga0496112_0197170
517 Ga0496113_0191569
518 Ga0496114_0604993
519 Ga0496114_0941543
520 nmdc:mga05p37_1223078_c1
521 nmdc:mga05p37_288763_c1
522 nmdc:mga05p37_30508_c1
523 nmdc:mga05p37_50798_c1
524 nmdc:mga05p37_667980_c1
525 nmdc:mga09592_123870_c1
526 nmdc:mga0qj67_1030213_c1
527 nmdc:mga0qj67_131547_c1
528 nmdc:mga06r32_483774_c1
529 nmdc:mga06r32_914437_c1
530 nmdc:mga08y16_53997_c1
531 nmdc:mga0rr50_386835_c1
532 nmdc:mga0rr50_473834_c1
533 nmdc:mga08x19_296368_c1
534 nmdc:mga08x19_63022_c1
535 nmdc:mga0a205_710358_c1
536 Ga0495601_0196144
537 Ga0495601_0676309
538 Ga0495619_0053016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c0i-assembly1.cif.gz_A crystal structure of chimeric mutant of e3l in complex with z-dna 0.8674 53 132
7c0i-assembly1.cif.gz_A crystal structure of chimeric mutant of e3l in complex with z-dna 0.8419 53 132
4i7h-assembly1.cif.gz_A structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes 0.8207 53 131
5l0p-assembly1.cif.gz_A-2 symmetry-based assembly of a two-dimensional protein lattice 0.8158 53 132
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.7948 54 132
ID Description Score Start End Superfamily
3mwmB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8446 56 135 1.10.10.10
af_F4I7L1_123_208_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8354 58 134 1.10.10.10
af_Q9HGK2_5_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8252 55 133 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8211 52 132 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8177 54 131 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6G9FR50-F1-model_v4 Transcriptional regulator 0.8155 53 133
AF-A0A4R3J9D2-F1-model_v4 Uncharacterized protein 0.8143 54 135
AF-A0A7H0KA08-F1-model_v4 HTH HARE-type domain-containing protein 0.8045 53 131 GO:0006355
AF-A0A383A4J8-F1-model_v4 Uncharacterized protein 0.8036 56 135
AF-A0A5D3FWR6-F1-model_v4 ROK family transcriptional regulator 0.8029 55 132 GO:0003700
GO:0003824

Map