F375845

General Info

Members Datasets Scaffolds Average Seq Length
268 182 243 301

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0005494|Ga0500616_0005494_2435_3448
Length 337
Sequence MHVVHHPFYVAPGTPGTGMRFDKYGLVMEALREADLPLTLHQPDPMPRRWIEAVHDPAYVEEVLTLSVPKAKERRIGFPVTERVALRAQLSPGGTWQAARLALIDGYAANAAGGSHHALADTGAGYCVFNDLVIAANRLIAERDAARILILDLDVHQGDGSAALTAGRDDIFTLSIHAEHNFPERKARSTLDMPLPDGTDDRTYLAVLRETLPKVLDDFAPDLILYQAGVDPHIDDRLGRLALTDQGLIARDRFVASLARSGSIPLASTLGGGYGTDRMAVARRHARSIMTMAALFDDRQPSGSSASKPSVTAHGRHPVLEENVDLPTSSTHGVGRP

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
13 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
14 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
15 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
16 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
17 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
18 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
21 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
22 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
23 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
24 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
25 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
117 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
118 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
182 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.67
Metatranscriptomes 0
Isolates 9.33

Biome Distribution

Category Percentage (%)
Aerial Root 1.12
Bulb 0
Endosphere 22.39
Nodule 0
Rhizoplane 3.36
Rhizosphere 54.48
Stem 0
Stem Tuber 0
Unclassified 18.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000023 3300001904 Bacteria 25735
2 JGI24740J21852_10010247 3300001979 Bacteria 3621
3 JGI24739J22299_10001293 3300001989 Bacteria 9413
4 JGI24739J22299_10002985 3300001989 Bacteria 6472
5 JGI24737J22298_10001355 3300001990 Bacteria 8672
6 JGI24737J22298_10002290 3300001990 Bacteria 6807
7 JGI24735J21928_10000680 3300002067 Bacteria 12054
8 JGI24735J21928_10004282 3300002067 Bacteria 4810
9 JGI24735J21928_10016971 3300002067 Bacteria 2254
10 JGI24750J21931_1000274 3300002070 Bacteria 8836
11 JGI24738J21930_10000394 3300002075 Bacteria 12190
12 JGI24738J21930_10005723 3300002075 Bacteria 2958
13 JGI25150J39212_1000285 3300002774 Bacteria 26336
14 JGI25153J46596_10000044 3300003215 Bacteria 154263
15 rootH1_10079869 3300003316 Bacteria 1212
16 Ga0055532_1008211 3300003758 Bacteria 1310
17 Ga0055526_1000860 3300003771 Bacteria 22629
18 Ga0055537_1004587 3300003773 Bacteria 3918
19 Ga0055536_1018702 3300003781 Bacteria 2210
20 Ga0055530_10032453 3300003791 Bacteria 1358
21 Ga0055540_1011306 3300003792 Bacteria 2889
22 Ga0065165_1014240 3300005262 Bacteria 3099
23 Ga0070683_100378512 3300005329 Bacteria 1349
24 Ga0070690_100000202 3300005330 Bacteria 31141
25 Ga0070670_100121719 3300005331 Bacteria 2251
26 Ga0070666_10000053 3300005335 Bacteria 97883
27 Ga0070666_10013892 3300005335 Bacteria 5116
28 Ga0070660_100242541 3300005339 Bacteria 1468
29 Ga0070668_100002872 3300005347 Bacteria 12701
30 Ga0070668_100006427 3300005347 Bacteria 8714
31 Ga0070671_100060135 3300005355 Bacteria 3163
32 Ga0070659_100165498 3300005366 Bacteria 1809
33 Ga0070667_100008626 3300005367 Bacteria 8449
34 Ga0070662_100007415 3300005457 Bacteria 7113
35 Ga0070662_100387352 3300005457 Bacteria 1151
36 Ga0070686_100000050 3300005544 Bacteria 97879
37 Ga0068857_100025246 3300005577 Bacteria 5233
38 Ga0068857_100030286 3300005577 Bacteria 4778
39 Ga0068857_100330212 3300005577 Bacteria 1409
40 Ga0068854_100054904 3300005578 Bacteria 2867
41 Ga0068859_100107091 3300005617 Bacteria 2855
42 Ga0068863_100000093 3300005841 Bacteria 96862
43 Ga0068858_100058890 3300005842 Bacteria 3551
44 Ga0075363_100017596 3300006048 Bacteria 3547
45 Ga0075364_10055374 3300006051 Bacteria 2595
46 Ga0075364_10175974 3300006051 Bacteria 1447
47 Ga0075367_10095587 3300006178 Bacteria 1812
48 Ga0097620_100107091 3300006931 Bacteria 2855
49 Ga0105240_10789452 3300009093 Bacteria 1029
50 Ga0105248_10004227 3300009177 Bacteria 15883
51 Ga0157370_10036925 3300013104 Bacteria 4739
52 Ga0157369_10023012 3300013105 Bacteria 6946
53 Ga0157369_10362340 3300013105 Bacteria 1505
54 Ga0157372_10041206 3300013307 Bacteria 5105
55 Ga0157372_10045606 3300013307 Bacteria 4864
56 Ga0157372_10190902 3300013307 Bacteria 2373
57 Ga0183363_1001 3300015690 Bacteria 611534
58 Ga0163161_10233485 3300017792 Bacteria 1428
59 Ga0213875_10000105 3300021388 Bacteria 96051
60 Ga0207425_1000026 3300025245 Bacteria 301303
61 Ga0209148_1003499 3300025254 Bacteria 4305
62 Ga0209129_1002266 3300025258 Bacteria 9607
63 Ga0209565_1000064 3300025263 Bacteria 180732
64 Ga0209455_1001069 3300025272 Bacteria 13510
65 Ga0209673_1019664 3300025273 Bacteria 2417
66 Ga0209025_1000726 3300025294 Bacteria 55863
67 Ga0209564_1002791 3300025295 Bacteria 13034
68 Ga0209564_1031460 3300025295 Bacteria 1621
69 Ga0209758_1000004 3300025297 Bacteria 1375322
70 Ga0209758_1018748 3300025297 Bacteria 3375
71 Ga0209050_1000001 3300025298 Bacteria 3563507
72 Ga0209050_1000582 3300025298 Bacteria 59096
73 Ga0209050_1021547 3300025298 Bacteria 2345
74 Ga0209256_1036863 3300025299 Bacteria 1279
75 Ga0209051_1000793 3300025303 Bacteria 33269
76 Ga0209257_1000617 3300025304 Bacteria 57694
77 Ga0209257_1000633 3300025304 Bacteria 56365
78 Ga0207656_10022656 3300025321 Bacteria 2522
79 Ga0207680_10010398 3300025903 Bacteria 4652
80 Ga0207647_10001726 3300025904 Bacteria 16752
81 Ga0207705_10008886 3300025909 Bacteria 7322
82 Ga0207654_10009517 3300025911 Bacteria 4937
83 Ga0207654_10185831 3300025911 Bacteria 1359
84 Ga0207695_10005689 3300025913 Bacteria 16443
85 Ga0207671_10006833 3300025914 Bacteria 10074
86 Ga0207671_10009831 3300025914 Bacteria 7959
87 Ga0207671_10394320 3300025914 Bacteria 1101
88 Ga0207657_10011750 3300025919 Bacteria 8673
89 Ga0207657_10168059 3300025919 Bacteria 1778
90 Ga0207694_10016124 3300025924 Bacteria 5638
91 Ga0207650_10080694 3300025925 Bacteria 2467
92 Ga0207706_10004690 3300025933 Bacteria 12810
93 Ga0207706_10060263 3300025933 Bacteria 3342
94 Ga0207670_10056854 3300025936 Bacteria 2651
95 Ga0207711_10009629 3300025941 Bacteria 8051
96 Ga0207661_10589717 3300025944 Bacteria 1020
97 Ga0207667_10021852 3300025949 Bacteria 7081
98 Ga0207668_10002163 3300025972 Bacteria 11461
99 Ga0207668_10010224 3300025972 Bacteria 5664
100 Ga0207668_10165483 3300025972 Bacteria 1728
101 Ga0207640_10058944 3300025981 Bacteria 2531
102 Ga0207640_10139065 3300025981 Bacteria 1767
103 Ga0207658_10000263 3300025986 Bacteria 55175
104 Ga0207703_10065213 3300026035 Bacteria 2992
105 Ga0207639_10396084 3300026041 Bacteria 1243
106 Ga0207678_10023926 3300026067 Bacteria 5341
107 Ga0207702_10003500 3300026078 Bacteria 14313
108 Ga0207641_10000029 3300026088 Bacteria 229383
109 Ga0207641_10000991 3300026088 Bacteria 29011
110 Ga0207674_10031133 3300026116 Bacteria 5606
111 Ga0207674_10063370 3300026116 Bacteria 3732
112 Ga0207698_10001620 3300026142 Bacteria 13098
113 Ga0209813_10000036 3300027866 Bacteria 58545
114 Ga0268266_10000009 3300028379 Bacteria 1097737
115 Ga0268264_10000184 3300028381 Bacteria 131402
116 Ga0307412_10006092 3300031911 Bacteria 6792
117 Ga0307412_10007474 3300031911 Bacteria 6199
118 Ga0307412_10091613 3300031911 Bacteria 2128
119 Ga0307412_10131507 3300031911 Bacteria 1818
120 Ga0316574_0270036 3300035398 Bacteria 1085
121 Ga0436364_0184827 3300037853 Bacteria 146498
122 Ga0237819_01938 3300038705 Bacteria 4701
123 Ga0400483_060644 3300039062 Bacteria 3007
124 Ga0451798_1171132 3300041458 Bacteria 1283
125 Ga0451806_574197 3300041462 Bacteria 11493
126 Ga0451849_0429861 3300041505 Bacteria 2122
127 Ga0495627_001304 3300046453 Bacteria 15211
128 Ga0495627_049324 3300046453 Bacteria 1271
129 Ga0495638_0266065 3300046460 Bacteria 938
130 Ga0495650_0001651 3300046471 Bacteria 20626
131 Ga0495650_0002398 3300046471 Bacteria 15306
132 Ga0495650_0041217 3300046471 Bacteria 1976
133 Ga0495596_0000230 3300046500 Bacteria 37798
134 Ga0495596_0001475 3300046500 Bacteria 13466
135 Ga0495596_0003652 3300046500 Bacteria 7720
136 Ga0495607_0013092 3300046501 Bacteria 5447
137 Ga0495607_0025517 3300046501 Bacteria 3675
138 Ga0495607_0028252 3300046501 Bacteria 3462
139 Ga0495583_0062597 3300046506 Bacteria 1656
140 Ga0495610_0000238 3300046512 Bacteria 57907
141 Ga0495610_0002803 3300046512 Bacteria 14242
142 Ga0495610_0005038 3300046512 Bacteria 9542
143 Ga0495616_0000483 3300046513 Bacteria 30296
144 Ga0495620_0009851 3300046515 Bacteria 5062
145 Ga0495632_0017965 3300046519 Bacteria 3890
146 Ga0495637_0002193 3300046520 Bacteria 10919
147 Ga0495637_0006070 3300046520 Bacteria 6102
148 Ga0495637_0023301 3300046520 Bacteria 2816
149 Ga0495643_0000038 3300046522 Bacteria 236010
150 Ga0495643_0028994 3300046522 Bacteria 3099
151 Ga0495643_0029621 3300046522 Bacteria 3061
152 Ga0495648_0012017 3300046524 Bacteria 6487
153 Ga0495654_0010360 3300046530 Bacteria 5072
154 Ga0495609_0001296 3300046538 Bacteria 17067
155 Ga0495609_0005153 3300046538 Bacteria 6956
156 Ga0495597_0008567 3300046542 Bacteria 5116
157 Ga0495668_0002162 3300046616 Bacteria 16877
158 Ga0495668_0013780 3300046616 Bacteria 4756
159 Ga0495668_0130737 3300046616 Bacteria 1374
160 Ga0495625_0002838 3300046660 Bacteria 18205
161 Ga0495625_0215569 3300046660 Bacteria 1260
162 Ga0495670_0000009 3300046691 Bacteria 210956
163 Ga0495671_0000027 3300046692 Bacteria 236011
164 Ga0495671_0054413 3300046692 Bacteria 1984
165 Ga0495681_0000825 3300047470 Bacteria 23900
166 Ga0495681_0001901 3300047470 Bacteria 15333
167 Ga0495681_0023410 3300047470 Bacteria 3282
168 Ga0495686_0000057 3300047472 Bacteria 250088
169 Ga0495686_0040529 3300047472 Bacteria 2970
170 Ga0495615_0000038 3300048090 Bacteria 43468
171 Ga0495626_0001450 3300048091 Bacteria 18771
172 Ga0496100_0293679 3300048903 Bacteria 1215
173 Ga0496102_0000049 3300048905 Bacteria 179480
174 Ga0496103_0000037 3300048906 Bacteria 179474
175 Ga0496107_0072500 3300048910 Bacteria 2504
176 Ga0496115_0033041 3300048918 Bacteria 4084
177 Ga0496116_0000028 3300048919 Bacteria 424086
178 Ga0496116_0001001 3300048919 Bacteria 34554
179 Ga0496116_0090169 3300048919 Bacteria 1867
180 Ga0496117_0000115 3300048920 Bacteria 179488
181 Ga0496117_0012184 3300048920 Bacteria 7609
182 Ga0496117_0035114 3300048920 Bacteria 3768
183 Ga0496118_0000086 3300048921 Bacteria 179488
184 Ga0496118_0010619 3300048921 Bacteria 9093
185 Ga0496118_0019054 3300048921 Bacteria 6151
186 Ga0496118_0052724 3300048921 Bacteria 3099
187 Ga0496120_0042982 3300048923 Bacteria 2636
188 Ga0496121_0003807 3300048924 Bacteria 21025
189 Ga0496122_0001673 3300048925 Bacteria 34402
190 Ga0496122_0004560 3300048925 Bacteria 17079
191 Ga0496122_0004749 3300048925 Bacteria 16649
192 Ga0496122_0013475 3300048925 Bacteria 8000
193 Ga0496122_0036108 3300048925 Bacteria 4005
194 Ga0496123_0001239 3300048926 Bacteria 37030
195 Ga0496123_0001839 3300048926 Bacteria 27851
196 Ga0496123_0008555 3300048926 Bacteria 9379
197 Ga0496123_0025140 3300048926 Bacteria 4499
198 Ga0496123_0068006 3300048926 Bacteria 2246
199 Ga0496123_0139473 3300048926 Bacteria 1328
200 Ga0496124_0000102 3300048927 Bacteria 179488
201 Ga0496124_0001648 3300048927 Bacteria 31950
202 Ga0496124_0002678 3300048927 Bacteria 22823
203 Ga0496124_0002897 3300048927 Bacteria 21645
204 Ga0496124_0007794 3300048927 Bacteria 11310
205 Ga0496124_0036546 3300048927 Bacteria 4283
206 Ga0496124_0195012 3300048927 Bacteria 1546
207 Ga0496125_0166751 3300048928 Bacteria 1487
208 Ga0496125_0190693 3300048928 Bacteria 1354
209 Ga0496125_0224106 3300048928 Bacteria 1208
210 Ga0496126_0000124 3300048929 Bacteria 180422
211 Ga0496126_0151153 3300048929 Bacteria 1990
212 Ga0495678_008199 3300049459 Bacteria 5302
213 Ga0501043_0244128 3300049579 Bacteria 1384
214 Ga0501047_0000447 3300049581 Bacteria 45607
215 Ga0501048_0037897 3300049582 Bacteria 3462
216 nmdc:mga03n38_9472_c1 3300050490 Bacteria 3546
217 nmdc:mga06z11_111_c1 3300050494 Bacteria 33603
218 nmdc:mga04h51_792_c1 3300050495 Bacteria 7342
219 nmdc:mga07m45_24110_c1 3300050496 Bacteria 3330
220 Ga0500643_000166 3300053087 Bacteria 65586
221 Ga0500643_003725 3300053087 Bacteria 7166
222 Ga0500643_004858 3300053087 Bacteria 5934
223 Ga0500643_005491 3300053087 Bacteria 5457
224 Ga0500647_0019384 3300053091 Bacteria 3158
225 Ga0500651_0002584 3300053093 Bacteria 9614
226 Ga0500592_004940 3300053116 Bacteria 2117
227 Ga0500618_007827 3300053125 Bacteria 3019
228 Ga0500618_009093 3300053125 Bacteria 2731
229 Ga0500655_000094 3300053133 Bacteria 23193
230 Ga0500655_020628 3300053133 Bacteria 1232
231 Ga0500559_0149056 3300053136 Bacteria 1097
232 Ga0500590_002974 3300053148 Bacteria 7697
233 Ga0500604_0001506 3300053151 Bacteria 6521
234 Ga0500616_0005494 3300053153 Bacteria 8598
235 Ga0500622_0004446 3300053156 Bacteria 8803
236 Ga0500624_000044 3300053157 Bacteria 90094
237 Ga0500624_000190 3300053157 Bacteria 24336
238 Ga0500627_0000578 3300053158 Bacteria 9863
239 Ga0500627_0032167 3300053158 Bacteria 2209
240 Ga0500639_024616 3300053163 Bacteria 3182
241 Ga0500636_0031133 3300053177 Bacteria 3156
242 Ga0500636_0035542 3300053177 Bacteria 2948
243 Ga0500570_000135 3300053724 Bacteria 21948

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10079869 rootH1_100798691 266
2 3300003758 Ga0055532_1008211 Ga0055532_10082112 269
3 3300047472 Ga0495686_0000057 Ga0495686_0000057_168563_169375 270
4 3300053136 Ga0500559_0149056 Ga0500559_0149056_18_836 272
5 3300001989 JGI24739J22299_10002985 JGI24739J22299_100029853 273
6 3300001990 JGI24737J22298_10001355 JGI24737J22298_100013556 273
7 3300002067 JGI24735J21928_10000680 JGI24735J21928_1000068011 273
8 3300002067 JGI24735J21928_10016971 JGI24735J21928_100169712 273
9 3300002070 JGI24750J21931_1000274 JGI24750J21931_10002742 273
10 3300002075 JGI24738J21930_10000394 JGI24738J21930_100003947 273
11 3300005330 Ga0070690_100000202 Ga0070690_10000020222 273
12 3300005335 Ga0070666_10000053 Ga0070666_100000537 273
13 3300005339 Ga0070660_100242541 Ga0070660_1002425411 273
14 3300005355 Ga0070671_100060135 Ga0070671_1000601352 273
15 3300005367 Ga0070667_100008626 Ga0070667_1000086265 273
16 3300005457 Ga0070662_100007415 Ga0070662_1000074153 273
17 3300005544 Ga0070686_100000050 Ga0070686_1000000507 273
18 3300013307 Ga0157372_10041206 Ga0157372_100412065 273
19 3300025919 Ga0207657_10011750 Ga0207657_100117508 273
20 3300025936 Ga0207670_10056854 Ga0207670_100568543 273
21 3300025972 Ga0207668_10165483 Ga0207668_101654832 273
22 3300028379 Ga0268266_10000009 Ga0268266_10000009510 273
23 3300046460 Ga0495638_0266065 Ga0495638_0266065_99_923 273
24 3300048910 Ga0496107_0072500 Ga0496107_0072500_51_872 273
25 3300053133 Ga0500655_020628 Ga0500655_020628_379_1203 273
26 3300046453 Ga0495627_049324 Ga0495627_049324_28_891 279
27 3300053087 Ga0500643_004858 Ga0500643_004858_889_1752 279
28 3300053157 Ga0500624_000190 Ga0500624_000190_2639_3502 279
29 3300053177 Ga0500636_0031133 Ga0500636_0031133_506_1369 279
30 3300005577 Ga0068857_100025246 Ga0068857_1000252467 294
31 3300025254 Ga0209148_1003499 Ga0209148_10034994 294
32 3300025272 Ga0209455_1001069 Ga0209455_100106913 294
33 3300025909 Ga0207705_10008886 Ga0207705_100088864 294
34 iso_pu_bacteria 2830075706 2830077885 294
35 3300013307 Ga0157372_10045606 Ga0157372_100456065 295
36 3300035398 Ga0316574_0270036 Ga0316574_0270036_17_922 295
37 3300039062 Ga0400483_060644 Ga0400483_060644_1305_2243 295
38 iso_pu_bacteria 2512564014 2512644047 295
39 iso_pu_bacteria 2808606401 2809064817 295
40 iso_pu_bacteria 2808606404 2809080784 295
41 iso_pu_bacteria 2808606405 2809085149 295
42 iso_pu_bacteria 2880518877 2880521846 295
43 iso_pu_bacteria 2919709256 2919711347 295
44 3300006051 Ga0075364_10175974 Ga0075364_101759742 296
45 3300046500 Ga0495596_0001475 Ga0495596_0001475_133_1023 296
46 3300046501 Ga0495607_0025517 Ga0495607_0025517_2199_3089 296
47 3300046512 Ga0495610_0005038 Ga0495610_0005038_6837_7727 296
48 3300046519 Ga0495632_0017965 Ga0495632_0017965_624_1514 296
49 3300046522 Ga0495643_0029621 Ga0495643_0029621_1092_1982 296
50 3300046538 Ga0495609_0001296 Ga0495609_0001296_2053_2943 296
51 3300047470 Ga0495681_0023410 Ga0495681_0023410_2356_3246 296
52 3300047472 Ga0495686_0040529 Ga0495686_0040529_1041_1931 296
53 3300005842 Ga0068858_100058890 Ga0068858_1000588904 297
54 3300026035 Ga0207703_10065213 Ga0207703_100652132 297
55 3300046524 Ga0495648_0012017 Ga0495648_0012017_3444_4337 297
56 3300048919 Ga0496116_0090169 Ga0496116_0090169_237_1133 297
57 3300048920 Ga0496117_0012184 Ga0496117_0012184_4773_5669 297
58 3300048921 Ga0496118_0019054 Ga0496118_0019054_1251_2147 297
59 3300048927 Ga0496124_0007794 Ga0496124_0007794_41_937 297
60 iso_pu_bacteria 2510917021 2511128799 297
61 iso_pu_bacteria 2599185354 2600202582 297
62 iso_pu_bacteria 2599185359 2600226131 297
63 iso_pu_bacteria 2643221541 2643728142 297
64 iso_pu_bacteria 2643221606 2644042909 297
65 iso_pu_bacteria 2643221671 2644395660 297
66 iso_pu_bacteria 2818991466 2819712822 297
67 iso_pu_bacteria 2885429604 2885431246 297
68 iso_pu_bacteria 2928027323 2928027673 297
69 iso_pu_bacteria 2928526807 2928527415 297
70 iso_pu_bacteria 2928968154 2928969099 297
71 iso_pu_bacteria 2946787523 2946788760 297
72 iso_pu_bacteria 2984555340 2984558034 297
73 iso_pu_bacteria 2984564862 2984567599 297
74 iso_pu_bacteria 2993356040 2993358651 297
75 iso_pu_bacteria 8054302542 8054303136 297
76 3300046520 Ga0495637_0002193 Ga0495637_0002193_3489_4385 298
77 3300046520 Ga0495637_0023301 Ga0495637_0023301_1088_1984 298
78 3300046522 Ga0495643_0000038 Ga0495643_0000038_200980_201876 298
79 3300046692 Ga0495671_0000027 Ga0495671_0000027_34136_35032 298
80 3300047470 Ga0495681_0000825 Ga0495681_0000825_16461_17357 298
81 3300049459 Ga0495678_008199 Ga0495678_008199_3014_3910 298
82 3300053087 Ga0500643_003725 Ga0500643_003725_1693_2604 298
83 3300053125 Ga0500618_007827 Ga0500618_007827_1460_2356 298
84 iso_pu_bacteria 2751185897 2753764375 298
85 3300005262 Ga0065165_1014240 Ga0065165_10142401 299
86 3300005331 Ga0070670_100121719 Ga0070670_1001217193 299
87 3300005335 Ga0070666_10013892 Ga0070666_100138921 299
88 3300005347 Ga0070668_100002872 Ga0070668_10000287214 299
89 3300005841 Ga0068863_100000093 Ga0068863_10000009341 299
90 3300006048 Ga0075363_100017596 Ga0075363_1000175963 299
91 3300006178 Ga0075367_10095587 Ga0075367_100955872 299
92 3300015690 Ga0183363_1001 Ga0183363_1001406 299
93 3300025298 Ga0209050_1000582 Ga0209050_100058226 299
94 3300025299 Ga0209256_1036863 Ga0209256_10368631 299
95 3300025903 Ga0207680_10010398 Ga0207680_100103981 299
96 3300025925 Ga0207650_10080694 Ga0207650_100806942 299
97 3300025972 Ga0207668_10002163 Ga0207668_100021632 299
98 3300026088 Ga0207641_10000029 Ga0207641_10000029179 299
99 3300027866 Ga0209813_10000036 Ga0209813_1000003621 299
100 3300046471 Ga0495650_0001651 Ga0495650_0001651_6041_6940 299
101 3300046513 Ga0495616_0000483 Ga0495616_0000483_23911_24810 299
102 3300046616 Ga0495668_0013780 Ga0495668_0013780_1944_2843 299
103 3300048918 Ga0496115_0033041 Ga0496115_0033041_2609_3517 299
104 3300050490 nmdc:mga03n38_9472_c1 nmdc:mga03n38_9472_c1_1632_2534 299
105 3300050494 nmdc:mga06z11_111_c1 nmdc:mga06z11_111_c1_843_1745 299
106 3300050495 nmdc:mga04h51_792_c1 nmdc:mga04h51_792_c1_6332_7234 299
107 3300050496 nmdc:mga07m45_24110_c1 nmdc:mga07m45_24110_c1_1003_1905 299
108 3300053151 Ga0500604_0001506 Ga0500604_0001506_499_1398 299
109 3300053157 Ga0500624_000044 Ga0500624_000044_89044_89952 299
110 3300053158 Ga0500627_0032167 Ga0500627_0032167_148_1047 299
111 3300013105 Ga0157369_10362340 Ga0157369_103623402 300
112 3300038705 Ga0237819_01938 Ga0237819_01938_3240_4142 300
113 3300046471 Ga0495650_0041217 Ga0495650_0041217_716_1618 300
114 3300046500 Ga0495596_0000230 Ga0495596_0000230_30260_31162 300
115 3300046501 Ga0495607_0028252 Ga0495607_0028252_514_1416 300
116 3300046506 Ga0495583_0062597 Ga0495583_0062597_253_1155 300
117 3300046538 Ga0495609_0005153 Ga0495609_0005153_609_1511 300
118 3300046616 Ga0495668_0130737 Ga0495668_0130737_135_1037 300
119 3300046660 Ga0495625_0002838 Ga0495625_0002838_9164_10066 300
120 3300053153 Ga0500616_0005494 Ga0500616_0005494_2435_3448 300
121 3300001904 JGI24736J21556_1000023 JGI24736J21556_100002310 301
122 3300001979 JGI24740J21852_10010247 JGI24740J21852_100102475 301
123 3300001989 JGI24739J22299_10001293 JGI24739J22299_100012936 301
124 3300001990 JGI24737J22298_10002290 JGI24737J22298_100022906 301
125 3300002067 JGI24735J21928_10004282 JGI24735J21928_100042822 301
126 3300002075 JGI24738J21930_10005723 JGI24738J21930_100057232 301
127 3300002774 JGI25150J39212_1000285 JGI25150J39212_100028516 301
128 3300003215 JGI25153J46596_10000044 JGI25153J46596_1000004474 301
129 3300003771 Ga0055526_1000860 Ga0055526_10008604 301
130 3300003773 Ga0055537_1004587 Ga0055537_10045872 301
131 3300003781 Ga0055536_1018702 Ga0055536_10187023 301
132 3300003791 Ga0055530_10032453 Ga0055530_100324532 301
133 3300003792 Ga0055540_1011306 Ga0055540_10113061 301
134 3300005329 Ga0070683_100378512 Ga0070683_1003785122 301
135 3300005347 Ga0070668_100006427 Ga0070668_1000064272 301
136 3300005366 Ga0070659_100165498 Ga0070659_1001654982 301
137 3300005457 Ga0070662_100387352 Ga0070662_1003873521 301
138 3300005577 Ga0068857_100030286 Ga0068857_1000302865 301
139 3300005577 Ga0068857_100330212 Ga0068857_1003302122 301
140 3300005578 Ga0068854_100054904 Ga0068854_1000549043 301
141 3300005617 Ga0068859_100107091 Ga0068859_1001070913 301
142 3300006051 Ga0075364_10055374 Ga0075364_100553741 301
143 3300006931 Ga0097620_100107091 Ga0097620_1001070913 301
144 3300009093 Ga0105240_10789452 Ga0105240_107894521 301
145 3300009177 Ga0105248_10004227 Ga0105248_100042274 301
146 3300013104 Ga0157370_10036925 Ga0157370_100369253 301
147 3300013105 Ga0157369_10023012 Ga0157369_100230122 301
148 3300013307 Ga0157372_10190902 Ga0157372_101909022 301
149 3300017792 Ga0163161_10233485 Ga0163161_102334851 301
150 3300021388 Ga0213875_10000105 Ga0213875_1000010530 301
151 3300025245 Ga0207425_1000026 Ga0207425_1000026169 301
152 3300025258 Ga0209129_1002266 Ga0209129_10022666 301
153 3300025263 Ga0209565_1000064 Ga0209565_100006496 301
154 3300025273 Ga0209673_1019664 Ga0209673_10196643 301
155 3300025294 Ga0209025_1000726 Ga0209025_100072618 301
156 3300025295 Ga0209564_1002791 Ga0209564_100279111 301
157 3300025295 Ga0209564_1031460 Ga0209564_10314601 301
158 3300025297 Ga0209758_1000004 Ga0209758_10000041111 301
159 3300025297 Ga0209758_1018748 Ga0209758_10187484 301
160 3300025298 Ga0209050_1000001 Ga0209050_10000013107 301
161 3300025298 Ga0209050_1021547 Ga0209050_10215472 301
162 3300025303 Ga0209051_1000793 Ga0209051_10007938 301
163 3300025304 Ga0209257_1000617 Ga0209257_100061724 301
164 3300025304 Ga0209257_1000633 Ga0209257_100063324 301
165 3300025321 Ga0207656_10022656 Ga0207656_100226562 301
166 3300025904 Ga0207647_10001726 Ga0207647_1000172610 301
167 3300025911 Ga0207654_10009517 Ga0207654_100095176 301
168 3300025911 Ga0207654_10185831 Ga0207654_101858311 301
169 3300025913 Ga0207695_10005689 Ga0207695_100056899 301
170 3300025914 Ga0207671_10006833 Ga0207671_100068339 301
171 3300025914 Ga0207671_10009831 Ga0207671_100098318 301
172 3300025914 Ga0207671_10394320 Ga0207671_103943201 301
173 3300025919 Ga0207657_10168059 Ga0207657_101680591 301
174 3300025924 Ga0207694_10016124 Ga0207694_100161241 301
175 3300025933 Ga0207706_10004690 Ga0207706_1000469015 301
176 3300025933 Ga0207706_10060263 Ga0207706_100602633 301
177 3300025941 Ga0207711_10009629 Ga0207711_100096293 301
178 3300025944 Ga0207661_10589717 Ga0207661_105897171 301
179 3300025949 Ga0207667_10021852 Ga0207667_100218523 301
180 3300025972 Ga0207668_10010224 Ga0207668_100102241 301
181 3300025981 Ga0207640_10058944 Ga0207640_100589442 301
182 3300025981 Ga0207640_10139065 Ga0207640_101390651 301
183 3300025986 Ga0207658_10000263 Ga0207658_1000026341 301
184 3300026041 Ga0207639_10396084 Ga0207639_103960842 301
185 3300026067 Ga0207678_10023926 Ga0207678_100239263 301
186 3300026078 Ga0207702_10003500 Ga0207702_100035007 301
187 3300026088 Ga0207641_10000991 Ga0207641_100009916 301
188 3300026116 Ga0207674_10031133 Ga0207674_100311335 301
189 3300026116 Ga0207674_10063370 Ga0207674_100633704 301
190 3300026142 Ga0207698_10001620 Ga0207698_100016208 301
191 3300028381 Ga0268264_10000184 Ga0268264_1000018441 301
192 3300031911 Ga0307412_10006092 Ga0307412_100060925 301
193 3300031911 Ga0307412_10007474 Ga0307412_100074746 301
194 3300031911 Ga0307412_10091613 Ga0307412_100916132 301
195 3300031911 Ga0307412_10131507 Ga0307412_101315071 301
196 3300037853 Ga0436364_0184827 Ga0436364_0184827_90666_91622 301
197 3300041458 Ga0451798_1171132 Ga0451798_1171132_234_1163 301
198 3300041462 Ga0451806_574197 Ga0451806_574197_9499_10428 301
199 3300041505 Ga0451849_0429861 Ga0451849_0429861_527_1456 301
200 3300046453 Ga0495627_001304 Ga0495627_001304_7064_7975 301
201 3300046471 Ga0495650_0002398 Ga0495650_0002398_7237_8148 301
202 3300046500 Ga0495596_0003652 Ga0495596_0003652_3447_4376 301
203 3300046501 Ga0495607_0013092 Ga0495607_0013092_1030_1947 301
204 3300046512 Ga0495610_0000238 Ga0495610_0000238_56401_57312 301
205 3300046512 Ga0495610_0002803 Ga0495610_0002803_1835_2764 301
206 3300046515 Ga0495620_0009851 Ga0495620_0009851_2407_3318 301
207 3300046520 Ga0495637_0006070 Ga0495637_0006070_642_1550 301
208 3300046522 Ga0495643_0028994 Ga0495643_0028994_342_1385 301
209 3300046530 Ga0495654_0010360 Ga0495654_0010360_2176_3114 301
210 3300046542 Ga0495597_0008567 Ga0495597_0008567_3404_4312 301
211 3300046616 Ga0495668_0002162 Ga0495668_0002162_4040_4978 301
212 3300046660 Ga0495625_0215569 Ga0495625_0215569_24_938 301
213 3300046691 Ga0495670_0000009 Ga0495670_0000009_125911_126837 301
214 3300046692 Ga0495671_0054413 Ga0495671_0054413_936_1877 301
215 3300047470 Ga0495681_0001901 Ga0495681_0001901_7186_8097 301
216 3300048090 Ga0495615_0000038 Ga0495615_0000038_24602_25513 301
217 3300048091 Ga0495626_0001450 Ga0495626_0001450_7918_8847 301
218 3300048903 Ga0496100_0293679 Ga0496100_0293679_72_983 301
219 3300048905 Ga0496102_0000049 Ga0496102_0000049_105003_105950 301
220 3300048906 Ga0496103_0000037 Ga0496103_0000037_73525_74472 301
221 3300048919 Ga0496116_0000028 Ga0496116_0000028_408624_409535 301
222 3300048919 Ga0496116_0001001 Ga0496116_0001001_2294_3241 301
223 3300048920 Ga0496117_0000115 Ga0496117_0000115_105003_105950 301
224 3300048920 Ga0496117_0035114 Ga0496117_0035114_487_1401 301
225 3300048921 Ga0496118_0000086 Ga0496118_0000086_73539_74486 301
226 3300048921 Ga0496118_0010619 Ga0496118_0010619_7513_8424 301
227 3300048921 Ga0496118_0052724 Ga0496118_0052724_982_1935 301
228 3300048923 Ga0496120_0042982 Ga0496120_0042982_471_1385 301
229 3300048924 Ga0496121_0003807 Ga0496121_0003807_6968_7882 301
230 3300048925 Ga0496122_0001673 Ga0496122_0001673_18007_18918 301
231 3300048925 Ga0496122_0004560 Ga0496122_0004560_1295_2209 301
232 3300048925 Ga0496122_0004749 Ga0496122_0004749_14479_15390 301
233 3300048925 Ga0496122_0013475 Ga0496122_0013475_6520_7431 301
234 3300048925 Ga0496122_0036108 Ga0496122_0036108_2172_3113 301
235 3300048926 Ga0496123_0001239 Ga0496123_0001239_33191_34102 301
236 3300048926 Ga0496123_0001839 Ga0496123_0001839_13476_14387 301
237 3300048926 Ga0496123_0008555 Ga0496123_0008555_2190_3131 301
238 3300048926 Ga0496123_0025140 Ga0496123_0025140_2457_3404 301
239 3300048926 Ga0496123_0068006 Ga0496123_0068006_1276_2217 301
240 3300048926 Ga0496123_0139473 Ga0496123_0139473_343_1257 301
241 3300048927 Ga0496124_0000102 Ga0496124_0000102_73539_74486 301
242 3300048927 Ga0496124_0001648 Ga0496124_0001648_2690_3631 301
243 3300048927 Ga0496124_0002678 Ga0496124_0002678_16957_17916 301
244 3300048927 Ga0496124_0002897 Ga0496124_0002897_15422_16363 301
245 3300048927 Ga0496124_0036546 Ga0496124_0036546_1657_2568 301
246 3300048927 Ga0496124_0195012 Ga0496124_0195012_485_1432 301
247 3300048928 Ga0496125_0166751 Ga0496125_0166751_213_1127 301
248 3300048928 Ga0496125_0190693 Ga0496125_0190693_295_1236 301
249 3300048928 Ga0496125_0224106 Ga0496125_0224106_243_1148 301
250 3300048929 Ga0496126_0000124 Ga0496126_0000124_13673_14584 301
251 3300048929 Ga0496126_0151153 Ga0496126_0151153_1037_1978 301
252 3300049579 Ga0501043_0244128 Ga0501043_0244128_268_1215 301
253 3300049581 Ga0501047_0000447 Ga0501047_0000447_17606_18553 301
254 3300049582 Ga0501048_0037897 Ga0501048_0037897_673_1620 301
255 3300053087 Ga0500643_000166 Ga0500643_000166_40836_41747 301
256 3300053087 Ga0500643_005491 Ga0500643_005491_3532_4446 301
257 3300053091 Ga0500647_0019384 Ga0500647_0019384_1275_2183 301
258 3300053093 Ga0500651_0002584 Ga0500651_0002584_2730_3638 301
259 3300053116 Ga0500592_004940 Ga0500592_004940_416_1327 301
260 3300053125 Ga0500618_009093 Ga0500618_009093_338_1246 301
261 3300053133 Ga0500655_000094 Ga0500655_000094_17341_18249 301
262 3300053148 Ga0500590_002974 Ga0500590_002974_5378_6286 301
263 3300053156 Ga0500622_0004446 Ga0500622_0004446_5022_5930 301
264 3300053158 Ga0500627_0000578 Ga0500627_0000578_1963_2901 301
265 3300053163 Ga0500639_024616 Ga0500639_024616_1233_2141 301
266 3300053177 Ga0500636_0035542 Ga0500636_0035542_95_1003 301
267 3300053724 Ga0500570_000135 Ga0500570_000135_460_1368 301
268 iso_pu_bacteria 2818991438 2819553374 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

18

290

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8szt-assembly1.cif.gz_A structure of kdac1 from acinetobacter baumannii 0.8517 1 294
5eek-assembly1.cif.gz_A crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 in complex with trichostatin a 0.8498 1 292
8g20-assembly2.cif.gz_B crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 complexed with inhibitor mz327 0.8496 1 292
6vnr-assembly2.cif.gz_B crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 (cd2) complexed with bishydroxamic acid inhibitor 0.8493 1 292
8szt-assembly1.cif.gz_C-2 structure of kdac1 from acinetobacter baumannii 0.8491 2 294
ID Description Score Start End Superfamily
af_X1WCM6_55_351_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9483 6 293 3.40.800.20
af_X1WCM6_55_351_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9174 6 293 3.40.800.20
af_Q18477_16_331_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.8859 1 294 3.40.800.20
af_Q5Z608_39_349_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.8837 5 294 3.40.800.20
af_A0A1D6N7T5_1_214_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.873 127 294 3.40.800.20
ID Description Score Start End GO Terms
AF-A0A2A5YMV6-F1-model_v4 Histone deacetylase 0.9929 154 294 GO:0004407
GO:0040029
AF-A0A0N0M334-F1-model_v4 Histone deacetylase 0.9816 1 294 GO:0004407
GO:0040029
AF-A0A1B6JU28-F1-model_v4 Histone deacetylase domain-containing protein 0.9812 148 294 GO:0004407
GO:0040029
AF-A0A3N5DJJ7-F1-model_v4 Histone deacetylase 0.9783 1 296 GO:0004407
GO:0040029
AF-A0A219B8H5-F1-model_v4 Histone deacetylase 0.9766 24 294 GO:0004407
GO:0040029

Feature Viewer

pLDDT pTM Quality
86.93 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map