F375845
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 182 | 243 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300053153|Ga0500616_0005494|Ga0500616_0005494_2435_3448 |
| Length | 337 |
| Sequence | MHVVHHPFYVAPGTPGTGMRFDKYGLVMEALREADLPLTLHQPDPMPRRWIEAVHDPAYVEEVLTLSVPKAKERRIGFPVTERVALRAQLSPGGTWQAARLALIDGYAANAAGGSHHALADTGAGYCVFNDLVIAANRLIAERDAARILILDLDVHQGDGSAALTAGRDDIFTLSIHAEHNFPERKARSTLDMPLPDGTDDRTYLAVLRETLPKVLDDFAPDLILYQAGVDPHIDDRLGRLALTDQGLIARDRFVASLARSGSIPLASTLGGGYGTDRMAVARRHARSIMTMAALFDDRQPSGSSASKPSVTAHGRHPVLEENVDLPTSSTHGVGRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 6 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 7 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 8 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 9 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 10 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 11 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 12 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 13 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 14 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 15 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 16 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 17 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 18 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 19 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 20 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 21 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 22 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 23 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 24 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 25 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 26 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 27 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 28 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 70 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 113 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 114 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 115 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 116 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 119 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 149 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 150 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 151 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 152 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 153 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 154 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 155 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 156 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 157 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 158 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 163 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 165 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 166 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 167 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 168 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 169 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 170 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 171 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 172 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 173 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 174 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 175 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 176 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 177 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 178 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 179 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 180 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 182 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.67 |
| Metatranscriptomes | 0 |
| Isolates | 9.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.12 |
| Bulb | 0 |
| Endosphere | 22.39 |
| Nodule | 0 |
| Rhizoplane | 3.36 |
| Rhizosphere | 54.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000023 | 3300001904 | Bacteria | 25735 |
| 2 | JGI24740J21852_10010247 | 3300001979 | Bacteria | 3621 |
| 3 | JGI24739J22299_10001293 | 3300001989 | Bacteria | 9413 |
| 4 | JGI24739J22299_10002985 | 3300001989 | Bacteria | 6472 |
| 5 | JGI24737J22298_10001355 | 3300001990 | Bacteria | 8672 |
| 6 | JGI24737J22298_10002290 | 3300001990 | Bacteria | 6807 |
| 7 | JGI24735J21928_10000680 | 3300002067 | Bacteria | 12054 |
| 8 | JGI24735J21928_10004282 | 3300002067 | Bacteria | 4810 |
| 9 | JGI24735J21928_10016971 | 3300002067 | Bacteria | 2254 |
| 10 | JGI24750J21931_1000274 | 3300002070 | Bacteria | 8836 |
| 11 | JGI24738J21930_10000394 | 3300002075 | Bacteria | 12190 |
| 12 | JGI24738J21930_10005723 | 3300002075 | Bacteria | 2958 |
| 13 | JGI25150J39212_1000285 | 3300002774 | Bacteria | 26336 |
| 14 | JGI25153J46596_10000044 | 3300003215 | Bacteria | 154263 |
| 15 | rootH1_10079869 | 3300003316 | Bacteria | 1212 |
| 16 | Ga0055532_1008211 | 3300003758 | Bacteria | 1310 |
| 17 | Ga0055526_1000860 | 3300003771 | Bacteria | 22629 |
| 18 | Ga0055537_1004587 | 3300003773 | Bacteria | 3918 |
| 19 | Ga0055536_1018702 | 3300003781 | Bacteria | 2210 |
| 20 | Ga0055530_10032453 | 3300003791 | Bacteria | 1358 |
| 21 | Ga0055540_1011306 | 3300003792 | Bacteria | 2889 |
| 22 | Ga0065165_1014240 | 3300005262 | Bacteria | 3099 |
| 23 | Ga0070683_100378512 | 3300005329 | Bacteria | 1349 |
| 24 | Ga0070690_100000202 | 3300005330 | Bacteria | 31141 |
| 25 | Ga0070670_100121719 | 3300005331 | Bacteria | 2251 |
| 26 | Ga0070666_10000053 | 3300005335 | Bacteria | 97883 |
| 27 | Ga0070666_10013892 | 3300005335 | Bacteria | 5116 |
| 28 | Ga0070660_100242541 | 3300005339 | Bacteria | 1468 |
| 29 | Ga0070668_100002872 | 3300005347 | Bacteria | 12701 |
| 30 | Ga0070668_100006427 | 3300005347 | Bacteria | 8714 |
| 31 | Ga0070671_100060135 | 3300005355 | Bacteria | 3163 |
| 32 | Ga0070659_100165498 | 3300005366 | Bacteria | 1809 |
| 33 | Ga0070667_100008626 | 3300005367 | Bacteria | 8449 |
| 34 | Ga0070662_100007415 | 3300005457 | Bacteria | 7113 |
| 35 | Ga0070662_100387352 | 3300005457 | Bacteria | 1151 |
| 36 | Ga0070686_100000050 | 3300005544 | Bacteria | 97879 |
| 37 | Ga0068857_100025246 | 3300005577 | Bacteria | 5233 |
| 38 | Ga0068857_100030286 | 3300005577 | Bacteria | 4778 |
| 39 | Ga0068857_100330212 | 3300005577 | Bacteria | 1409 |
| 40 | Ga0068854_100054904 | 3300005578 | Bacteria | 2867 |
| 41 | Ga0068859_100107091 | 3300005617 | Bacteria | 2855 |
| 42 | Ga0068863_100000093 | 3300005841 | Bacteria | 96862 |
| 43 | Ga0068858_100058890 | 3300005842 | Bacteria | 3551 |
| 44 | Ga0075363_100017596 | 3300006048 | Bacteria | 3547 |
| 45 | Ga0075364_10055374 | 3300006051 | Bacteria | 2595 |
| 46 | Ga0075364_10175974 | 3300006051 | Bacteria | 1447 |
| 47 | Ga0075367_10095587 | 3300006178 | Bacteria | 1812 |
| 48 | Ga0097620_100107091 | 3300006931 | Bacteria | 2855 |
| 49 | Ga0105240_10789452 | 3300009093 | Bacteria | 1029 |
| 50 | Ga0105248_10004227 | 3300009177 | Bacteria | 15883 |
| 51 | Ga0157370_10036925 | 3300013104 | Bacteria | 4739 |
| 52 | Ga0157369_10023012 | 3300013105 | Bacteria | 6946 |
| 53 | Ga0157369_10362340 | 3300013105 | Bacteria | 1505 |
| 54 | Ga0157372_10041206 | 3300013307 | Bacteria | 5105 |
| 55 | Ga0157372_10045606 | 3300013307 | Bacteria | 4864 |
| 56 | Ga0157372_10190902 | 3300013307 | Bacteria | 2373 |
| 57 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 58 | Ga0163161_10233485 | 3300017792 | Bacteria | 1428 |
| 59 | Ga0213875_10000105 | 3300021388 | Bacteria | 96051 |
| 60 | Ga0207425_1000026 | 3300025245 | Bacteria | 301303 |
| 61 | Ga0209148_1003499 | 3300025254 | Bacteria | 4305 |
| 62 | Ga0209129_1002266 | 3300025258 | Bacteria | 9607 |
| 63 | Ga0209565_1000064 | 3300025263 | Bacteria | 180732 |
| 64 | Ga0209455_1001069 | 3300025272 | Bacteria | 13510 |
| 65 | Ga0209673_1019664 | 3300025273 | Bacteria | 2417 |
| 66 | Ga0209025_1000726 | 3300025294 | Bacteria | 55863 |
| 67 | Ga0209564_1002791 | 3300025295 | Bacteria | 13034 |
| 68 | Ga0209564_1031460 | 3300025295 | Bacteria | 1621 |
| 69 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 70 | Ga0209758_1018748 | 3300025297 | Bacteria | 3375 |
| 71 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 72 | Ga0209050_1000582 | 3300025298 | Bacteria | 59096 |
| 73 | Ga0209050_1021547 | 3300025298 | Bacteria | 2345 |
| 74 | Ga0209256_1036863 | 3300025299 | Bacteria | 1279 |
| 75 | Ga0209051_1000793 | 3300025303 | Bacteria | 33269 |
| 76 | Ga0209257_1000617 | 3300025304 | Bacteria | 57694 |
| 77 | Ga0209257_1000633 | 3300025304 | Bacteria | 56365 |
| 78 | Ga0207656_10022656 | 3300025321 | Bacteria | 2522 |
| 79 | Ga0207680_10010398 | 3300025903 | Bacteria | 4652 |
| 80 | Ga0207647_10001726 | 3300025904 | Bacteria | 16752 |
| 81 | Ga0207705_10008886 | 3300025909 | Bacteria | 7322 |
| 82 | Ga0207654_10009517 | 3300025911 | Bacteria | 4937 |
| 83 | Ga0207654_10185831 | 3300025911 | Bacteria | 1359 |
| 84 | Ga0207695_10005689 | 3300025913 | Bacteria | 16443 |
| 85 | Ga0207671_10006833 | 3300025914 | Bacteria | 10074 |
| 86 | Ga0207671_10009831 | 3300025914 | Bacteria | 7959 |
| 87 | Ga0207671_10394320 | 3300025914 | Bacteria | 1101 |
| 88 | Ga0207657_10011750 | 3300025919 | Bacteria | 8673 |
| 89 | Ga0207657_10168059 | 3300025919 | Bacteria | 1778 |
| 90 | Ga0207694_10016124 | 3300025924 | Bacteria | 5638 |
| 91 | Ga0207650_10080694 | 3300025925 | Bacteria | 2467 |
| 92 | Ga0207706_10004690 | 3300025933 | Bacteria | 12810 |
| 93 | Ga0207706_10060263 | 3300025933 | Bacteria | 3342 |
| 94 | Ga0207670_10056854 | 3300025936 | Bacteria | 2651 |
| 95 | Ga0207711_10009629 | 3300025941 | Bacteria | 8051 |
| 96 | Ga0207661_10589717 | 3300025944 | Bacteria | 1020 |
| 97 | Ga0207667_10021852 | 3300025949 | Bacteria | 7081 |
| 98 | Ga0207668_10002163 | 3300025972 | Bacteria | 11461 |
| 99 | Ga0207668_10010224 | 3300025972 | Bacteria | 5664 |
| 100 | Ga0207668_10165483 | 3300025972 | Bacteria | 1728 |
| 101 | Ga0207640_10058944 | 3300025981 | Bacteria | 2531 |
| 102 | Ga0207640_10139065 | 3300025981 | Bacteria | 1767 |
| 103 | Ga0207658_10000263 | 3300025986 | Bacteria | 55175 |
| 104 | Ga0207703_10065213 | 3300026035 | Bacteria | 2992 |
| 105 | Ga0207639_10396084 | 3300026041 | Bacteria | 1243 |
| 106 | Ga0207678_10023926 | 3300026067 | Bacteria | 5341 |
| 107 | Ga0207702_10003500 | 3300026078 | Bacteria | 14313 |
| 108 | Ga0207641_10000029 | 3300026088 | Bacteria | 229383 |
| 109 | Ga0207641_10000991 | 3300026088 | Bacteria | 29011 |
| 110 | Ga0207674_10031133 | 3300026116 | Bacteria | 5606 |
| 111 | Ga0207674_10063370 | 3300026116 | Bacteria | 3732 |
| 112 | Ga0207698_10001620 | 3300026142 | Bacteria | 13098 |
| 113 | Ga0209813_10000036 | 3300027866 | Bacteria | 58545 |
| 114 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 115 | Ga0268264_10000184 | 3300028381 | Bacteria | 131402 |
| 116 | Ga0307412_10006092 | 3300031911 | Bacteria | 6792 |
| 117 | Ga0307412_10007474 | 3300031911 | Bacteria | 6199 |
| 118 | Ga0307412_10091613 | 3300031911 | Bacteria | 2128 |
| 119 | Ga0307412_10131507 | 3300031911 | Bacteria | 1818 |
| 120 | Ga0316574_0270036 | 3300035398 | Bacteria | 1085 |
| 121 | Ga0436364_0184827 | 3300037853 | Bacteria | 146498 |
| 122 | Ga0237819_01938 | 3300038705 | Bacteria | 4701 |
| 123 | Ga0400483_060644 | 3300039062 | Bacteria | 3007 |
| 124 | Ga0451798_1171132 | 3300041458 | Bacteria | 1283 |
| 125 | Ga0451806_574197 | 3300041462 | Bacteria | 11493 |
| 126 | Ga0451849_0429861 | 3300041505 | Bacteria | 2122 |
| 127 | Ga0495627_001304 | 3300046453 | Bacteria | 15211 |
| 128 | Ga0495627_049324 | 3300046453 | Bacteria | 1271 |
| 129 | Ga0495638_0266065 | 3300046460 | Bacteria | 938 |
| 130 | Ga0495650_0001651 | 3300046471 | Bacteria | 20626 |
| 131 | Ga0495650_0002398 | 3300046471 | Bacteria | 15306 |
| 132 | Ga0495650_0041217 | 3300046471 | Bacteria | 1976 |
| 133 | Ga0495596_0000230 | 3300046500 | Bacteria | 37798 |
| 134 | Ga0495596_0001475 | 3300046500 | Bacteria | 13466 |
| 135 | Ga0495596_0003652 | 3300046500 | Bacteria | 7720 |
| 136 | Ga0495607_0013092 | 3300046501 | Bacteria | 5447 |
| 137 | Ga0495607_0025517 | 3300046501 | Bacteria | 3675 |
| 138 | Ga0495607_0028252 | 3300046501 | Bacteria | 3462 |
| 139 | Ga0495583_0062597 | 3300046506 | Bacteria | 1656 |
| 140 | Ga0495610_0000238 | 3300046512 | Bacteria | 57907 |
| 141 | Ga0495610_0002803 | 3300046512 | Bacteria | 14242 |
| 142 | Ga0495610_0005038 | 3300046512 | Bacteria | 9542 |
| 143 | Ga0495616_0000483 | 3300046513 | Bacteria | 30296 |
| 144 | Ga0495620_0009851 | 3300046515 | Bacteria | 5062 |
| 145 | Ga0495632_0017965 | 3300046519 | Bacteria | 3890 |
| 146 | Ga0495637_0002193 | 3300046520 | Bacteria | 10919 |
| 147 | Ga0495637_0006070 | 3300046520 | Bacteria | 6102 |
| 148 | Ga0495637_0023301 | 3300046520 | Bacteria | 2816 |
| 149 | Ga0495643_0000038 | 3300046522 | Bacteria | 236010 |
| 150 | Ga0495643_0028994 | 3300046522 | Bacteria | 3099 |
| 151 | Ga0495643_0029621 | 3300046522 | Bacteria | 3061 |
| 152 | Ga0495648_0012017 | 3300046524 | Bacteria | 6487 |
| 153 | Ga0495654_0010360 | 3300046530 | Bacteria | 5072 |
| 154 | Ga0495609_0001296 | 3300046538 | Bacteria | 17067 |
| 155 | Ga0495609_0005153 | 3300046538 | Bacteria | 6956 |
| 156 | Ga0495597_0008567 | 3300046542 | Bacteria | 5116 |
| 157 | Ga0495668_0002162 | 3300046616 | Bacteria | 16877 |
| 158 | Ga0495668_0013780 | 3300046616 | Bacteria | 4756 |
| 159 | Ga0495668_0130737 | 3300046616 | Bacteria | 1374 |
| 160 | Ga0495625_0002838 | 3300046660 | Bacteria | 18205 |
| 161 | Ga0495625_0215569 | 3300046660 | Bacteria | 1260 |
| 162 | Ga0495670_0000009 | 3300046691 | Bacteria | 210956 |
| 163 | Ga0495671_0000027 | 3300046692 | Bacteria | 236011 |
| 164 | Ga0495671_0054413 | 3300046692 | Bacteria | 1984 |
| 165 | Ga0495681_0000825 | 3300047470 | Bacteria | 23900 |
| 166 | Ga0495681_0001901 | 3300047470 | Bacteria | 15333 |
| 167 | Ga0495681_0023410 | 3300047470 | Bacteria | 3282 |
| 168 | Ga0495686_0000057 | 3300047472 | Bacteria | 250088 |
| 169 | Ga0495686_0040529 | 3300047472 | Bacteria | 2970 |
| 170 | Ga0495615_0000038 | 3300048090 | Bacteria | 43468 |
| 171 | Ga0495626_0001450 | 3300048091 | Bacteria | 18771 |
| 172 | Ga0496100_0293679 | 3300048903 | Bacteria | 1215 |
| 173 | Ga0496102_0000049 | 3300048905 | Bacteria | 179480 |
| 174 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 175 | Ga0496107_0072500 | 3300048910 | Bacteria | 2504 |
| 176 | Ga0496115_0033041 | 3300048918 | Bacteria | 4084 |
| 177 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 178 | Ga0496116_0001001 | 3300048919 | Bacteria | 34554 |
| 179 | Ga0496116_0090169 | 3300048919 | Bacteria | 1867 |
| 180 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 181 | Ga0496117_0012184 | 3300048920 | Bacteria | 7609 |
| 182 | Ga0496117_0035114 | 3300048920 | Bacteria | 3768 |
| 183 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 184 | Ga0496118_0010619 | 3300048921 | Bacteria | 9093 |
| 185 | Ga0496118_0019054 | 3300048921 | Bacteria | 6151 |
| 186 | Ga0496118_0052724 | 3300048921 | Bacteria | 3099 |
| 187 | Ga0496120_0042982 | 3300048923 | Bacteria | 2636 |
| 188 | Ga0496121_0003807 | 3300048924 | Bacteria | 21025 |
| 189 | Ga0496122_0001673 | 3300048925 | Bacteria | 34402 |
| 190 | Ga0496122_0004560 | 3300048925 | Bacteria | 17079 |
| 191 | Ga0496122_0004749 | 3300048925 | Bacteria | 16649 |
| 192 | Ga0496122_0013475 | 3300048925 | Bacteria | 8000 |
| 193 | Ga0496122_0036108 | 3300048925 | Bacteria | 4005 |
| 194 | Ga0496123_0001239 | 3300048926 | Bacteria | 37030 |
| 195 | Ga0496123_0001839 | 3300048926 | Bacteria | 27851 |
| 196 | Ga0496123_0008555 | 3300048926 | Bacteria | 9379 |
| 197 | Ga0496123_0025140 | 3300048926 | Bacteria | 4499 |
| 198 | Ga0496123_0068006 | 3300048926 | Bacteria | 2246 |
| 199 | Ga0496123_0139473 | 3300048926 | Bacteria | 1328 |
| 200 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 201 | Ga0496124_0001648 | 3300048927 | Bacteria | 31950 |
| 202 | Ga0496124_0002678 | 3300048927 | Bacteria | 22823 |
| 203 | Ga0496124_0002897 | 3300048927 | Bacteria | 21645 |
| 204 | Ga0496124_0007794 | 3300048927 | Bacteria | 11310 |
| 205 | Ga0496124_0036546 | 3300048927 | Bacteria | 4283 |
| 206 | Ga0496124_0195012 | 3300048927 | Bacteria | 1546 |
| 207 | Ga0496125_0166751 | 3300048928 | Bacteria | 1487 |
| 208 | Ga0496125_0190693 | 3300048928 | Bacteria | 1354 |
| 209 | Ga0496125_0224106 | 3300048928 | Bacteria | 1208 |
| 210 | Ga0496126_0000124 | 3300048929 | Bacteria | 180422 |
| 211 | Ga0496126_0151153 | 3300048929 | Bacteria | 1990 |
| 212 | Ga0495678_008199 | 3300049459 | Bacteria | 5302 |
| 213 | Ga0501043_0244128 | 3300049579 | Bacteria | 1384 |
| 214 | Ga0501047_0000447 | 3300049581 | Bacteria | 45607 |
| 215 | Ga0501048_0037897 | 3300049582 | Bacteria | 3462 |
| 216 | nmdc:mga03n38_9472_c1 | 3300050490 | Bacteria | 3546 |
| 217 | nmdc:mga06z11_111_c1 | 3300050494 | Bacteria | 33603 |
| 218 | nmdc:mga04h51_792_c1 | 3300050495 | Bacteria | 7342 |
| 219 | nmdc:mga07m45_24110_c1 | 3300050496 | Bacteria | 3330 |
| 220 | Ga0500643_000166 | 3300053087 | Bacteria | 65586 |
| 221 | Ga0500643_003725 | 3300053087 | Bacteria | 7166 |
| 222 | Ga0500643_004858 | 3300053087 | Bacteria | 5934 |
| 223 | Ga0500643_005491 | 3300053087 | Bacteria | 5457 |
| 224 | Ga0500647_0019384 | 3300053091 | Bacteria | 3158 |
| 225 | Ga0500651_0002584 | 3300053093 | Bacteria | 9614 |
| 226 | Ga0500592_004940 | 3300053116 | Bacteria | 2117 |
| 227 | Ga0500618_007827 | 3300053125 | Bacteria | 3019 |
| 228 | Ga0500618_009093 | 3300053125 | Bacteria | 2731 |
| 229 | Ga0500655_000094 | 3300053133 | Bacteria | 23193 |
| 230 | Ga0500655_020628 | 3300053133 | Bacteria | 1232 |
| 231 | Ga0500559_0149056 | 3300053136 | Bacteria | 1097 |
| 232 | Ga0500590_002974 | 3300053148 | Bacteria | 7697 |
| 233 | Ga0500604_0001506 | 3300053151 | Bacteria | 6521 |
| 234 | Ga0500616_0005494 | 3300053153 | Bacteria | 8598 |
| 235 | Ga0500622_0004446 | 3300053156 | Bacteria | 8803 |
| 236 | Ga0500624_000044 | 3300053157 | Bacteria | 90094 |
| 237 | Ga0500624_000190 | 3300053157 | Bacteria | 24336 |
| 238 | Ga0500627_0000578 | 3300053158 | Bacteria | 9863 |
| 239 | Ga0500627_0032167 | 3300053158 | Bacteria | 2209 |
| 240 | Ga0500639_024616 | 3300053163 | Bacteria | 3182 |
| 241 | Ga0500636_0031133 | 3300053177 | Bacteria | 3156 |
| 242 | Ga0500636_0035542 | 3300053177 | Bacteria | 2948 |
| 243 | Ga0500570_000135 | 3300053724 | Bacteria | 21948 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003316 | rootH1_10079869 | rootH1_100798691 | 266 |
| 2 | 3300003758 | Ga0055532_1008211 | Ga0055532_10082112 | 269 |
| 3 | 3300047472 | Ga0495686_0000057 | Ga0495686_0000057_168563_169375 | 270 |
| 4 | 3300053136 | Ga0500559_0149056 | Ga0500559_0149056_18_836 | 272 |
| 5 | 3300001989 | JGI24739J22299_10002985 | JGI24739J22299_100029853 | 273 |
| 6 | 3300001990 | JGI24737J22298_10001355 | JGI24737J22298_100013556 | 273 |
| 7 | 3300002067 | JGI24735J21928_10000680 | JGI24735J21928_1000068011 | 273 |
| 8 | 3300002067 | JGI24735J21928_10016971 | JGI24735J21928_100169712 | 273 |
| 9 | 3300002070 | JGI24750J21931_1000274 | JGI24750J21931_10002742 | 273 |
| 10 | 3300002075 | JGI24738J21930_10000394 | JGI24738J21930_100003947 | 273 |
| 11 | 3300005330 | Ga0070690_100000202 | Ga0070690_10000020222 | 273 |
| 12 | 3300005335 | Ga0070666_10000053 | Ga0070666_100000537 | 273 |
| 13 | 3300005339 | Ga0070660_100242541 | Ga0070660_1002425411 | 273 |
| 14 | 3300005355 | Ga0070671_100060135 | Ga0070671_1000601352 | 273 |
| 15 | 3300005367 | Ga0070667_100008626 | Ga0070667_1000086265 | 273 |
| 16 | 3300005457 | Ga0070662_100007415 | Ga0070662_1000074153 | 273 |
| 17 | 3300005544 | Ga0070686_100000050 | Ga0070686_1000000507 | 273 |
| 18 | 3300013307 | Ga0157372_10041206 | Ga0157372_100412065 | 273 |
| 19 | 3300025919 | Ga0207657_10011750 | Ga0207657_100117508 | 273 |
| 20 | 3300025936 | Ga0207670_10056854 | Ga0207670_100568543 | 273 |
| 21 | 3300025972 | Ga0207668_10165483 | Ga0207668_101654832 | 273 |
| 22 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009510 | 273 |
| 23 | 3300046460 | Ga0495638_0266065 | Ga0495638_0266065_99_923 | 273 |
| 24 | 3300048910 | Ga0496107_0072500 | Ga0496107_0072500_51_872 | 273 |
| 25 | 3300053133 | Ga0500655_020628 | Ga0500655_020628_379_1203 | 273 |
| 26 | 3300046453 | Ga0495627_049324 | Ga0495627_049324_28_891 | 279 |
| 27 | 3300053087 | Ga0500643_004858 | Ga0500643_004858_889_1752 | 279 |
| 28 | 3300053157 | Ga0500624_000190 | Ga0500624_000190_2639_3502 | 279 |
| 29 | 3300053177 | Ga0500636_0031133 | Ga0500636_0031133_506_1369 | 279 |
| 30 | 3300005577 | Ga0068857_100025246 | Ga0068857_1000252467 | 294 |
| 31 | 3300025254 | Ga0209148_1003499 | Ga0209148_10034994 | 294 |
| 32 | 3300025272 | Ga0209455_1001069 | Ga0209455_100106913 | 294 |
| 33 | 3300025909 | Ga0207705_10008886 | Ga0207705_100088864 | 294 |
| 34 | iso_pu_bacteria | 2830075706 | 2830077885 | 294 |
| 35 | 3300013307 | Ga0157372_10045606 | Ga0157372_100456065 | 295 |
| 36 | 3300035398 | Ga0316574_0270036 | Ga0316574_0270036_17_922 | 295 |
| 37 | 3300039062 | Ga0400483_060644 | Ga0400483_060644_1305_2243 | 295 |
| 38 | iso_pu_bacteria | 2512564014 | 2512644047 | 295 |
| 39 | iso_pu_bacteria | 2808606401 | 2809064817 | 295 |
| 40 | iso_pu_bacteria | 2808606404 | 2809080784 | 295 |
| 41 | iso_pu_bacteria | 2808606405 | 2809085149 | 295 |
| 42 | iso_pu_bacteria | 2880518877 | 2880521846 | 295 |
| 43 | iso_pu_bacteria | 2919709256 | 2919711347 | 295 |
| 44 | 3300006051 | Ga0075364_10175974 | Ga0075364_101759742 | 296 |
| 45 | 3300046500 | Ga0495596_0001475 | Ga0495596_0001475_133_1023 | 296 |
| 46 | 3300046501 | Ga0495607_0025517 | Ga0495607_0025517_2199_3089 | 296 |
| 47 | 3300046512 | Ga0495610_0005038 | Ga0495610_0005038_6837_7727 | 296 |
| 48 | 3300046519 | Ga0495632_0017965 | Ga0495632_0017965_624_1514 | 296 |
| 49 | 3300046522 | Ga0495643_0029621 | Ga0495643_0029621_1092_1982 | 296 |
| 50 | 3300046538 | Ga0495609_0001296 | Ga0495609_0001296_2053_2943 | 296 |
| 51 | 3300047470 | Ga0495681_0023410 | Ga0495681_0023410_2356_3246 | 296 |
| 52 | 3300047472 | Ga0495686_0040529 | Ga0495686_0040529_1041_1931 | 296 |
| 53 | 3300005842 | Ga0068858_100058890 | Ga0068858_1000588904 | 297 |
| 54 | 3300026035 | Ga0207703_10065213 | Ga0207703_100652132 | 297 |
| 55 | 3300046524 | Ga0495648_0012017 | Ga0495648_0012017_3444_4337 | 297 |
| 56 | 3300048919 | Ga0496116_0090169 | Ga0496116_0090169_237_1133 | 297 |
| 57 | 3300048920 | Ga0496117_0012184 | Ga0496117_0012184_4773_5669 | 297 |
| 58 | 3300048921 | Ga0496118_0019054 | Ga0496118_0019054_1251_2147 | 297 |
| 59 | 3300048927 | Ga0496124_0007794 | Ga0496124_0007794_41_937 | 297 |
| 60 | iso_pu_bacteria | 2510917021 | 2511128799 | 297 |
| 61 | iso_pu_bacteria | 2599185354 | 2600202582 | 297 |
| 62 | iso_pu_bacteria | 2599185359 | 2600226131 | 297 |
| 63 | iso_pu_bacteria | 2643221541 | 2643728142 | 297 |
| 64 | iso_pu_bacteria | 2643221606 | 2644042909 | 297 |
| 65 | iso_pu_bacteria | 2643221671 | 2644395660 | 297 |
| 66 | iso_pu_bacteria | 2818991466 | 2819712822 | 297 |
| 67 | iso_pu_bacteria | 2885429604 | 2885431246 | 297 |
| 68 | iso_pu_bacteria | 2928027323 | 2928027673 | 297 |
| 69 | iso_pu_bacteria | 2928526807 | 2928527415 | 297 |
| 70 | iso_pu_bacteria | 2928968154 | 2928969099 | 297 |
| 71 | iso_pu_bacteria | 2946787523 | 2946788760 | 297 |
| 72 | iso_pu_bacteria | 2984555340 | 2984558034 | 297 |
| 73 | iso_pu_bacteria | 2984564862 | 2984567599 | 297 |
| 74 | iso_pu_bacteria | 2993356040 | 2993358651 | 297 |
| 75 | iso_pu_bacteria | 8054302542 | 8054303136 | 297 |
| 76 | 3300046520 | Ga0495637_0002193 | Ga0495637_0002193_3489_4385 | 298 |
| 77 | 3300046520 | Ga0495637_0023301 | Ga0495637_0023301_1088_1984 | 298 |
| 78 | 3300046522 | Ga0495643_0000038 | Ga0495643_0000038_200980_201876 | 298 |
| 79 | 3300046692 | Ga0495671_0000027 | Ga0495671_0000027_34136_35032 | 298 |
| 80 | 3300047470 | Ga0495681_0000825 | Ga0495681_0000825_16461_17357 | 298 |
| 81 | 3300049459 | Ga0495678_008199 | Ga0495678_008199_3014_3910 | 298 |
| 82 | 3300053087 | Ga0500643_003725 | Ga0500643_003725_1693_2604 | 298 |
| 83 | 3300053125 | Ga0500618_007827 | Ga0500618_007827_1460_2356 | 298 |
| 84 | iso_pu_bacteria | 2751185897 | 2753764375 | 298 |
| 85 | 3300005262 | Ga0065165_1014240 | Ga0065165_10142401 | 299 |
| 86 | 3300005331 | Ga0070670_100121719 | Ga0070670_1001217193 | 299 |
| 87 | 3300005335 | Ga0070666_10013892 | Ga0070666_100138921 | 299 |
| 88 | 3300005347 | Ga0070668_100002872 | Ga0070668_10000287214 | 299 |
| 89 | 3300005841 | Ga0068863_100000093 | Ga0068863_10000009341 | 299 |
| 90 | 3300006048 | Ga0075363_100017596 | Ga0075363_1000175963 | 299 |
| 91 | 3300006178 | Ga0075367_10095587 | Ga0075367_100955872 | 299 |
| 92 | 3300015690 | Ga0183363_1001 | Ga0183363_1001406 | 299 |
| 93 | 3300025298 | Ga0209050_1000582 | Ga0209050_100058226 | 299 |
| 94 | 3300025299 | Ga0209256_1036863 | Ga0209256_10368631 | 299 |
| 95 | 3300025903 | Ga0207680_10010398 | Ga0207680_100103981 | 299 |
| 96 | 3300025925 | Ga0207650_10080694 | Ga0207650_100806942 | 299 |
| 97 | 3300025972 | Ga0207668_10002163 | Ga0207668_100021632 | 299 |
| 98 | 3300026088 | Ga0207641_10000029 | Ga0207641_10000029179 | 299 |
| 99 | 3300027866 | Ga0209813_10000036 | Ga0209813_1000003621 | 299 |
| 100 | 3300046471 | Ga0495650_0001651 | Ga0495650_0001651_6041_6940 | 299 |
| 101 | 3300046513 | Ga0495616_0000483 | Ga0495616_0000483_23911_24810 | 299 |
| 102 | 3300046616 | Ga0495668_0013780 | Ga0495668_0013780_1944_2843 | 299 |
| 103 | 3300048918 | Ga0496115_0033041 | Ga0496115_0033041_2609_3517 | 299 |
| 104 | 3300050490 | nmdc:mga03n38_9472_c1 | nmdc:mga03n38_9472_c1_1632_2534 | 299 |
| 105 | 3300050494 | nmdc:mga06z11_111_c1 | nmdc:mga06z11_111_c1_843_1745 | 299 |
| 106 | 3300050495 | nmdc:mga04h51_792_c1 | nmdc:mga04h51_792_c1_6332_7234 | 299 |
| 107 | 3300050496 | nmdc:mga07m45_24110_c1 | nmdc:mga07m45_24110_c1_1003_1905 | 299 |
| 108 | 3300053151 | Ga0500604_0001506 | Ga0500604_0001506_499_1398 | 299 |
| 109 | 3300053157 | Ga0500624_000044 | Ga0500624_000044_89044_89952 | 299 |
| 110 | 3300053158 | Ga0500627_0032167 | Ga0500627_0032167_148_1047 | 299 |
| 111 | 3300013105 | Ga0157369_10362340 | Ga0157369_103623402 | 300 |
| 112 | 3300038705 | Ga0237819_01938 | Ga0237819_01938_3240_4142 | 300 |
| 113 | 3300046471 | Ga0495650_0041217 | Ga0495650_0041217_716_1618 | 300 |
| 114 | 3300046500 | Ga0495596_0000230 | Ga0495596_0000230_30260_31162 | 300 |
| 115 | 3300046501 | Ga0495607_0028252 | Ga0495607_0028252_514_1416 | 300 |
| 116 | 3300046506 | Ga0495583_0062597 | Ga0495583_0062597_253_1155 | 300 |
| 117 | 3300046538 | Ga0495609_0005153 | Ga0495609_0005153_609_1511 | 300 |
| 118 | 3300046616 | Ga0495668_0130737 | Ga0495668_0130737_135_1037 | 300 |
| 119 | 3300046660 | Ga0495625_0002838 | Ga0495625_0002838_9164_10066 | 300 |
| 120 | 3300053153 | Ga0500616_0005494 | Ga0500616_0005494_2435_3448 | 300 |
| 121 | 3300001904 | JGI24736J21556_1000023 | JGI24736J21556_100002310 | 301 |
| 122 | 3300001979 | JGI24740J21852_10010247 | JGI24740J21852_100102475 | 301 |
| 123 | 3300001989 | JGI24739J22299_10001293 | JGI24739J22299_100012936 | 301 |
| 124 | 3300001990 | JGI24737J22298_10002290 | JGI24737J22298_100022906 | 301 |
| 125 | 3300002067 | JGI24735J21928_10004282 | JGI24735J21928_100042822 | 301 |
| 126 | 3300002075 | JGI24738J21930_10005723 | JGI24738J21930_100057232 | 301 |
| 127 | 3300002774 | JGI25150J39212_1000285 | JGI25150J39212_100028516 | 301 |
| 128 | 3300003215 | JGI25153J46596_10000044 | JGI25153J46596_1000004474 | 301 |
| 129 | 3300003771 | Ga0055526_1000860 | Ga0055526_10008604 | 301 |
| 130 | 3300003773 | Ga0055537_1004587 | Ga0055537_10045872 | 301 |
| 131 | 3300003781 | Ga0055536_1018702 | Ga0055536_10187023 | 301 |
| 132 | 3300003791 | Ga0055530_10032453 | Ga0055530_100324532 | 301 |
| 133 | 3300003792 | Ga0055540_1011306 | Ga0055540_10113061 | 301 |
| 134 | 3300005329 | Ga0070683_100378512 | Ga0070683_1003785122 | 301 |
| 135 | 3300005347 | Ga0070668_100006427 | Ga0070668_1000064272 | 301 |
| 136 | 3300005366 | Ga0070659_100165498 | Ga0070659_1001654982 | 301 |
| 137 | 3300005457 | Ga0070662_100387352 | Ga0070662_1003873521 | 301 |
| 138 | 3300005577 | Ga0068857_100030286 | Ga0068857_1000302865 | 301 |
| 139 | 3300005577 | Ga0068857_100330212 | Ga0068857_1003302122 | 301 |
| 140 | 3300005578 | Ga0068854_100054904 | Ga0068854_1000549043 | 301 |
| 141 | 3300005617 | Ga0068859_100107091 | Ga0068859_1001070913 | 301 |
| 142 | 3300006051 | Ga0075364_10055374 | Ga0075364_100553741 | 301 |
| 143 | 3300006931 | Ga0097620_100107091 | Ga0097620_1001070913 | 301 |
| 144 | 3300009093 | Ga0105240_10789452 | Ga0105240_107894521 | 301 |
| 145 | 3300009177 | Ga0105248_10004227 | Ga0105248_100042274 | 301 |
| 146 | 3300013104 | Ga0157370_10036925 | Ga0157370_100369253 | 301 |
| 147 | 3300013105 | Ga0157369_10023012 | Ga0157369_100230122 | 301 |
| 148 | 3300013307 | Ga0157372_10190902 | Ga0157372_101909022 | 301 |
| 149 | 3300017792 | Ga0163161_10233485 | Ga0163161_102334851 | 301 |
| 150 | 3300021388 | Ga0213875_10000105 | Ga0213875_1000010530 | 301 |
| 151 | 3300025245 | Ga0207425_1000026 | Ga0207425_1000026169 | 301 |
| 152 | 3300025258 | Ga0209129_1002266 | Ga0209129_10022666 | 301 |
| 153 | 3300025263 | Ga0209565_1000064 | Ga0209565_100006496 | 301 |
| 154 | 3300025273 | Ga0209673_1019664 | Ga0209673_10196643 | 301 |
| 155 | 3300025294 | Ga0209025_1000726 | Ga0209025_100072618 | 301 |
| 156 | 3300025295 | Ga0209564_1002791 | Ga0209564_100279111 | 301 |
| 157 | 3300025295 | Ga0209564_1031460 | Ga0209564_10314601 | 301 |
| 158 | 3300025297 | Ga0209758_1000004 | Ga0209758_10000041111 | 301 |
| 159 | 3300025297 | Ga0209758_1018748 | Ga0209758_10187484 | 301 |
| 160 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000013107 | 301 |
| 161 | 3300025298 | Ga0209050_1021547 | Ga0209050_10215472 | 301 |
| 162 | 3300025303 | Ga0209051_1000793 | Ga0209051_10007938 | 301 |
| 163 | 3300025304 | Ga0209257_1000617 | Ga0209257_100061724 | 301 |
| 164 | 3300025304 | Ga0209257_1000633 | Ga0209257_100063324 | 301 |
| 165 | 3300025321 | Ga0207656_10022656 | Ga0207656_100226562 | 301 |
| 166 | 3300025904 | Ga0207647_10001726 | Ga0207647_1000172610 | 301 |
| 167 | 3300025911 | Ga0207654_10009517 | Ga0207654_100095176 | 301 |
| 168 | 3300025911 | Ga0207654_10185831 | Ga0207654_101858311 | 301 |
| 169 | 3300025913 | Ga0207695_10005689 | Ga0207695_100056899 | 301 |
| 170 | 3300025914 | Ga0207671_10006833 | Ga0207671_100068339 | 301 |
| 171 | 3300025914 | Ga0207671_10009831 | Ga0207671_100098318 | 301 |
| 172 | 3300025914 | Ga0207671_10394320 | Ga0207671_103943201 | 301 |
| 173 | 3300025919 | Ga0207657_10168059 | Ga0207657_101680591 | 301 |
| 174 | 3300025924 | Ga0207694_10016124 | Ga0207694_100161241 | 301 |
| 175 | 3300025933 | Ga0207706_10004690 | Ga0207706_1000469015 | 301 |
| 176 | 3300025933 | Ga0207706_10060263 | Ga0207706_100602633 | 301 |
| 177 | 3300025941 | Ga0207711_10009629 | Ga0207711_100096293 | 301 |
| 178 | 3300025944 | Ga0207661_10589717 | Ga0207661_105897171 | 301 |
| 179 | 3300025949 | Ga0207667_10021852 | Ga0207667_100218523 | 301 |
| 180 | 3300025972 | Ga0207668_10010224 | Ga0207668_100102241 | 301 |
| 181 | 3300025981 | Ga0207640_10058944 | Ga0207640_100589442 | 301 |
| 182 | 3300025981 | Ga0207640_10139065 | Ga0207640_101390651 | 301 |
| 183 | 3300025986 | Ga0207658_10000263 | Ga0207658_1000026341 | 301 |
| 184 | 3300026041 | Ga0207639_10396084 | Ga0207639_103960842 | 301 |
| 185 | 3300026067 | Ga0207678_10023926 | Ga0207678_100239263 | 301 |
| 186 | 3300026078 | Ga0207702_10003500 | Ga0207702_100035007 | 301 |
| 187 | 3300026088 | Ga0207641_10000991 | Ga0207641_100009916 | 301 |
| 188 | 3300026116 | Ga0207674_10031133 | Ga0207674_100311335 | 301 |
| 189 | 3300026116 | Ga0207674_10063370 | Ga0207674_100633704 | 301 |
| 190 | 3300026142 | Ga0207698_10001620 | Ga0207698_100016208 | 301 |
| 191 | 3300028381 | Ga0268264_10000184 | Ga0268264_1000018441 | 301 |
| 192 | 3300031911 | Ga0307412_10006092 | Ga0307412_100060925 | 301 |
| 193 | 3300031911 | Ga0307412_10007474 | Ga0307412_100074746 | 301 |
| 194 | 3300031911 | Ga0307412_10091613 | Ga0307412_100916132 | 301 |
| 195 | 3300031911 | Ga0307412_10131507 | Ga0307412_101315071 | 301 |
| 196 | 3300037853 | Ga0436364_0184827 | Ga0436364_0184827_90666_91622 | 301 |
| 197 | 3300041458 | Ga0451798_1171132 | Ga0451798_1171132_234_1163 | 301 |
| 198 | 3300041462 | Ga0451806_574197 | Ga0451806_574197_9499_10428 | 301 |
| 199 | 3300041505 | Ga0451849_0429861 | Ga0451849_0429861_527_1456 | 301 |
| 200 | 3300046453 | Ga0495627_001304 | Ga0495627_001304_7064_7975 | 301 |
| 201 | 3300046471 | Ga0495650_0002398 | Ga0495650_0002398_7237_8148 | 301 |
| 202 | 3300046500 | Ga0495596_0003652 | Ga0495596_0003652_3447_4376 | 301 |
| 203 | 3300046501 | Ga0495607_0013092 | Ga0495607_0013092_1030_1947 | 301 |
| 204 | 3300046512 | Ga0495610_0000238 | Ga0495610_0000238_56401_57312 | 301 |
| 205 | 3300046512 | Ga0495610_0002803 | Ga0495610_0002803_1835_2764 | 301 |
| 206 | 3300046515 | Ga0495620_0009851 | Ga0495620_0009851_2407_3318 | 301 |
| 207 | 3300046520 | Ga0495637_0006070 | Ga0495637_0006070_642_1550 | 301 |
| 208 | 3300046522 | Ga0495643_0028994 | Ga0495643_0028994_342_1385 | 301 |
| 209 | 3300046530 | Ga0495654_0010360 | Ga0495654_0010360_2176_3114 | 301 |
| 210 | 3300046542 | Ga0495597_0008567 | Ga0495597_0008567_3404_4312 | 301 |
| 211 | 3300046616 | Ga0495668_0002162 | Ga0495668_0002162_4040_4978 | 301 |
| 212 | 3300046660 | Ga0495625_0215569 | Ga0495625_0215569_24_938 | 301 |
| 213 | 3300046691 | Ga0495670_0000009 | Ga0495670_0000009_125911_126837 | 301 |
| 214 | 3300046692 | Ga0495671_0054413 | Ga0495671_0054413_936_1877 | 301 |
| 215 | 3300047470 | Ga0495681_0001901 | Ga0495681_0001901_7186_8097 | 301 |
| 216 | 3300048090 | Ga0495615_0000038 | Ga0495615_0000038_24602_25513 | 301 |
| 217 | 3300048091 | Ga0495626_0001450 | Ga0495626_0001450_7918_8847 | 301 |
| 218 | 3300048903 | Ga0496100_0293679 | Ga0496100_0293679_72_983 | 301 |
| 219 | 3300048905 | Ga0496102_0000049 | Ga0496102_0000049_105003_105950 | 301 |
| 220 | 3300048906 | Ga0496103_0000037 | Ga0496103_0000037_73525_74472 | 301 |
| 221 | 3300048919 | Ga0496116_0000028 | Ga0496116_0000028_408624_409535 | 301 |
| 222 | 3300048919 | Ga0496116_0001001 | Ga0496116_0001001_2294_3241 | 301 |
| 223 | 3300048920 | Ga0496117_0000115 | Ga0496117_0000115_105003_105950 | 301 |
| 224 | 3300048920 | Ga0496117_0035114 | Ga0496117_0035114_487_1401 | 301 |
| 225 | 3300048921 | Ga0496118_0000086 | Ga0496118_0000086_73539_74486 | 301 |
| 226 | 3300048921 | Ga0496118_0010619 | Ga0496118_0010619_7513_8424 | 301 |
| 227 | 3300048921 | Ga0496118_0052724 | Ga0496118_0052724_982_1935 | 301 |
| 228 | 3300048923 | Ga0496120_0042982 | Ga0496120_0042982_471_1385 | 301 |
| 229 | 3300048924 | Ga0496121_0003807 | Ga0496121_0003807_6968_7882 | 301 |
| 230 | 3300048925 | Ga0496122_0001673 | Ga0496122_0001673_18007_18918 | 301 |
| 231 | 3300048925 | Ga0496122_0004560 | Ga0496122_0004560_1295_2209 | 301 |
| 232 | 3300048925 | Ga0496122_0004749 | Ga0496122_0004749_14479_15390 | 301 |
| 233 | 3300048925 | Ga0496122_0013475 | Ga0496122_0013475_6520_7431 | 301 |
| 234 | 3300048925 | Ga0496122_0036108 | Ga0496122_0036108_2172_3113 | 301 |
| 235 | 3300048926 | Ga0496123_0001239 | Ga0496123_0001239_33191_34102 | 301 |
| 236 | 3300048926 | Ga0496123_0001839 | Ga0496123_0001839_13476_14387 | 301 |
| 237 | 3300048926 | Ga0496123_0008555 | Ga0496123_0008555_2190_3131 | 301 |
| 238 | 3300048926 | Ga0496123_0025140 | Ga0496123_0025140_2457_3404 | 301 |
| 239 | 3300048926 | Ga0496123_0068006 | Ga0496123_0068006_1276_2217 | 301 |
| 240 | 3300048926 | Ga0496123_0139473 | Ga0496123_0139473_343_1257 | 301 |
| 241 | 3300048927 | Ga0496124_0000102 | Ga0496124_0000102_73539_74486 | 301 |
| 242 | 3300048927 | Ga0496124_0001648 | Ga0496124_0001648_2690_3631 | 301 |
| 243 | 3300048927 | Ga0496124_0002678 | Ga0496124_0002678_16957_17916 | 301 |
| 244 | 3300048927 | Ga0496124_0002897 | Ga0496124_0002897_15422_16363 | 301 |
| 245 | 3300048927 | Ga0496124_0036546 | Ga0496124_0036546_1657_2568 | 301 |
| 246 | 3300048927 | Ga0496124_0195012 | Ga0496124_0195012_485_1432 | 301 |
| 247 | 3300048928 | Ga0496125_0166751 | Ga0496125_0166751_213_1127 | 301 |
| 248 | 3300048928 | Ga0496125_0190693 | Ga0496125_0190693_295_1236 | 301 |
| 249 | 3300048928 | Ga0496125_0224106 | Ga0496125_0224106_243_1148 | 301 |
| 250 | 3300048929 | Ga0496126_0000124 | Ga0496126_0000124_13673_14584 | 301 |
| 251 | 3300048929 | Ga0496126_0151153 | Ga0496126_0151153_1037_1978 | 301 |
| 252 | 3300049579 | Ga0501043_0244128 | Ga0501043_0244128_268_1215 | 301 |
| 253 | 3300049581 | Ga0501047_0000447 | Ga0501047_0000447_17606_18553 | 301 |
| 254 | 3300049582 | Ga0501048_0037897 | Ga0501048_0037897_673_1620 | 301 |
| 255 | 3300053087 | Ga0500643_000166 | Ga0500643_000166_40836_41747 | 301 |
| 256 | 3300053087 | Ga0500643_005491 | Ga0500643_005491_3532_4446 | 301 |
| 257 | 3300053091 | Ga0500647_0019384 | Ga0500647_0019384_1275_2183 | 301 |
| 258 | 3300053093 | Ga0500651_0002584 | Ga0500651_0002584_2730_3638 | 301 |
| 259 | 3300053116 | Ga0500592_004940 | Ga0500592_004940_416_1327 | 301 |
| 260 | 3300053125 | Ga0500618_009093 | Ga0500618_009093_338_1246 | 301 |
| 261 | 3300053133 | Ga0500655_000094 | Ga0500655_000094_17341_18249 | 301 |
| 262 | 3300053148 | Ga0500590_002974 | Ga0500590_002974_5378_6286 | 301 |
| 263 | 3300053156 | Ga0500622_0004446 | Ga0500622_0004446_5022_5930 | 301 |
| 264 | 3300053158 | Ga0500627_0000578 | Ga0500627_0000578_1963_2901 | 301 |
| 265 | 3300053163 | Ga0500639_024616 | Ga0500639_024616_1233_2141 | 301 |
| 266 | 3300053177 | Ga0500636_0035542 | Ga0500636_0035542_95_1003 | 301 |
| 267 | 3300053724 | Ga0500570_000135 | Ga0500570_000135_460_1368 | 301 |
| 268 | iso_pu_bacteria | 2818991438 | 2819553374 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8szt-assembly1.cif.gz_A | structure of kdac1 from acinetobacter baumannii | 0.8517 | 1 | 294 |
| 5eek-assembly1.cif.gz_A | crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 in complex with trichostatin a | 0.8498 | 1 | 292 |
| 8g20-assembly2.cif.gz_B | crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 complexed with inhibitor mz327 | 0.8496 | 1 | 292 |
| 6vnr-assembly2.cif.gz_B | crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 (cd2) complexed with bishydroxamic acid inhibitor | 0.8493 | 1 | 292 |
| 8szt-assembly1.cif.gz_C-2 | structure of kdac1 from acinetobacter baumannii | 0.8491 | 2 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_X1WCM6_55_351_3.40.800.20 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9483 | 6 | 293 | 3.40.800.20 |
| af_X1WCM6_55_351_3.40.800.20 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9174 | 6 | 293 | 3.40.800.20 |
| af_Q18477_16_331_3.40.800.20 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.8859 | 1 | 294 | 3.40.800.20 |
| af_Q5Z608_39_349_3.40.800.20 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.8837 | 5 | 294 | 3.40.800.20 |
| af_A0A1D6N7T5_1_214_3.40.800.20 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.873 | 127 | 294 | 3.40.800.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A5YMV6-F1-model_v4 | Histone deacetylase | 0.9929 | 154 | 294 |
GO:0004407
GO:0040029 |
| AF-A0A0N0M334-F1-model_v4 | Histone deacetylase | 0.9816 | 1 | 294 |
GO:0004407
GO:0040029 |
| AF-A0A1B6JU28-F1-model_v4 | Histone deacetylase domain-containing protein | 0.9812 | 148 | 294 |
GO:0004407
GO:0040029 |
| AF-A0A3N5DJJ7-F1-model_v4 | Histone deacetylase | 0.9783 | 1 | 296 |
GO:0004407
GO:0040029 |
| AF-A0A219B8H5-F1-model_v4 | Histone deacetylase | 0.9766 | 24 | 294 |
GO:0004407
GO:0040029 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar