F375824

General Info

Members Datasets Scaffolds Average Seq Length
268 185 536 198

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_529_c1|nmdc:mga0n895_529_c1_15698_16345
Length 215
Sequence MSPTATRWHRRHSATRSATSPPCSLRFSSTIIFSLALAAGCGSGAPKFRSADITGADYGRSLELTDTRGQVRRLADFRGKAVVLFFGFTQCPDVCPTTLAELAGVMKGLGPEAERVQVLFVTLDPERDTPEALGRYVGAFDPRFIALRGDLAATQRVAKEFKIFFEKRKQGSSYTIDHSAQSYVIDPQGRLRLLVRHDRIAQDLPEDLRTLLKQG

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 1.49
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_529_c1 3300050512 Bacteria 26051
2 JGI25406J46586_10046529 3300003203 Bacteria 1485
3 Ga0065715_10428246 3300005293 Bacteria 850
4 Ga0070676_10003854 3300005328 Bacteria 7878
5 Ga0070683_100098950 3300005329 Bacteria 2745
6 Ga0070690_100133274 3300005330 Bacteria 1680
7 Ga0070670_100178327 3300005331 Bacteria 1844
8 Ga0070670_100312802 3300005331 Bacteria 1375
9 Ga0070670_100522756 3300005331 Bacteria 1057
10 Ga0068869_100221856 3300005334 Bacteria 1499
11 Ga0070666_10225157 3300005335 Bacteria 1324
12 Ga0070680_100342669 3300005336 Bacteria 1270
13 Ga0070680_100540135 3300005336 Bacteria 999
14 Ga0070687_100078526 3300005343 Bacteria 1794
15 Ga0070687_100467576 3300005343 Bacteria 842
16 Ga0070692_10469692 3300005345 Bacteria 809
17 Ga0070668_100303384 3300005347 Bacteria 1340
18 Ga0070669_100414131 3300005353 Bacteria 1105
19 Ga0070675_100799880 3300005354 Bacteria 862
20 Ga0070671_100276419 3300005355 Bacteria 1428
21 Ga0070674_100623599 3300005356 Bacteria 914
22 Ga0070688_100277837 3300005365 Bacteria 1202
23 Ga0070688_100571693 3300005365 Bacteria 862
24 Ga0070667_100213217 3300005367 Bacteria 1717
25 Ga0070705_100002213 3300005440 Bacteria 9880
26 Ga0070705_100149617 3300005440 Bacteria 1547
27 Ga0070694_100046304 3300005444 Bacteria 2919
28 Ga0070694_100065081 3300005444 Bacteria 2497
29 Ga0070694_100194259 3300005444 Bacteria 1509
30 Ga0070694_100195235 3300005444 Bacteria 1506
31 Ga0070694_100666995 3300005444 Bacteria 843
32 Ga0070678_100062430 3300005456 Bacteria 2751
33 Ga0070678_100369306 3300005456 Bacteria 1238
34 Ga0070681_10001159 3300005458 Bacteria 22770
35 Ga0068867_100136428 3300005459 Bacteria 1913
36 Ga0068867_100472334 3300005459 Bacteria 1073
37 Ga0070685_10483435 3300005466 Bacteria 873
38 Ga0070699_100114282 3300005518 Bacteria 2372
39 Ga0070679_100056901 3300005530 Bacteria 3897
40 Ga0070684_100025330 3300005535 Bacteria 4986
41 Ga0070697_100117048 3300005536 Bacteria 2226
42 Ga0068853_100164047 3300005539 Bacteria 2006
43 Ga0070672_100010609 3300005543 Bacteria 6396
44 Ga0070686_100291279 3300005544 Bacteria 1208
45 Ga0070686_100764537 3300005544 Bacteria 776
46 Ga0070695_100007996 3300005545 Bacteria 6266
47 Ga0070696_100002063 3300005546 Bacteria 13176
48 Ga0070696_100036280 3300005546 Bacteria 3399
49 Ga0070693_100093064 3300005547 Bacteria 1821
50 Ga0070665_100107022 3300005548 Bacteria 2799
51 Ga0070704_100014582 3300005549 Bacteria 4911
52 Ga0070704_100344520 3300005549 Bacteria 1256
53 Ga0068855_100172503 3300005563 Bacteria 2449
54 Ga0068854_100265514 3300005578 Bacteria 1376
55 Ga0068856_100612791 3300005614 Bacteria 1109
56 Ga0070702_100354656 3300005615 Bacteria 1034
57 Ga0068859_100086418 3300005617 Bacteria 3183
58 Ga0068864_100289224 3300005618 Bacteria 1532
59 Ga0068864_100366296 3300005618 Bacteria 1363
60 Ga0068866_10337951 3300005718 Bacteria 953
61 Ga0068861_100284557 3300005719 Bacteria 1425
62 Ga0068863_100260583 3300005841 Bacteria 1676
63 Ga0068863_100295387 3300005841 Bacteria 1571
64 Ga0068863_100310822 3300005841 Bacteria 1530
65 Ga0068858_100059561 3300005842 Bacteria 3529
66 Ga0068858_100635527 3300005842 Bacteria 1037
67 Ga0068860_100603512 3300005843 Bacteria 1103
68 Ga0081539_10002681 3300005985 Bacteria 24195
69 Ga0070716_100851790 3300006173 Bacteria 710
70 Ga0097621_100003503 3300006237 Bacteria 10836
71 Ga0068871_100001810 3300006358 Bacteria 14431
72 Ga0068871_100133269 3300006358 Bacteria 2108
73 Ga0068871_100254323 3300006358 Bacteria 1531
74 Ga0075431_100024658 3300006847 Bacteria 6167
75 Ga0075431_100836972 3300006847 Bacteria 892
76 Ga0075433_10013597 3300006852 Bacteria 6625
77 Ga0075433_10082364 3300006852 Bacteria 2838
78 Ga0075434_100012871 3300006871 Bacteria 7945
79 Ga0075429_100000184 3300006880 Bacteria 40869
80 Ga0068865_100003167 3300006881 Bacteria 9855
81 Ga0068865_100109761 3300006881 Bacteria 2033
82 Ga0075436_100000890 3300006914 Bacteria 19852
83 Ga0075436_100055806 3300006914 Bacteria 2728
84 Ga0075436_100065169 3300006914 Bacteria 2518
85 Ga0075436_100184350 3300006914 Bacteria 1476
86 Ga0097620_100086418 3300006931 Bacteria 3183
87 Ga0075435_100000315 3300007076 Bacteria 29765
88 Ga0075435_100028871 3300007076 Bacteria 4352
89 Ga0075435_100605955 3300007076 Bacteria 950
90 Ga0099794_10017189 3300007265 Bacteria 3220
91 Ga0105240_10011255 3300009093 Bacteria 12473
92 Ga0111539_10006481 3300009094 Bacteria 15077
93 Ga0111539_10237026 3300009094 Bacteria 2124
94 Ga0105245_10685342 3300009098 Bacteria 1057
95 Ga0114129_10000677 3300009147 Bacteria 42898
96 Ga0114129_11088628 3300009147 Bacteria 1001
97 Ga0114129_11977186 3300009147 Bacteria 705
98 Ga0105241_10076194 3300009174 Bacteria 2615
99 Ga0105242_10002553 3300009176 Bacteria 14268
100 Ga0105242_10077698 3300009176 Bacteria 2769
101 Ga0105237_10011506 3300009545 Bacteria 9361
102 Ga0105238_10004604 3300009551 Bacteria 13643
103 Ga0105238_10047996 3300009551 Bacteria 4304
104 Ga0105249_10047285 3300009553 Bacteria 3920
105 Ga0105249_10217678 3300009553 Bacteria 1878
106 Ga0105239_10357633 3300010375 Bacteria 1649
107 Ga0157369_10331120 3300013105 Bacteria 1582
108 Ga0157378_10978767 3300013297 Bacteria 879
109 Ga0163162_10077418 3300013306 Bacteria 3389
110 Ga0163162_10190730 3300013306 Bacteria 2177
111 Ga0163162_11280781 3300013306 Bacteria 833
112 Ga0163162_11357584 3300013306 Bacteria 808
113 Ga0157372_10107124 3300013307 Bacteria 3197
114 Ga0157375_10000256 3300013308 Bacteria 48304
115 Ga0157375_10007114 3300013308 Bacteria 9774
116 Ga0157375_10700721 3300013308 Bacteria 1166
117 Ga0163163_10126098 3300014325 Bacteria 2598
118 Ga0157377_10185760 3300014745 Bacteria 1310
119 Ga0157379_10601618 3300014968 Bacteria 1026
120 Ga0157376_10000254 3300014969 Bacteria 36962
121 Ga0157376_10001188 3300014969 Bacteria 17183
122 Ga0157376_10330747 3300014969 Bacteria 1452
123 Ga0163161_10041433 3300017792 Bacteria 3309
124 Ga0163161_10139835 3300017792 Bacteria 1833
125 Ga0207653_10097663 3300025885 Bacteria 1035
126 Ga0207642_10066183 3300025899 Bacteria 1701
127 Ga0207699_10124859 3300025906 Bacteria 1670
128 Ga0207645_10368496 3300025907 Bacteria 963
129 Ga0207684_10729201 3300025910 Bacteria 841
130 Ga0207654_10308719 3300025911 Bacteria 1078
131 Ga0207707_10000770 3300025912 Bacteria 31517
132 Ga0207695_10002942 3300025913 Bacteria 24581
133 Ga0207671_10003439 3300025914 Bacteria 15793
134 Ga0207662_10055602 3300025918 Bacteria 2362
135 Ga0207662_10249646 3300025918 Bacteria 1164
136 Ga0207652_10033338 3300025921 Bacteria 4335
137 Ga0207681_10035966 3300025923 Bacteria 3265
138 Ga0207681_10077144 3300025923 Bacteria 2342
139 Ga0207694_10001329 3300025924 Bacteria 21273
140 Ga0207650_10234646 3300025925 Bacteria 1481
141 Ga0207650_10484946 3300025925 Bacteria 1032
142 Ga0207650_10513972 3300025925 Bacteria 1002
143 Ga0207659_10124283 3300025926 Bacteria 1982
144 Ga0207687_10343369 3300025927 Bacteria 1214
145 Ga0207664_10176946 3300025929 Bacteria 1830
146 Ga0207644_10060904 3300025931 Bacteria 2732
147 Ga0207644_10220349 3300025931 Bacteria 1504
148 Ga0207644_10831445 3300025931 Bacteria 773
149 Ga0207686_10029943 3300025934 Bacteria 3217
150 Ga0207669_10155513 3300025937 Bacteria 1608
151 Ga0207704_10069762 3300025938 Bacteria 2222
152 Ga0207704_10110123 3300025938 Bacteria 1859
153 Ga0207704_10497961 3300025938 Bacteria 981
154 Ga0207665_10360387 3300025939 Bacteria 1099
155 Ga0207665_10780807 3300025939 Bacteria 754
156 Ga0207691_10004046 3300025940 Bacteria 14219
157 Ga0207691_10850819 3300025940 Bacteria 765
158 Ga0207689_10271564 3300025942 Bacteria 1404
159 Ga0207689_10298524 3300025942 Bacteria 1335
160 Ga0207661_10044850 3300025944 Bacteria 3497
161 Ga0207667_10384127 3300025949 Bacteria 1430
162 Ga0207712_10195629 3300025961 Bacteria 1599
163 Ga0207668_10169650 3300025972 Bacteria 1710
164 Ga0207640_10469744 3300025981 Bacteria 1041
165 Ga0207658_10104798 3300025986 Bacteria 2223
166 Ga0207677_10494812 3300026023 Bacteria 1056
167 Ga0207703_10068300 3300026035 Bacteria 2928
168 Ga0207639_10083068 3300026041 Bacteria 2541
169 Ga0207639_10258742 3300026041 Bacteria 1521
170 Ga0207639_10460845 3300026041 Bacteria 1156
171 Ga0207641_10306384 3300026088 Bacteria 1502
172 Ga0207641_10322240 3300026088 Bacteria 1466
173 Ga0207676_10004626 3300026095 Bacteria 9739
174 Ga0207676_10071355 3300026095 Bacteria 2788
175 Ga0207675_100376432 3300026118 Bacteria 1395
176 Ga0207683_10018044 3300026121 Bacteria 6017
177 Ga0207683_10325264 3300026121 Bacteria 1409
178 Ga0209967_1000844 3300027364 Bacteria 3938
179 Ga0209588_1008032 3300027671 Bacteria 3123
180 Ga0207428_10001488 3300027907 Bacteria 24511
181 Ga0207428_10041644 3300027907 Bacteria 3717
182 Ga0307408_100516089 3300031548 Bacteria 1049
183 Ga0307410_10291730 3300031852 Bacteria 1284
184 Ga0307409_100101062 3300031995 Bacteria 2392
185 Ga0307411_10668529 3300032005 Bacteria 901
186 Ga0307415_100730641 3300032126 Bacteria 897
187 Ga0373952_0005646 3300035092 Bacteria 2293
188 Ga0373923_0309209 3300035111 Bacteria 749
189 Ga0373939_0029667 3300035114 Bacteria 1567
190 Ga0373941_0026280 3300035115 Bacteria 1689
191 Ga0373953_0053268 3300035117 Bacteria 1640
192 Ga0373924_0097543 3300035410 Bacteria 1262
193 Ga0373931_0051849 3300035691 Bacteria 2186
194 Ga0373931_0091942 3300035691 Bacteria 1692
195 Ga0373931_0471815 3300035691 Bacteria 805
196 Ga0373935_0206619 3300035692 Bacteria 1359
197 Ga0373927_0009173 3300035695 Bacteria 6638
198 Ga0373933_0103073 3300035724 Bacteria 1772
199 Ga0373937_0010574 3300036401 Bacteria 8064
200 Ga0373937_0036857 3300036401 Bacteria 4456
201 Ga0373937_0176160 3300036401 Bacteria 2007
202 Ga0373937_0563693 3300036401 Bacteria 1082
203 Ga0373925_0013262 3300037068 Bacteria 5965
204 Ga0373925_0041616 3300037068 Bacteria 3407
205 Ga0439446_0006369 3300042156 Bacteria 3074
206 Ga0439434_0000279 3300042435 Bacteria 14568
207 Ga0439435_0000133 3300042436 Bacteria 9883
208 Ga0451577_0118843 3300042876 Bacteria 2367
209 Ga0466964_0045858 3300044706 Bacteria 1780
210 Ga0466968_0344655 3300044735 Bacteria 723
211 Ga0451576_0003283 3300045051 Bacteria 22465
212 Ga0451576_0415665 3300045051 Bacteria 1411
213 Ga0451576_0521482 3300045051 Bacteria 1248
214 Ga0495629_0057666 3300046459 Bacteria 2715
215 Ga0495651_0022213 3300046462 Bacteria 4933
216 Ga0495580_0030395 3300046472 Bacteria 3912
217 Ga0495582_0013614 3300046473 Bacteria 4478
218 Ga0495639_0038071 3300046475 Bacteria 2158
219 Ga0495630_0223283 3300046517 Bacteria 1438
220 Ga0495652_0096011 3300046529 Bacteria 2415
221 Ga0495586_0077862 3300046535 Bacteria 1819
222 Ga0495598_0014596 3300046537 Bacteria 1967
223 Ga0495598_0019014 3300046537 Bacteria 1794
224 Ga0495621_0039588 3300046539 Bacteria 1649
225 Ga0495645_0107040 3300046543 Bacteria 1982
226 Ga0495659_0038607 3300046664 Bacteria 1696
227 Ga0495623_0103503 3300046679 Bacteria 1732
228 Ga0495647_0013704 3300046681 Bacteria 2814
229 Ga0495658_0004968 3300046683 Bacteria 6524
230 Ga0495680_0229292 3300047322 Bacteria 1323
231 Ga0496104_0000011 3300048907 Bacteria 459358
232 Ga0496105_0000014 3300048908 Bacteria 220911
233 Ga0496108_0681433 3300048911 Bacteria 892
234 Ga0496112_0103447 3300048915 Bacteria 2818
235 Ga0501040_0145479 3300049576 Bacteria 1671
236 Ga0501042_0483906 3300049578 Bacteria 898
237 Ga0501048_0219145 3300049582 Bacteria 1350
238 Ga0501067_0018477 3300049583 Bacteria 3862
239 Ga0501073_0250553 3300049589 Bacteria 1222
240 Ga0501079_0469472 3300049741 Bacteria 989
241 Ga0501080_0168489 3300049742 Bacteria 2021
242 Ga0501083_0419156 3300049744 Bacteria 871
243 nmdc:mga05p37_244_c1 3300050507 Bacteria 55725
244 nmdc:mga05p37_797494_c1 3300050507 Bacteria 1034
245 nmdc:mga09592_110_c1 3300050508 Bacteria 51342
246 nmdc:mga06r32_270533_c1 3300050510 Bacteria 1686
247 nmdc:mga06r32_772116_c1 3300050510 Bacteria 923
248 nmdc:mga08y16_14649_c1 3300050511 Bacteria 8246
249 nmdc:mga08y16_18664_c1 3300050511 Bacteria 7306
250 nmdc:mga0n895_223894_c1 3300050512 Bacteria 1909
251 nmdc:mga0n895_5722_c1 3300050512 Bacteria 10430
252 nmdc:mga0n895_9195_c1 3300050512 Bacteria 8632
253 nmdc:mga0rr50_10653_c1 3300050513 Bacteria 5848
254 nmdc:mga0rr50_2260_c1 3300050513 Bacteria 10804
255 nmdc:mga08x19_1195_c1 3300050514 Bacteria 16236
256 nmdc:mga08x19_149704_c1 3300050514 Bacteria 1580
257 nmdc:mga08x19_422252_c1 3300050514 Bacteria 937
258 nmdc:mga08x19_70926_c1 3300050514 Bacteria 2271
259 nmdc:mga08x19_7517_c1 3300050514 Bacteria 6473
260 nmdc:mga0a205_124696_c1 3300050515 Bacteria 2475
261 nmdc:mga0a205_160_c1 3300050515 Bacteria 44269
262 nmdc:mga0a205_55715_c1 3300050515 Bacteria 3818
263 Ga0495601_0487288 3300053077 Unclassified 796
264 Ga0500566_0077538 3300053094 Bacteria 1855
265 Ga0501084_0129895 3300054114 Bacteria 2121
266 Ga0501084_0197281 3300054114 Bacteria 1698
267 Ga0501082_0016466 3300060353 Bacteria 6363
268 Ga0530510_0291944 3300061734 Bacteria 1219
269 nmdc:mga0n895_529_c1
270 JGI25406J46586_10046529
271 Ga0065715_10428246
272 Ga0070676_10003854
273 Ga0070683_100098950
274 Ga0070690_100133274
275 Ga0070670_100178327
276 Ga0070670_100312802
277 Ga0070670_100522756
278 Ga0068869_100221856
279 Ga0070666_10225157
280 Ga0070680_100342669
281 Ga0070680_100540135
282 Ga0070687_100078526
283 Ga0070687_100467576
284 Ga0070692_10469692
285 Ga0070668_100303384
286 Ga0070669_100414131
287 Ga0070675_100799880
288 Ga0070671_100276419
289 Ga0070674_100623599
290 Ga0070688_100277837
291 Ga0070688_100571693
292 Ga0070667_100213217
293 Ga0070705_100002213
294 Ga0070705_100149617
295 Ga0070694_100046304
296 Ga0070694_100065081
297 Ga0070694_100194259
298 Ga0070694_100195235
299 Ga0070694_100666995
300 Ga0070678_100062430
301 Ga0070678_100369306
302 Ga0070681_10001159
303 Ga0068867_100136428
304 Ga0068867_100472334
305 Ga0070685_10483435
306 Ga0070699_100114282
307 Ga0070679_100056901
308 Ga0070684_100025330
309 Ga0070697_100117048
310 Ga0068853_100164047
311 Ga0070672_100010609
312 Ga0070686_100291279
313 Ga0070686_100764537
314 Ga0070695_100007996
315 Ga0070696_100002063
316 Ga0070696_100036280
317 Ga0070693_100093064
318 Ga0070665_100107022
319 Ga0070704_100014582
320 Ga0070704_100344520
321 Ga0068855_100172503
322 Ga0068854_100265514
323 Ga0068856_100612791
324 Ga0070702_100354656
325 Ga0068859_100086418
326 Ga0068864_100289224
327 Ga0068864_100366296
328 Ga0068866_10337951
329 Ga0068861_100284557
330 Ga0068863_100260583
331 Ga0068863_100295387
332 Ga0068863_100310822
333 Ga0068858_100059561
334 Ga0068858_100635527
335 Ga0068860_100603512
336 Ga0081539_10002681
337 Ga0070716_100851790
338 Ga0097621_100003503
339 Ga0068871_100001810
340 Ga0068871_100133269
341 Ga0068871_100254323
342 Ga0075431_100024658
343 Ga0075431_100836972
344 Ga0075433_10013597
345 Ga0075433_10082364
346 Ga0075434_100012871
347 Ga0075429_100000184
348 Ga0068865_100003167
349 Ga0068865_100109761
350 Ga0075436_100000890
351 Ga0075436_100055806
352 Ga0075436_100065169
353 Ga0075436_100184350
354 Ga0097620_100086418
355 Ga0075435_100000315
356 Ga0075435_100028871
357 Ga0075435_100605955
358 Ga0099794_10017189
359 Ga0105240_10011255
360 Ga0111539_10006481
361 Ga0111539_10237026
362 Ga0105245_10685342
363 Ga0114129_10000677
364 Ga0114129_11088628
365 Ga0114129_11977186
366 Ga0105241_10076194
367 Ga0105242_10002553
368 Ga0105242_10077698
369 Ga0105237_10011506
370 Ga0105238_10004604
371 Ga0105238_10047996
372 Ga0105249_10047285
373 Ga0105249_10217678
374 Ga0105239_10357633
375 Ga0157369_10331120
376 Ga0157378_10978767
377 Ga0163162_10077418
378 Ga0163162_10190730
379 Ga0163162_11280781
380 Ga0163162_11357584
381 Ga0157372_10107124
382 Ga0157375_10000256
383 Ga0157375_10007114
384 Ga0157375_10700721
385 Ga0163163_10126098
386 Ga0157377_10185760
387 Ga0157379_10601618
388 Ga0157376_10000254
389 Ga0157376_10001188
390 Ga0157376_10330747
391 Ga0163161_10041433
392 Ga0163161_10139835
393 Ga0207653_10097663
394 Ga0207642_10066183
395 Ga0207699_10124859
396 Ga0207645_10368496
397 Ga0207684_10729201
398 Ga0207654_10308719
399 Ga0207707_10000770
400 Ga0207695_10002942
401 Ga0207671_10003439
402 Ga0207662_10055602
403 Ga0207662_10249646
404 Ga0207652_10033338
405 Ga0207681_10035966
406 Ga0207681_10077144
407 Ga0207694_10001329
408 Ga0207650_10234646
409 Ga0207650_10484946
410 Ga0207650_10513972
411 Ga0207659_10124283
412 Ga0207687_10343369
413 Ga0207664_10176946
414 Ga0207644_10060904
415 Ga0207644_10220349
416 Ga0207644_10831445
417 Ga0207686_10029943
418 Ga0207669_10155513
419 Ga0207704_10069762
420 Ga0207704_10110123
421 Ga0207704_10497961
422 Ga0207665_10360387
423 Ga0207665_10780807
424 Ga0207691_10004046
425 Ga0207691_10850819
426 Ga0207689_10271564
427 Ga0207689_10298524
428 Ga0207661_10044850
429 Ga0207667_10384127
430 Ga0207712_10195629
431 Ga0207668_10169650
432 Ga0207640_10469744
433 Ga0207658_10104798
434 Ga0207677_10494812
435 Ga0207703_10068300
436 Ga0207639_10083068
437 Ga0207639_10258742
438 Ga0207639_10460845
439 Ga0207641_10306384
440 Ga0207641_10322240
441 Ga0207676_10004626
442 Ga0207676_10071355
443 Ga0207675_100376432
444 Ga0207683_10018044
445 Ga0207683_10325264
446 Ga0209967_1000844
447 Ga0209588_1008032
448 Ga0207428_10001488
449 Ga0207428_10041644
450 Ga0307408_100516089
451 Ga0307410_10291730
452 Ga0307409_100101062
453 Ga0307411_10668529
454 Ga0307415_100730641
455 Ga0373952_0005646
456 Ga0373923_0309209
457 Ga0373939_0029667
458 Ga0373941_0026280
459 Ga0373953_0053268
460 Ga0373924_0097543
461 Ga0373931_0051849
462 Ga0373931_0091942
463 Ga0373931_0471815
464 Ga0373935_0206619
465 Ga0373927_0009173
466 Ga0373933_0103073
467 Ga0373937_0010574
468 Ga0373937_0036857
469 Ga0373937_0176160
470 Ga0373937_0563693
471 Ga0373925_0013262
472 Ga0373925_0041616
473 Ga0439446_0006369
474 Ga0439434_0000279
475 Ga0439435_0000133
476 Ga0451577_0118843
477 Ga0466964_0045858
478 Ga0466968_0344655
479 Ga0451576_0003283
480 Ga0451576_0415665
481 Ga0451576_0521482
482 Ga0495629_0057666
483 Ga0495651_0022213
484 Ga0495580_0030395
485 Ga0495582_0013614
486 Ga0495639_0038071
487 Ga0495630_0223283
488 Ga0495652_0096011
489 Ga0495586_0077862
490 Ga0495598_0014596
491 Ga0495598_0019014
492 Ga0495621_0039588
493 Ga0495645_0107040
494 Ga0495659_0038607
495 Ga0495623_0103503
496 Ga0495647_0013704
497 Ga0495658_0004968
498 Ga0495680_0229292
499 Ga0496104_0000011
500 Ga0496105_0000014
501 Ga0496108_0681433
502 Ga0496112_0103447
503 Ga0501040_0145479
504 Ga0501042_0483906
505 Ga0501048_0219145
506 Ga0501067_0018477
507 Ga0501073_0250553
508 Ga0501079_0469472
509 Ga0501080_0168489
510 Ga0501083_0419156
511 nmdc:mga05p37_244_c1
512 nmdc:mga05p37_797494_c1
513 nmdc:mga09592_110_c1
514 nmdc:mga06r32_270533_c1
515 nmdc:mga06r32_772116_c1
516 nmdc:mga08y16_14649_c1
517 nmdc:mga08y16_18664_c1
518 nmdc:mga0n895_223894_c1
519 nmdc:mga0n895_5722_c1
520 nmdc:mga0n895_9195_c1
521 nmdc:mga0rr50_10653_c1
522 nmdc:mga0rr50_2260_c1
523 nmdc:mga08x19_1195_c1
524 nmdc:mga08x19_149704_c1
525 nmdc:mga08x19_422252_c1
526 nmdc:mga08x19_70926_c1
527 nmdc:mga08x19_7517_c1
528 nmdc:mga0a205_124696_c1
529 nmdc:mga0a205_160_c1
530 nmdc:mga0a205_55715_c1
531 Ga0495601_0487288
532 Ga0500566_0077538
533 Ga0501084_0129895
534 Ga0501084_0197281
535 Ga0501082_0016466
536 Ga0530510_0291944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

59

191

0.97

PF00578

AhpC-TSA

AhpC/TSA family

57

194

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.899 23 175
2b7k-assembly3.cif.gz_C crystal structure of yeast sco1 0.8956 20 179
2b7j-assembly4.cif.gz_D crystal structure of yeast sco1 with copper bound 0.8886 21 179
2b7k-assembly4.cif.gz_D crystal structure of yeast sco1 0.8807 21 179
1wp0-assembly1.cif.gz_A human sco1 0.878 26 173
ID Description Score Start End Superfamily
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9475 24 179 3.40.30.10
af_O42899_78_257_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9423 22 173 3.40.30.10
af_Q8IC00_108_304_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9291 22 178 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9247 24 179 3.40.30.10
af_Q4CYL4_166_345_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9245 22 178 3.40.30.10
ID Description Score Start End GO Terms
AF-F3FNZ5-F1-model_v4 Twin-arginine translocation pathway signal 0.991 24 113 GO:0046872
AF-A0A537BV44-F1-model_v4 SCO family protein 0.9783 7 176 GO:0046872
AF-A0A257FJ18-F1-model_v4 deleted 0.9743 12 132
AF-A0A4Q3JSY0-F1-model_v4 deleted 0.9734 11 175
AF-A0A357I7F2-F1-model_v4 SCO family protein 0.9701 22 176 GO:0046872

Map