F375697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 153 | 536 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0002877|Ga0453684_0002877_14901_15311 |
| Length | 136 |
| Sequence | MKNNNVTSFGYSQNQAQSVKRIKLPEIEAWENQYRRDYVIKIVHPEFTSVCPKTGLPDFGTITVEYVPGKLCLELKSLKYYFLQYRNCGIFMENIANRVLDDVVKAIKPKSCTVTGDFTPRGGLSSIITAQYKAKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 56 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 57 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 88 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 96 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 97 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 98 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 99 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 100 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 101 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 102 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 103 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 105 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 106 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 109 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 110 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 111 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 146 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 149 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 153 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 1.87 |
| Rhizosphere | 94.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0002877 | 3300044712 | Bacteria | 40377 |
| 2 | Ga0070683_100178914 | 3300005329 | Bacteria | 2013 |
| 3 | Ga0070683_100184994 | 3300005329 | Bacteria | 1978 |
| 4 | Ga0070690_100295974 | 3300005330 | Bacteria | 1159 |
| 5 | Ga0070690_100458978 | 3300005330 | Bacteria | 946 |
| 6 | Ga0070666_10316485 | 3300005335 | Bacteria | 1113 |
| 7 | Ga0070666_10509012 | 3300005335 | Bacteria | 873 |
| 8 | Ga0070680_100044912 | 3300005336 | Bacteria | 3591 |
| 9 | Ga0070680_100172654 | 3300005336 | Bacteria | 1819 |
| 10 | Ga0070682_101105471 | 3300005337 | Bacteria | 664 |
| 11 | Ga0070687_100899472 | 3300005343 | Bacteria | 635 |
| 12 | Ga0070688_100233960 | 3300005365 | Bacteria | 1301 |
| 13 | Ga0070659_101345571 | 3300005366 | Bacteria | 634 |
| 14 | Ga0070709_11258334 | 3300005434 | Unclassified | 596 |
| 15 | Ga0070709_11330120 | 3300005434 | Unclassified | 580 |
| 16 | Ga0070713_100040341 | 3300005436 | Bacteria | 3795 |
| 17 | Ga0070713_100368726 | 3300005436 | Bacteria | 1336 |
| 18 | Ga0070711_100882953 | 3300005439 | Bacteria | 762 |
| 19 | Ga0070678_100199925 | 3300005456 | Bacteria | 1649 |
| 20 | Ga0070678_101180434 | 3300005456 | Bacteria | 709 |
| 21 | Ga0070681_10027795 | 3300005458 | Bacteria | 5687 |
| 22 | Ga0068867_100508811 | 3300005459 | Bacteria | 1036 |
| 23 | Ga0068867_102140990 | 3300005459 | Unclassified | 530 |
| 24 | Ga0070679_100419808 | 3300005530 | Bacteria | 1283 |
| 25 | Ga0070684_100000004 | 3300005535 | Bacteria | 231043 |
| 26 | Ga0070684_100607386 | 3300005535 | Bacteria | 1017 |
| 27 | Ga0070684_100934006 | 3300005535 | Unclassified | 813 |
| 28 | Ga0070686_100140447 | 3300005544 | Unclassified | 1681 |
| 29 | Ga0070695_100653801 | 3300005545 | Unclassified | 830 |
| 30 | Ga0070665_100127162 | 3300005548 | Unclassified | 2551 |
| 31 | Ga0068855_100126224 | 3300005563 | Bacteria | 2925 |
| 32 | Ga0068855_101675654 | 3300005563 | Bacteria | 649 |
| 33 | Ga0070664_101205682 | 3300005564 | Bacteria | 714 |
| 34 | Ga0070664_101706662 | 3300005564 | Unclassified | 597 |
| 35 | Ga0068856_101298602 | 3300005614 | Bacteria | 743 |
| 36 | Ga0070702_100710848 | 3300005615 | Unclassified | 767 |
| 37 | Ga0068859_100272059 | 3300005617 | Bacteria | 1786 |
| 38 | Ga0068859_100684021 | 3300005617 | Bacteria | 1117 |
| 39 | Ga0068864_100075198 | 3300005618 | Bacteria | 2949 |
| 40 | Ga0068864_100864182 | 3300005618 | Unclassified | 892 |
| 41 | Ga0068864_101527607 | 3300005618 | Bacteria | 671 |
| 42 | Ga0068858_100958230 | 3300005842 | Bacteria | 838 |
| 43 | Ga0070717_10206446 | 3300006028 | Unclassified | 1723 |
| 44 | Ga0070717_10611171 | 3300006028 | Bacteria | 989 |
| 45 | Ga0070717_10965316 | 3300006028 | Unclassified | 776 |
| 46 | Ga0075364_10214868 | 3300006051 | Unclassified | 1304 |
| 47 | Ga0097621_100561563 | 3300006237 | Unclassified | 1040 |
| 48 | Ga0097621_100839185 | 3300006237 | Bacteria | 853 |
| 49 | Ga0068871_101356540 | 3300006358 | Unclassified | 670 |
| 50 | Ga0075428_101642224 | 3300006844 | Bacteria | 671 |
| 51 | Ga0097620_100272037 | 3300006931 | Bacteria | 1786 |
| 52 | Ga0097620_100684209 | 3300006931 | Bacteria | 1117 |
| 53 | Ga0105240_10003450 | 3300009093 | Bacteria | 24537 |
| 54 | Ga0105240_10117912 | 3300009093 | Bacteria | 3200 |
| 55 | Ga0105240_10704416 | 3300009093 | Bacteria | 1102 |
| 56 | Ga0105240_12193143 | 3300009093 | Unclassified | 573 |
| 57 | Ga0111539_12513918 | 3300009094 | Unclassified | 597 |
| 58 | Ga0105243_11123933 | 3300009148 | Bacteria | 795 |
| 59 | Ga0105242_12299312 | 3300009176 | Unclassified | 585 |
| 60 | Ga0105248_10042722 | 3300009177 | Bacteria | 5083 |
| 61 | Ga0105248_10101505 | 3300009177 | Bacteria | 3243 |
| 62 | Ga0105248_10335605 | 3300009177 | Bacteria | 1702 |
| 63 | Ga0105248_10474322 | 3300009177 | Bacteria | 1410 |
| 64 | Ga0105248_10779992 | 3300009177 | Bacteria | 1079 |
| 65 | Ga0105248_11515045 | 3300009177 | Unclassified | 759 |
| 66 | Ga0105248_11649896 | 3300009177 | Bacteria | 726 |
| 67 | Ga0105237_10003745 | 3300009545 | Bacteria | 17911 |
| 68 | Ga0105237_10881429 | 3300009545 | Unclassified | 902 |
| 69 | Ga0105239_10359175 | 3300010375 | Unclassified | 1645 |
| 70 | Ga0105239_12231810 | 3300010375 | Unclassified | 637 |
| 71 | Ga0105246_11472273 | 3300011119 | Unclassified | 638 |
| 72 | Ga0157370_10829245 | 3300013104 | Unclassified | 841 |
| 73 | Ga0157370_11798554 | 3300013104 | Unclassified | 550 |
| 74 | Ga0157369_11192672 | 3300013105 | Bacteria | 777 |
| 75 | Ga0157374_10419735 | 3300013296 | Bacteria | 1336 |
| 76 | Ga0157374_10452038 | 3300013296 | Unclassified | 1286 |
| 77 | Ga0157378_11546428 | 3300013297 | Unclassified | 709 |
| 78 | Ga0163162_10192413 | 3300013306 | Bacteria | 2168 |
| 79 | Ga0163162_11754244 | 3300013306 | Bacteria | 709 |
| 80 | Ga0157372_10687103 | 3300013307 | Bacteria | 1191 |
| 81 | Ga0157372_10695985 | 3300013307 | Unclassified | 1183 |
| 82 | Ga0157372_10819810 | 3300013307 | Bacteria | 1081 |
| 83 | Ga0157375_10524517 | 3300013308 | Bacteria | 1347 |
| 84 | Ga0157375_10934023 | 3300013308 | Bacteria | 1010 |
| 85 | Ga0163163_10041970 | 3300014325 | Bacteria | 4477 |
| 86 | Ga0163163_10382621 | 3300014325 | Bacteria | 1465 |
| 87 | Ga0163163_10481183 | 3300014325 | Bacteria | 1302 |
| 88 | Ga0163163_10622033 | 3300014325 | Bacteria | 1143 |
| 89 | Ga0157380_12156960 | 3300014326 | Unclassified | 621 |
| 90 | Ga0157377_10827741 | 3300014745 | Bacteria | 685 |
| 91 | Ga0157379_10539414 | 3300014968 | Unclassified | 1084 |
| 92 | Ga0157376_10024552 | 3300014969 | Bacteria | 4735 |
| 93 | Ga0157376_10079220 | 3300014969 | Bacteria | 2816 |
| 94 | Ga0157376_10522442 | 3300014969 | Unclassified | 1170 |
| 95 | Ga0157376_10946018 | 3300014969 | Bacteria | 882 |
| 96 | Ga0157376_12650969 | 3300014969 | Unclassified | 541 |
| 97 | Ga0163161_10941330 | 3300017792 | Bacteria | 734 |
| 98 | Ga0213876_10162957 | 3300021384 | Bacteria | 1186 |
| 99 | Ga0213875_10014464 | 3300021388 | Bacteria | 3850 |
| 100 | Ga0213875_10281483 | 3300021388 | Unclassified | 785 |
| 101 | Ga0207692_11220044 | 3300025898 | Unclassified | 500 |
| 102 | Ga0207680_10274864 | 3300025903 | Bacteria | 1169 |
| 103 | Ga0207699_11494519 | 3300025906 | Bacteria | 500 |
| 104 | Ga0207645_10245399 | 3300025907 | Bacteria | 1184 |
| 105 | Ga0207705_10097401 | 3300025909 | Bacteria | 2160 |
| 106 | Ga0207707_10178324 | 3300025912 | Bacteria | 1855 |
| 107 | Ga0207695_10006430 | 3300025913 | Bacteria | 15254 |
| 108 | Ga0207695_10457117 | 3300025913 | Bacteria | 1160 |
| 109 | Ga0207695_11413054 | 3300025913 | Unclassified | 576 |
| 110 | Ga0207671_10007717 | 3300025914 | Bacteria | 9279 |
| 111 | Ga0207671_10571785 | 3300025914 | Unclassified | 901 |
| 112 | Ga0207660_10109222 | 3300025917 | Unclassified | 2079 |
| 113 | Ga0207660_10668420 | 3300025917 | Bacteria | 847 |
| 114 | Ga0207662_10219786 | 3300025918 | Bacteria | 1237 |
| 115 | Ga0207657_11096843 | 3300025919 | Unclassified | 608 |
| 116 | Ga0207652_10332921 | 3300025921 | Bacteria | 1371 |
| 117 | Ga0207646_11189401 | 3300025922 | Bacteria | 669 |
| 118 | Ga0207700_10084568 | 3300025928 | Unclassified | 2487 |
| 119 | Ga0207669_10136539 | 3300025937 | Bacteria | 1695 |
| 120 | Ga0207665_10146921 | 3300025939 | Bacteria | 1685 |
| 121 | Ga0207711_10038538 | 3300025941 | Unclassified | 4065 |
| 122 | Ga0207711_10072466 | 3300025941 | Bacteria | 2993 |
| 123 | Ga0207711_10379409 | 3300025941 | Bacteria | 1312 |
| 124 | Ga0207711_10896272 | 3300025941 | Unclassified | 825 |
| 125 | Ga0207661_10000055 | 3300025944 | Bacteria | 86544 |
| 126 | Ga0207679_11379835 | 3300025945 | Unclassified | 647 |
| 127 | Ga0207667_10478151 | 3300025949 | Bacteria | 1265 |
| 128 | Ga0207667_10681447 | 3300025949 | Bacteria | 1031 |
| 129 | Ga0207651_10724283 | 3300025960 | Bacteria | 878 |
| 130 | Ga0207703_11013931 | 3300026035 | Bacteria | 796 |
| 131 | Ga0207703_11585355 | 3300026035 | Unclassified | 630 |
| 132 | Ga0207703_11693933 | 3300026035 | Unclassified | 608 |
| 133 | Ga0207702_10647341 | 3300026078 | Bacteria | 1039 |
| 134 | Ga0207702_12048950 | 3300026078 | Unclassified | 562 |
| 135 | Ga0207641_10049790 | 3300026088 | Bacteria | 3542 |
| 136 | Ga0207641_10493693 | 3300026088 | Bacteria | 1188 |
| 137 | Ga0207648_10306179 | 3300026089 | Bacteria | 1426 |
| 138 | Ga0207676_10472256 | 3300026095 | Unclassified | 1186 |
| 139 | Ga0207676_11099474 | 3300026095 | Bacteria | 786 |
| 140 | Ga0207675_101131619 | 3300026118 | Bacteria | 803 |
| 141 | Ga0207683_10202348 | 3300026121 | Bacteria | 1805 |
| 142 | Ga0268266_10161322 | 3300028379 | Bacteria | 2029 |
| 143 | Ga0268266_10560276 | 3300028379 | Unclassified | 1096 |
| 144 | Ga0268266_10736913 | 3300028379 | Bacteria | 951 |
| 145 | Ga0268264_11424262 | 3300028381 | Bacteria | 703 |
| 146 | Ga0265323_10000308 | 3300028653 | Bacteria | 28119 |
| 147 | Ga0265332_10016870 | 3300031238 | Bacteria | 3220 |
| 148 | Ga0265328_10215889 | 3300031239 | Unclassified | 730 |
| 149 | Ga0265325_10115245 | 3300031241 | Bacteria | 1301 |
| 150 | Ga0265329_10295965 | 3300031242 | Bacteria | 546 |
| 151 | Ga0265340_10056830 | 3300031247 | Bacteria | 1882 |
| 152 | Ga0265331_10051119 | 3300031250 | Unclassified | 1979 |
| 153 | Ga0265316_10001657 | 3300031344 | Bacteria | 23702 |
| 154 | Ga0265316_10014830 | 3300031344 | Bacteria | 6838 |
| 155 | Ga0265316_10070822 | 3300031344 | Unclassified | 2689 |
| 156 | Ga0265316_10072870 | 3300031344 | Bacteria | 2646 |
| 157 | Ga0265316_10147747 | 3300031344 | Bacteria | 1762 |
| 158 | Ga0265316_10173538 | 3300031344 | Bacteria | 1607 |
| 159 | Ga0265316_10287030 | 3300031344 | Bacteria | 1201 |
| 160 | Ga0265316_10386651 | 3300031344 | Bacteria | 1009 |
| 161 | Ga0265316_10503166 | 3300031344 | Unclassified | 865 |
| 162 | Ga0265316_10759267 | 3300031344 | Bacteria | 681 |
| 163 | Ga0316575_10245729 | 3300031665 | Unclassified | 750 |
| 164 | Ga0316576_10045225 | 3300031727 | Unclassified | 3183 |
| 165 | Ga0316576_10293531 | 3300031727 | Unclassified | 1216 |
| 166 | Ga0316576_11173504 | 3300031727 | Bacteria | 543 |
| 167 | Ga0373953_0073208 | 3300035117 | Unclassified | 1416 |
| 168 | Ga0373954_0066258 | 3300035118 | Unclassified | 1710 |
| 169 | Ga0373955_0457885 | 3300035172 | Bacteria | 778 |
| 170 | Ga0373955_1019782 | 3300035172 | Bacteria | 510 |
| 171 | Ga0373927_0259746 | 3300035695 | Bacteria | 1142 |
| 172 | Ga0373927_0483751 | 3300035695 | Bacteria | 818 |
| 173 | Ga0373927_1089964 | 3300035695 | Bacteria | 527 |
| 174 | Ga0373933_0825278 | 3300035724 | Bacteria | 610 |
| 175 | Ga0373947_0270950 | 3300035725 | Bacteria | 1127 |
| 176 | Ga0373937_0220881 | 3300036401 | Bacteria | 1784 |
| 177 | Ga0373937_0355478 | 3300036401 | Unclassified | 1388 |
| 178 | Ga0373937_1057898 | 3300036401 | Unclassified | 760 |
| 179 | Ga0316582_1013390 | 3300036647 | Unclassified | 567 |
| 180 | Ga0316584_0113534 | 3300036712 | Bacteria | 2027 |
| 181 | Ga0316584_0729114 | 3300036712 | Bacteria | 678 |
| 182 | Ga0373925_0254594 | 3300037068 | Unclassified | 1409 |
| 183 | Ga0373925_1112524 | 3300037068 | Unclassified | 650 |
| 184 | Ga0436364_0579727 | 3300037853 | Bacteria | 11000 |
| 185 | Ga0436364_0722734 | 3300037853 | Bacteria | 1094 |
| 186 | Ga0436364_0971586 | 3300037853 | Unclassified | 2722 |
| 187 | Ga0436365_0666376 | 3300039437 | Bacteria | 5232 |
| 188 | Ga0451577_1153015 | 3300042876 | Bacteria | 692 |
| 189 | Ga0451576_0000405 | 3300045051 | Bacteria | 100277 |
| 190 | Ga0451576_0000911 | 3300045051 | Bacteria | 56009 |
| 191 | Ga0451576_0017174 | 3300045051 | Bacteria | 7960 |
| 192 | Ga0451576_0386154 | 3300045051 | Unclassified | 1468 |
| 193 | Ga0451576_1080951 | 3300045051 | Unclassified | 840 |
| 194 | Ga0495603_0746662 | 3300046455 | Unclassified | 559 |
| 195 | Ga0495629_0255548 | 3300046459 | Bacteria | 1205 |
| 196 | Ga0495651_0112245 | 3300046462 | Bacteria | 2014 |
| 197 | Ga0495651_0294409 | 3300046462 | Bacteria | 1091 |
| 198 | Ga0495653_0456439 | 3300046463 | Unclassified | 803 |
| 199 | Ga0495653_0519990 | 3300046463 | Unclassified | 740 |
| 200 | Ga0495580_0001715 | 3300046472 | Bacteria | 19256 |
| 201 | Ga0495580_0009584 | 3300046472 | Bacteria | 7607 |
| 202 | Ga0495580_0144953 | 3300046472 | Unclassified | 1646 |
| 203 | Ga0495639_0203098 | 3300046475 | Bacteria | 971 |
| 204 | Ga0495639_0633480 | 3300046475 | Unclassified | 551 |
| 205 | Ga0495662_0324430 | 3300046476 | Bacteria | 757 |
| 206 | Ga0495664_0713750 | 3300046477 | Unclassified | 592 |
| 207 | Ga0495584_0461469 | 3300046491 | Bacteria | 646 |
| 208 | Ga0495594_0250444 | 3300046499 | Bacteria | 1009 |
| 209 | Ga0495608_0346171 | 3300046511 | Unclassified | 915 |
| 210 | Ga0495618_0220718 | 3300046514 | Bacteria | 1196 |
| 211 | Ga0495618_0604995 | 3300046514 | Bacteria | 652 |
| 212 | Ga0495628_0205213 | 3300046516 | Unclassified | 1484 |
| 213 | Ga0495630_0315691 | 3300046517 | Unclassified | 1195 |
| 214 | Ga0495642_0294296 | 3300046528 | Bacteria | 711 |
| 215 | Ga0495665_0114366 | 3300046531 | Bacteria | 1414 |
| 216 | Ga0495640_0082912 | 3300046533 | Bacteria | 2128 |
| 217 | Ga0495640_0174443 | 3300046533 | Bacteria | 1373 |
| 218 | Ga0495640_0402860 | 3300046533 | Bacteria | 840 |
| 219 | Ga0495586_0836801 | 3300046535 | Unclassified | 531 |
| 220 | Ga0495645_0009511 | 3300046543 | Bacteria | 6795 |
| 221 | Ga0495645_0193393 | 3300046543 | Bacteria | 1385 |
| 222 | Ga0495667_0115275 | 3300046559 | Bacteria | 1736 |
| 223 | Ga0495667_0127714 | 3300046559 | Bacteria | 1640 |
| 224 | Ga0495667_0954362 | 3300046559 | Unclassified | 524 |
| 225 | Ga0495634_0308146 | 3300046642 | Bacteria | 956 |
| 226 | Ga0495635_0566935 | 3300046663 | Bacteria | 743 |
| 227 | Ga0495599_0120157 | 3300046678 | Bacteria | 1634 |
| 228 | Ga0495599_0561028 | 3300046678 | Unclassified | 668 |
| 229 | Ga0495599_0764992 | 3300046678 | Bacteria | 553 |
| 230 | Ga0495623_0020895 | 3300046679 | Bacteria | 4231 |
| 231 | Ga0495623_0149272 | 3300046679 | Bacteria | 1383 |
| 232 | Ga0495623_0310575 | 3300046679 | Unclassified | 869 |
| 233 | Ga0495658_0458545 | 3300046683 | Bacteria | 814 |
| 234 | Ga0495613_0157933 | 3300046689 | Bacteria | 1615 |
| 235 | Ga0495613_0569850 | 3300046689 | Unclassified | 756 |
| 236 | Ga0495581_0684847 | 3300047315 | Bacteria | 592 |
| 237 | Ga0495604_0023928 | 3300047317 | Bacteria | 4876 |
| 238 | Ga0495604_0190690 | 3300047317 | Bacteria | 1428 |
| 239 | Ga0495674_0004940 | 3300047319 | Bacteria | 12823 |
| 240 | Ga0495674_0024324 | 3300047319 | Bacteria | 5566 |
| 241 | Ga0495674_0103710 | 3300047319 | Bacteria | 2417 |
| 242 | Ga0495674_0381656 | 3300047319 | Bacteria | 1140 |
| 243 | Ga0495674_0971234 | 3300047319 | Bacteria | 652 |
| 244 | Ga0495675_0093594 | 3300047444 | Bacteria | 1885 |
| 245 | Ga0495675_0149721 | 3300047444 | Unclassified | 1442 |
| 246 | Ga0495675_0188808 | 3300047444 | Bacteria | 1259 |
| 247 | Ga0495675_0235447 | 3300047444 | Bacteria | 1104 |
| 248 | Ga0495675_0494186 | 3300047444 | Unclassified | 703 |
| 249 | Ga0495684_0022987 | 3300047471 | Bacteria | 4796 |
| 250 | Ga0495684_0044276 | 3300047471 | Bacteria | 3407 |
| 251 | Ga0495684_0093641 | 3300047471 | Bacteria | 2275 |
| 252 | Ga0495684_0267859 | 3300047471 | Bacteria | 1237 |
| 253 | Ga0495684_0570985 | 3300047471 | Bacteria | 767 |
| 254 | Ga0495593_0064580 | 3300047673 | Bacteria | 1911 |
| 255 | Ga0495602_0050049 | 3300048088 | Bacteria | 3737 |
| 256 | Ga0495602_0336412 | 3300048088 | Bacteria | 1093 |
| 257 | Ga0495614_0048707 | 3300048089 | Bacteria | 1817 |
| 258 | Ga0496106_1216706 | 3300048909 | Bacteria | 587 |
| 259 | Ga0496109_1110466 | 3300048912 | Bacteria | 728 |
| 260 | Ga0496112_0414192 | 3300048915 | Bacteria | 1287 |
| 261 | Ga0496115_0124184 | 3300048918 | Unclassified | 2126 |
| 262 | Ga0496115_0148623 | 3300048918 | Bacteria | 1934 |
| 263 | Ga0501046_0145111 | 3300049580 | Bacteria | 1793 |
| 264 | Ga0501047_0307278 | 3300049581 | Bacteria | 1427 |
| 265 | Ga0501048_1146905 | 3300049582 | Bacteria | 559 |
| 266 | nmdc:mga00v17_71685_c1 | 3300050491 | Unclassified | 2148 |
| 267 | Ga0495619_0256149 | 3300053085 | Bacteria | 1213 |
| 268 | Ga0495619_0657134 | 3300053085 | Bacteria | 715 |
| 269 | Ga0453684_0002877 | |||
| 270 | Ga0070683_100178914 | |||
| 271 | Ga0070683_100184994 | |||
| 272 | Ga0070690_100295974 | |||
| 273 | Ga0070690_100458978 | |||
| 274 | Ga0070666_10316485 | |||
| 275 | Ga0070666_10509012 | |||
| 276 | Ga0070680_100044912 | |||
| 277 | Ga0070680_100172654 | |||
| 278 | Ga0070682_101105471 | |||
| 279 | Ga0070687_100899472 | |||
| 280 | Ga0070688_100233960 | |||
| 281 | Ga0070659_101345571 | |||
| 282 | Ga0070709_11258334 | |||
| 283 | Ga0070709_11330120 | |||
| 284 | Ga0070713_100040341 | |||
| 285 | Ga0070713_100368726 | |||
| 286 | Ga0070711_100882953 | |||
| 287 | Ga0070678_100199925 | |||
| 288 | Ga0070678_101180434 | |||
| 289 | Ga0070681_10027795 | |||
| 290 | Ga0068867_100508811 | |||
| 291 | Ga0068867_102140990 | |||
| 292 | Ga0070679_100419808 | |||
| 293 | Ga0070684_100000004 | |||
| 294 | Ga0070684_100607386 | |||
| 295 | Ga0070684_100934006 | |||
| 296 | Ga0070686_100140447 | |||
| 297 | Ga0070695_100653801 | |||
| 298 | Ga0070665_100127162 | |||
| 299 | Ga0068855_100126224 | |||
| 300 | Ga0068855_101675654 | |||
| 301 | Ga0070664_101205682 | |||
| 302 | Ga0070664_101706662 | |||
| 303 | Ga0068856_101298602 | |||
| 304 | Ga0070702_100710848 | |||
| 305 | Ga0068859_100272059 | |||
| 306 | Ga0068859_100684021 | |||
| 307 | Ga0068864_100075198 | |||
| 308 | Ga0068864_100864182 | |||
| 309 | Ga0068864_101527607 | |||
| 310 | Ga0068858_100958230 | |||
| 311 | Ga0070717_10206446 | |||
| 312 | Ga0070717_10611171 | |||
| 313 | Ga0070717_10965316 | |||
| 314 | Ga0075364_10214868 | |||
| 315 | Ga0097621_100561563 | |||
| 316 | Ga0097621_100839185 | |||
| 317 | Ga0068871_101356540 | |||
| 318 | Ga0075428_101642224 | |||
| 319 | Ga0097620_100272037 | |||
| 320 | Ga0097620_100684209 | |||
| 321 | Ga0105240_10003450 | |||
| 322 | Ga0105240_10117912 | |||
| 323 | Ga0105240_10704416 | |||
| 324 | Ga0105240_12193143 | |||
| 325 | Ga0111539_12513918 | |||
| 326 | Ga0105243_11123933 | |||
| 327 | Ga0105242_12299312 | |||
| 328 | Ga0105248_10042722 | |||
| 329 | Ga0105248_10101505 | |||
| 330 | Ga0105248_10335605 | |||
| 331 | Ga0105248_10474322 | |||
| 332 | Ga0105248_10779992 | |||
| 333 | Ga0105248_11515045 | |||
| 334 | Ga0105248_11649896 | |||
| 335 | Ga0105237_10003745 | |||
| 336 | Ga0105237_10881429 | |||
| 337 | Ga0105239_10359175 | |||
| 338 | Ga0105239_12231810 | |||
| 339 | Ga0105246_11472273 | |||
| 340 | Ga0157370_10829245 | |||
| 341 | Ga0157370_11798554 | |||
| 342 | Ga0157369_11192672 | |||
| 343 | Ga0157374_10419735 | |||
| 344 | Ga0157374_10452038 | |||
| 345 | Ga0157378_11546428 | |||
| 346 | Ga0163162_10192413 | |||
| 347 | Ga0163162_11754244 | |||
| 348 | Ga0157372_10687103 | |||
| 349 | Ga0157372_10695985 | |||
| 350 | Ga0157372_10819810 | |||
| 351 | Ga0157375_10524517 | |||
| 352 | Ga0157375_10934023 | |||
| 353 | Ga0163163_10041970 | |||
| 354 | Ga0163163_10382621 | |||
| 355 | Ga0163163_10481183 | |||
| 356 | Ga0163163_10622033 | |||
| 357 | Ga0157380_12156960 | |||
| 358 | Ga0157377_10827741 | |||
| 359 | Ga0157379_10539414 | |||
| 360 | Ga0157376_10024552 | |||
| 361 | Ga0157376_10079220 | |||
| 362 | Ga0157376_10522442 | |||
| 363 | Ga0157376_10946018 | |||
| 364 | Ga0157376_12650969 | |||
| 365 | Ga0163161_10941330 | |||
| 366 | Ga0213876_10162957 | |||
| 367 | Ga0213875_10014464 | |||
| 368 | Ga0213875_10281483 | |||
| 369 | Ga0207692_11220044 | |||
| 370 | Ga0207680_10274864 | |||
| 371 | Ga0207699_11494519 | |||
| 372 | Ga0207645_10245399 | |||
| 373 | Ga0207705_10097401 | |||
| 374 | Ga0207707_10178324 | |||
| 375 | Ga0207695_10006430 | |||
| 376 | Ga0207695_10457117 | |||
| 377 | Ga0207695_11413054 | |||
| 378 | Ga0207671_10007717 | |||
| 379 | Ga0207671_10571785 | |||
| 380 | Ga0207660_10109222 | |||
| 381 | Ga0207660_10668420 | |||
| 382 | Ga0207662_10219786 | |||
| 383 | Ga0207657_11096843 | |||
| 384 | Ga0207652_10332921 | |||
| 385 | Ga0207646_11189401 | |||
| 386 | Ga0207700_10084568 | |||
| 387 | Ga0207669_10136539 | |||
| 388 | Ga0207665_10146921 | |||
| 389 | Ga0207711_10038538 | |||
| 390 | Ga0207711_10072466 | |||
| 391 | Ga0207711_10379409 | |||
| 392 | Ga0207711_10896272 | |||
| 393 | Ga0207661_10000055 | |||
| 394 | Ga0207679_11379835 | |||
| 395 | Ga0207667_10478151 | |||
| 396 | Ga0207667_10681447 | |||
| 397 | Ga0207651_10724283 | |||
| 398 | Ga0207703_11013931 | |||
| 399 | Ga0207703_11585355 | |||
| 400 | Ga0207703_11693933 | |||
| 401 | Ga0207702_10647341 | |||
| 402 | Ga0207702_12048950 | |||
| 403 | Ga0207641_10049790 | |||
| 404 | Ga0207641_10493693 | |||
| 405 | Ga0207648_10306179 | |||
| 406 | Ga0207676_10472256 | |||
| 407 | Ga0207676_11099474 | |||
| 408 | Ga0207675_101131619 | |||
| 409 | Ga0207683_10202348 | |||
| 410 | Ga0268266_10161322 | |||
| 411 | Ga0268266_10560276 | |||
| 412 | Ga0268266_10736913 | |||
| 413 | Ga0268264_11424262 | |||
| 414 | Ga0265323_10000308 | |||
| 415 | Ga0265332_10016870 | |||
| 416 | Ga0265328_10215889 | |||
| 417 | Ga0265325_10115245 | |||
| 418 | Ga0265329_10295965 | |||
| 419 | Ga0265340_10056830 | |||
| 420 | Ga0265331_10051119 | |||
| 421 | Ga0265316_10001657 | |||
| 422 | Ga0265316_10014830 | |||
| 423 | Ga0265316_10070822 | |||
| 424 | Ga0265316_10072870 | |||
| 425 | Ga0265316_10147747 | |||
| 426 | Ga0265316_10173538 | |||
| 427 | Ga0265316_10287030 | |||
| 428 | Ga0265316_10386651 | |||
| 429 | Ga0265316_10503166 | |||
| 430 | Ga0265316_10759267 | |||
| 431 | Ga0316575_10245729 | |||
| 432 | Ga0316576_10045225 | |||
| 433 | Ga0316576_10293531 | |||
| 434 | Ga0316576_11173504 | |||
| 435 | Ga0373953_0073208 | |||
| 436 | Ga0373954_0066258 | |||
| 437 | Ga0373955_0457885 | |||
| 438 | Ga0373955_1019782 | |||
| 439 | Ga0373927_0259746 | |||
| 440 | Ga0373927_0483751 | |||
| 441 | Ga0373927_1089964 | |||
| 442 | Ga0373933_0825278 | |||
| 443 | Ga0373947_0270950 | |||
| 444 | Ga0373937_0220881 | |||
| 445 | Ga0373937_0355478 | |||
| 446 | Ga0373937_1057898 | |||
| 447 | Ga0316582_1013390 | |||
| 448 | Ga0316584_0113534 | |||
| 449 | Ga0316584_0729114 | |||
| 450 | Ga0373925_0254594 | |||
| 451 | Ga0373925_1112524 | |||
| 452 | Ga0436364_0579727 | |||
| 453 | Ga0436364_0722734 | |||
| 454 | Ga0436364_0971586 | |||
| 455 | Ga0436365_0666376 | |||
| 456 | Ga0451577_1153015 | |||
| 457 | Ga0451576_0000405 | |||
| 458 | Ga0451576_0000911 | |||
| 459 | Ga0451576_0017174 | |||
| 460 | Ga0451576_0386154 | |||
| 461 | Ga0451576_1080951 | |||
| 462 | Ga0495603_0746662 | |||
| 463 | Ga0495629_0255548 | |||
| 464 | Ga0495651_0112245 | |||
| 465 | Ga0495651_0294409 | |||
| 466 | Ga0495653_0456439 | |||
| 467 | Ga0495653_0519990 | |||
| 468 | Ga0495580_0001715 | |||
| 469 | Ga0495580_0009584 | |||
| 470 | Ga0495580_0144953 | |||
| 471 | Ga0495639_0203098 | |||
| 472 | Ga0495639_0633480 | |||
| 473 | Ga0495662_0324430 | |||
| 474 | Ga0495664_0713750 | |||
| 475 | Ga0495584_0461469 | |||
| 476 | Ga0495594_0250444 | |||
| 477 | Ga0495608_0346171 | |||
| 478 | Ga0495618_0220718 | |||
| 479 | Ga0495618_0604995 | |||
| 480 | Ga0495628_0205213 | |||
| 481 | Ga0495630_0315691 | |||
| 482 | Ga0495642_0294296 | |||
| 483 | Ga0495665_0114366 | |||
| 484 | Ga0495640_0082912 | |||
| 485 | Ga0495640_0174443 | |||
| 486 | Ga0495640_0402860 | |||
| 487 | Ga0495586_0836801 | |||
| 488 | Ga0495645_0009511 | |||
| 489 | Ga0495645_0193393 | |||
| 490 | Ga0495667_0115275 | |||
| 491 | Ga0495667_0127714 | |||
| 492 | Ga0495667_0954362 | |||
| 493 | Ga0495634_0308146 | |||
| 494 | Ga0495635_0566935 | |||
| 495 | Ga0495599_0120157 | |||
| 496 | Ga0495599_0561028 | |||
| 497 | Ga0495599_0764992 | |||
| 498 | Ga0495623_0020895 | |||
| 499 | Ga0495623_0149272 | |||
| 500 | Ga0495623_0310575 | |||
| 501 | Ga0495658_0458545 | |||
| 502 | Ga0495613_0157933 | |||
| 503 | Ga0495613_0569850 | |||
| 504 | Ga0495581_0684847 | |||
| 505 | Ga0495604_0023928 | |||
| 506 | Ga0495604_0190690 | |||
| 507 | Ga0495674_0004940 | |||
| 508 | Ga0495674_0024324 | |||
| 509 | Ga0495674_0103710 | |||
| 510 | Ga0495674_0381656 | |||
| 511 | Ga0495674_0971234 | |||
| 512 | Ga0495675_0093594 | |||
| 513 | Ga0495675_0149721 | |||
| 514 | Ga0495675_0188808 | |||
| 515 | Ga0495675_0235447 | |||
| 516 | Ga0495675_0494186 | |||
| 517 | Ga0495684_0022987 | |||
| 518 | Ga0495684_0044276 | |||
| 519 | Ga0495684_0093641 | |||
| 520 | Ga0495684_0267859 | |||
| 521 | Ga0495684_0570985 | |||
| 522 | Ga0495593_0064580 | |||
| 523 | Ga0495602_0050049 | |||
| 524 | Ga0495602_0336412 | |||
| 525 | Ga0495614_0048707 | |||
| 526 | Ga0496106_1216706 | |||
| 527 | Ga0496109_1110466 | |||
| 528 | Ga0496112_0414192 | |||
| 529 | Ga0496115_0124184 | |||
| 530 | Ga0496115_0148623 | |||
| 531 | Ga0501046_0145111 | |||
| 532 | Ga0501047_0307278 | |||
| 533 | Ga0501048_1146905 | |||
| 534 | nmdc:mga00v17_71685_c1 | |||
| 535 | Ga0495619_0256149 | |||
| 536 | Ga0495619_0657134 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f8b-assembly1.cif.gz_B-2 | crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef | 0.9457 | 18 | 131 |
| 5k0p-assembly1.cif.gz_B | crystal structure of the archaeosine synthase quef-like in the apo form | 0.9457 | 28 | 124 |
| 4fgc-assembly1.cif.gz_A-2 | crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 | 0.9387 | 16 | 127 |
| 5udg-assembly1.cif.gz_A | mutant e97q crystal structure of bacillus subtilis quef with a disulfide cys 55-99 | 0.9372 | 21 | 127 |
| 4ghm-assembly1.cif.gz_B | crystal structure of the h233a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq0 | 0.923 | 27 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G081_22_166_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9697 | 21 | 131 | 3.30.1130.10 |
| af_Q8I5H7_254_381_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8649 | 22 | 134 | 3.30.1130.10 |
| 3rzpD02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.834 | 27 | 134 | 3.30.1130.10 |
| af_A0A1D6DUT0_342_468_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8163 | 32 | 127 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.816 | 21 | 126 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9IRN5-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF | 0.9992 | 12 | 125 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A1Q6YG88-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9987 | 5 | 125 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A523DGH5-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9987 | 16 | 127 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A523ED95-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9946 | 20 | 125 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |
| AF-A0A2G4HYH6-F1-model_v4 | NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) | 0.9941 | 2 | 124 |
GO:0005737
GO:0006400 GO:0008616 GO:0033739 |