F375697

General Info

Members Datasets Scaffolds Average Seq Length
268 153 536 133

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0002877|Ga0453684_0002877_14901_15311
Length 136
Sequence MKNNNVTSFGYSQNQAQSVKRIKLPEIEAWENQYRRDYVIKIVHPEFTSVCPKTGLPDFGTITVEYVPGKLCLELKSLKYYFLQYRNCGIFMENIANRVLDDVVKAIKPKSCTVTGDFTPRGGLSSIITAQYKAKR

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 1.87
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 30.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0002877 3300044712 Bacteria 40377
2 Ga0070683_100178914 3300005329 Bacteria 2013
3 Ga0070683_100184994 3300005329 Bacteria 1978
4 Ga0070690_100295974 3300005330 Bacteria 1159
5 Ga0070690_100458978 3300005330 Bacteria 946
6 Ga0070666_10316485 3300005335 Bacteria 1113
7 Ga0070666_10509012 3300005335 Bacteria 873
8 Ga0070680_100044912 3300005336 Bacteria 3591
9 Ga0070680_100172654 3300005336 Bacteria 1819
10 Ga0070682_101105471 3300005337 Bacteria 664
11 Ga0070687_100899472 3300005343 Bacteria 635
12 Ga0070688_100233960 3300005365 Bacteria 1301
13 Ga0070659_101345571 3300005366 Bacteria 634
14 Ga0070709_11258334 3300005434 Unclassified 596
15 Ga0070709_11330120 3300005434 Unclassified 580
16 Ga0070713_100040341 3300005436 Bacteria 3795
17 Ga0070713_100368726 3300005436 Bacteria 1336
18 Ga0070711_100882953 3300005439 Bacteria 762
19 Ga0070678_100199925 3300005456 Bacteria 1649
20 Ga0070678_101180434 3300005456 Bacteria 709
21 Ga0070681_10027795 3300005458 Bacteria 5687
22 Ga0068867_100508811 3300005459 Bacteria 1036
23 Ga0068867_102140990 3300005459 Unclassified 530
24 Ga0070679_100419808 3300005530 Bacteria 1283
25 Ga0070684_100000004 3300005535 Bacteria 231043
26 Ga0070684_100607386 3300005535 Bacteria 1017
27 Ga0070684_100934006 3300005535 Unclassified 813
28 Ga0070686_100140447 3300005544 Unclassified 1681
29 Ga0070695_100653801 3300005545 Unclassified 830
30 Ga0070665_100127162 3300005548 Unclassified 2551
31 Ga0068855_100126224 3300005563 Bacteria 2925
32 Ga0068855_101675654 3300005563 Bacteria 649
33 Ga0070664_101205682 3300005564 Bacteria 714
34 Ga0070664_101706662 3300005564 Unclassified 597
35 Ga0068856_101298602 3300005614 Bacteria 743
36 Ga0070702_100710848 3300005615 Unclassified 767
37 Ga0068859_100272059 3300005617 Bacteria 1786
38 Ga0068859_100684021 3300005617 Bacteria 1117
39 Ga0068864_100075198 3300005618 Bacteria 2949
40 Ga0068864_100864182 3300005618 Unclassified 892
41 Ga0068864_101527607 3300005618 Bacteria 671
42 Ga0068858_100958230 3300005842 Bacteria 838
43 Ga0070717_10206446 3300006028 Unclassified 1723
44 Ga0070717_10611171 3300006028 Bacteria 989
45 Ga0070717_10965316 3300006028 Unclassified 776
46 Ga0075364_10214868 3300006051 Unclassified 1304
47 Ga0097621_100561563 3300006237 Unclassified 1040
48 Ga0097621_100839185 3300006237 Bacteria 853
49 Ga0068871_101356540 3300006358 Unclassified 670
50 Ga0075428_101642224 3300006844 Bacteria 671
51 Ga0097620_100272037 3300006931 Bacteria 1786
52 Ga0097620_100684209 3300006931 Bacteria 1117
53 Ga0105240_10003450 3300009093 Bacteria 24537
54 Ga0105240_10117912 3300009093 Bacteria 3200
55 Ga0105240_10704416 3300009093 Bacteria 1102
56 Ga0105240_12193143 3300009093 Unclassified 573
57 Ga0111539_12513918 3300009094 Unclassified 597
58 Ga0105243_11123933 3300009148 Bacteria 795
59 Ga0105242_12299312 3300009176 Unclassified 585
60 Ga0105248_10042722 3300009177 Bacteria 5083
61 Ga0105248_10101505 3300009177 Bacteria 3243
62 Ga0105248_10335605 3300009177 Bacteria 1702
63 Ga0105248_10474322 3300009177 Bacteria 1410
64 Ga0105248_10779992 3300009177 Bacteria 1079
65 Ga0105248_11515045 3300009177 Unclassified 759
66 Ga0105248_11649896 3300009177 Bacteria 726
67 Ga0105237_10003745 3300009545 Bacteria 17911
68 Ga0105237_10881429 3300009545 Unclassified 902
69 Ga0105239_10359175 3300010375 Unclassified 1645
70 Ga0105239_12231810 3300010375 Unclassified 637
71 Ga0105246_11472273 3300011119 Unclassified 638
72 Ga0157370_10829245 3300013104 Unclassified 841
73 Ga0157370_11798554 3300013104 Unclassified 550
74 Ga0157369_11192672 3300013105 Bacteria 777
75 Ga0157374_10419735 3300013296 Bacteria 1336
76 Ga0157374_10452038 3300013296 Unclassified 1286
77 Ga0157378_11546428 3300013297 Unclassified 709
78 Ga0163162_10192413 3300013306 Bacteria 2168
79 Ga0163162_11754244 3300013306 Bacteria 709
80 Ga0157372_10687103 3300013307 Bacteria 1191
81 Ga0157372_10695985 3300013307 Unclassified 1183
82 Ga0157372_10819810 3300013307 Bacteria 1081
83 Ga0157375_10524517 3300013308 Bacteria 1347
84 Ga0157375_10934023 3300013308 Bacteria 1010
85 Ga0163163_10041970 3300014325 Bacteria 4477
86 Ga0163163_10382621 3300014325 Bacteria 1465
87 Ga0163163_10481183 3300014325 Bacteria 1302
88 Ga0163163_10622033 3300014325 Bacteria 1143
89 Ga0157380_12156960 3300014326 Unclassified 621
90 Ga0157377_10827741 3300014745 Bacteria 685
91 Ga0157379_10539414 3300014968 Unclassified 1084
92 Ga0157376_10024552 3300014969 Bacteria 4735
93 Ga0157376_10079220 3300014969 Bacteria 2816
94 Ga0157376_10522442 3300014969 Unclassified 1170
95 Ga0157376_10946018 3300014969 Bacteria 882
96 Ga0157376_12650969 3300014969 Unclassified 541
97 Ga0163161_10941330 3300017792 Bacteria 734
98 Ga0213876_10162957 3300021384 Bacteria 1186
99 Ga0213875_10014464 3300021388 Bacteria 3850
100 Ga0213875_10281483 3300021388 Unclassified 785
101 Ga0207692_11220044 3300025898 Unclassified 500
102 Ga0207680_10274864 3300025903 Bacteria 1169
103 Ga0207699_11494519 3300025906 Bacteria 500
104 Ga0207645_10245399 3300025907 Bacteria 1184
105 Ga0207705_10097401 3300025909 Bacteria 2160
106 Ga0207707_10178324 3300025912 Bacteria 1855
107 Ga0207695_10006430 3300025913 Bacteria 15254
108 Ga0207695_10457117 3300025913 Bacteria 1160
109 Ga0207695_11413054 3300025913 Unclassified 576
110 Ga0207671_10007717 3300025914 Bacteria 9279
111 Ga0207671_10571785 3300025914 Unclassified 901
112 Ga0207660_10109222 3300025917 Unclassified 2079
113 Ga0207660_10668420 3300025917 Bacteria 847
114 Ga0207662_10219786 3300025918 Bacteria 1237
115 Ga0207657_11096843 3300025919 Unclassified 608
116 Ga0207652_10332921 3300025921 Bacteria 1371
117 Ga0207646_11189401 3300025922 Bacteria 669
118 Ga0207700_10084568 3300025928 Unclassified 2487
119 Ga0207669_10136539 3300025937 Bacteria 1695
120 Ga0207665_10146921 3300025939 Bacteria 1685
121 Ga0207711_10038538 3300025941 Unclassified 4065
122 Ga0207711_10072466 3300025941 Bacteria 2993
123 Ga0207711_10379409 3300025941 Bacteria 1312
124 Ga0207711_10896272 3300025941 Unclassified 825
125 Ga0207661_10000055 3300025944 Bacteria 86544
126 Ga0207679_11379835 3300025945 Unclassified 647
127 Ga0207667_10478151 3300025949 Bacteria 1265
128 Ga0207667_10681447 3300025949 Bacteria 1031
129 Ga0207651_10724283 3300025960 Bacteria 878
130 Ga0207703_11013931 3300026035 Bacteria 796
131 Ga0207703_11585355 3300026035 Unclassified 630
132 Ga0207703_11693933 3300026035 Unclassified 608
133 Ga0207702_10647341 3300026078 Bacteria 1039
134 Ga0207702_12048950 3300026078 Unclassified 562
135 Ga0207641_10049790 3300026088 Bacteria 3542
136 Ga0207641_10493693 3300026088 Bacteria 1188
137 Ga0207648_10306179 3300026089 Bacteria 1426
138 Ga0207676_10472256 3300026095 Unclassified 1186
139 Ga0207676_11099474 3300026095 Bacteria 786
140 Ga0207675_101131619 3300026118 Bacteria 803
141 Ga0207683_10202348 3300026121 Bacteria 1805
142 Ga0268266_10161322 3300028379 Bacteria 2029
143 Ga0268266_10560276 3300028379 Unclassified 1096
144 Ga0268266_10736913 3300028379 Bacteria 951
145 Ga0268264_11424262 3300028381 Bacteria 703
146 Ga0265323_10000308 3300028653 Bacteria 28119
147 Ga0265332_10016870 3300031238 Bacteria 3220
148 Ga0265328_10215889 3300031239 Unclassified 730
149 Ga0265325_10115245 3300031241 Bacteria 1301
150 Ga0265329_10295965 3300031242 Bacteria 546
151 Ga0265340_10056830 3300031247 Bacteria 1882
152 Ga0265331_10051119 3300031250 Unclassified 1979
153 Ga0265316_10001657 3300031344 Bacteria 23702
154 Ga0265316_10014830 3300031344 Bacteria 6838
155 Ga0265316_10070822 3300031344 Unclassified 2689
156 Ga0265316_10072870 3300031344 Bacteria 2646
157 Ga0265316_10147747 3300031344 Bacteria 1762
158 Ga0265316_10173538 3300031344 Bacteria 1607
159 Ga0265316_10287030 3300031344 Bacteria 1201
160 Ga0265316_10386651 3300031344 Bacteria 1009
161 Ga0265316_10503166 3300031344 Unclassified 865
162 Ga0265316_10759267 3300031344 Bacteria 681
163 Ga0316575_10245729 3300031665 Unclassified 750
164 Ga0316576_10045225 3300031727 Unclassified 3183
165 Ga0316576_10293531 3300031727 Unclassified 1216
166 Ga0316576_11173504 3300031727 Bacteria 543
167 Ga0373953_0073208 3300035117 Unclassified 1416
168 Ga0373954_0066258 3300035118 Unclassified 1710
169 Ga0373955_0457885 3300035172 Bacteria 778
170 Ga0373955_1019782 3300035172 Bacteria 510
171 Ga0373927_0259746 3300035695 Bacteria 1142
172 Ga0373927_0483751 3300035695 Bacteria 818
173 Ga0373927_1089964 3300035695 Bacteria 527
174 Ga0373933_0825278 3300035724 Bacteria 610
175 Ga0373947_0270950 3300035725 Bacteria 1127
176 Ga0373937_0220881 3300036401 Bacteria 1784
177 Ga0373937_0355478 3300036401 Unclassified 1388
178 Ga0373937_1057898 3300036401 Unclassified 760
179 Ga0316582_1013390 3300036647 Unclassified 567
180 Ga0316584_0113534 3300036712 Bacteria 2027
181 Ga0316584_0729114 3300036712 Bacteria 678
182 Ga0373925_0254594 3300037068 Unclassified 1409
183 Ga0373925_1112524 3300037068 Unclassified 650
184 Ga0436364_0579727 3300037853 Bacteria 11000
185 Ga0436364_0722734 3300037853 Bacteria 1094
186 Ga0436364_0971586 3300037853 Unclassified 2722
187 Ga0436365_0666376 3300039437 Bacteria 5232
188 Ga0451577_1153015 3300042876 Bacteria 692
189 Ga0451576_0000405 3300045051 Bacteria 100277
190 Ga0451576_0000911 3300045051 Bacteria 56009
191 Ga0451576_0017174 3300045051 Bacteria 7960
192 Ga0451576_0386154 3300045051 Unclassified 1468
193 Ga0451576_1080951 3300045051 Unclassified 840
194 Ga0495603_0746662 3300046455 Unclassified 559
195 Ga0495629_0255548 3300046459 Bacteria 1205
196 Ga0495651_0112245 3300046462 Bacteria 2014
197 Ga0495651_0294409 3300046462 Bacteria 1091
198 Ga0495653_0456439 3300046463 Unclassified 803
199 Ga0495653_0519990 3300046463 Unclassified 740
200 Ga0495580_0001715 3300046472 Bacteria 19256
201 Ga0495580_0009584 3300046472 Bacteria 7607
202 Ga0495580_0144953 3300046472 Unclassified 1646
203 Ga0495639_0203098 3300046475 Bacteria 971
204 Ga0495639_0633480 3300046475 Unclassified 551
205 Ga0495662_0324430 3300046476 Bacteria 757
206 Ga0495664_0713750 3300046477 Unclassified 592
207 Ga0495584_0461469 3300046491 Bacteria 646
208 Ga0495594_0250444 3300046499 Bacteria 1009
209 Ga0495608_0346171 3300046511 Unclassified 915
210 Ga0495618_0220718 3300046514 Bacteria 1196
211 Ga0495618_0604995 3300046514 Bacteria 652
212 Ga0495628_0205213 3300046516 Unclassified 1484
213 Ga0495630_0315691 3300046517 Unclassified 1195
214 Ga0495642_0294296 3300046528 Bacteria 711
215 Ga0495665_0114366 3300046531 Bacteria 1414
216 Ga0495640_0082912 3300046533 Bacteria 2128
217 Ga0495640_0174443 3300046533 Bacteria 1373
218 Ga0495640_0402860 3300046533 Bacteria 840
219 Ga0495586_0836801 3300046535 Unclassified 531
220 Ga0495645_0009511 3300046543 Bacteria 6795
221 Ga0495645_0193393 3300046543 Bacteria 1385
222 Ga0495667_0115275 3300046559 Bacteria 1736
223 Ga0495667_0127714 3300046559 Bacteria 1640
224 Ga0495667_0954362 3300046559 Unclassified 524
225 Ga0495634_0308146 3300046642 Bacteria 956
226 Ga0495635_0566935 3300046663 Bacteria 743
227 Ga0495599_0120157 3300046678 Bacteria 1634
228 Ga0495599_0561028 3300046678 Unclassified 668
229 Ga0495599_0764992 3300046678 Bacteria 553
230 Ga0495623_0020895 3300046679 Bacteria 4231
231 Ga0495623_0149272 3300046679 Bacteria 1383
232 Ga0495623_0310575 3300046679 Unclassified 869
233 Ga0495658_0458545 3300046683 Bacteria 814
234 Ga0495613_0157933 3300046689 Bacteria 1615
235 Ga0495613_0569850 3300046689 Unclassified 756
236 Ga0495581_0684847 3300047315 Bacteria 592
237 Ga0495604_0023928 3300047317 Bacteria 4876
238 Ga0495604_0190690 3300047317 Bacteria 1428
239 Ga0495674_0004940 3300047319 Bacteria 12823
240 Ga0495674_0024324 3300047319 Bacteria 5566
241 Ga0495674_0103710 3300047319 Bacteria 2417
242 Ga0495674_0381656 3300047319 Bacteria 1140
243 Ga0495674_0971234 3300047319 Bacteria 652
244 Ga0495675_0093594 3300047444 Bacteria 1885
245 Ga0495675_0149721 3300047444 Unclassified 1442
246 Ga0495675_0188808 3300047444 Bacteria 1259
247 Ga0495675_0235447 3300047444 Bacteria 1104
248 Ga0495675_0494186 3300047444 Unclassified 703
249 Ga0495684_0022987 3300047471 Bacteria 4796
250 Ga0495684_0044276 3300047471 Bacteria 3407
251 Ga0495684_0093641 3300047471 Bacteria 2275
252 Ga0495684_0267859 3300047471 Bacteria 1237
253 Ga0495684_0570985 3300047471 Bacteria 767
254 Ga0495593_0064580 3300047673 Bacteria 1911
255 Ga0495602_0050049 3300048088 Bacteria 3737
256 Ga0495602_0336412 3300048088 Bacteria 1093
257 Ga0495614_0048707 3300048089 Bacteria 1817
258 Ga0496106_1216706 3300048909 Bacteria 587
259 Ga0496109_1110466 3300048912 Bacteria 728
260 Ga0496112_0414192 3300048915 Bacteria 1287
261 Ga0496115_0124184 3300048918 Unclassified 2126
262 Ga0496115_0148623 3300048918 Bacteria 1934
263 Ga0501046_0145111 3300049580 Bacteria 1793
264 Ga0501047_0307278 3300049581 Bacteria 1427
265 Ga0501048_1146905 3300049582 Bacteria 559
266 nmdc:mga00v17_71685_c1 3300050491 Unclassified 2148
267 Ga0495619_0256149 3300053085 Bacteria 1213
268 Ga0495619_0657134 3300053085 Bacteria 715
269 Ga0453684_0002877
270 Ga0070683_100178914
271 Ga0070683_100184994
272 Ga0070690_100295974
273 Ga0070690_100458978
274 Ga0070666_10316485
275 Ga0070666_10509012
276 Ga0070680_100044912
277 Ga0070680_100172654
278 Ga0070682_101105471
279 Ga0070687_100899472
280 Ga0070688_100233960
281 Ga0070659_101345571
282 Ga0070709_11258334
283 Ga0070709_11330120
284 Ga0070713_100040341
285 Ga0070713_100368726
286 Ga0070711_100882953
287 Ga0070678_100199925
288 Ga0070678_101180434
289 Ga0070681_10027795
290 Ga0068867_100508811
291 Ga0068867_102140990
292 Ga0070679_100419808
293 Ga0070684_100000004
294 Ga0070684_100607386
295 Ga0070684_100934006
296 Ga0070686_100140447
297 Ga0070695_100653801
298 Ga0070665_100127162
299 Ga0068855_100126224
300 Ga0068855_101675654
301 Ga0070664_101205682
302 Ga0070664_101706662
303 Ga0068856_101298602
304 Ga0070702_100710848
305 Ga0068859_100272059
306 Ga0068859_100684021
307 Ga0068864_100075198
308 Ga0068864_100864182
309 Ga0068864_101527607
310 Ga0068858_100958230
311 Ga0070717_10206446
312 Ga0070717_10611171
313 Ga0070717_10965316
314 Ga0075364_10214868
315 Ga0097621_100561563
316 Ga0097621_100839185
317 Ga0068871_101356540
318 Ga0075428_101642224
319 Ga0097620_100272037
320 Ga0097620_100684209
321 Ga0105240_10003450
322 Ga0105240_10117912
323 Ga0105240_10704416
324 Ga0105240_12193143
325 Ga0111539_12513918
326 Ga0105243_11123933
327 Ga0105242_12299312
328 Ga0105248_10042722
329 Ga0105248_10101505
330 Ga0105248_10335605
331 Ga0105248_10474322
332 Ga0105248_10779992
333 Ga0105248_11515045
334 Ga0105248_11649896
335 Ga0105237_10003745
336 Ga0105237_10881429
337 Ga0105239_10359175
338 Ga0105239_12231810
339 Ga0105246_11472273
340 Ga0157370_10829245
341 Ga0157370_11798554
342 Ga0157369_11192672
343 Ga0157374_10419735
344 Ga0157374_10452038
345 Ga0157378_11546428
346 Ga0163162_10192413
347 Ga0163162_11754244
348 Ga0157372_10687103
349 Ga0157372_10695985
350 Ga0157372_10819810
351 Ga0157375_10524517
352 Ga0157375_10934023
353 Ga0163163_10041970
354 Ga0163163_10382621
355 Ga0163163_10481183
356 Ga0163163_10622033
357 Ga0157380_12156960
358 Ga0157377_10827741
359 Ga0157379_10539414
360 Ga0157376_10024552
361 Ga0157376_10079220
362 Ga0157376_10522442
363 Ga0157376_10946018
364 Ga0157376_12650969
365 Ga0163161_10941330
366 Ga0213876_10162957
367 Ga0213875_10014464
368 Ga0213875_10281483
369 Ga0207692_11220044
370 Ga0207680_10274864
371 Ga0207699_11494519
372 Ga0207645_10245399
373 Ga0207705_10097401
374 Ga0207707_10178324
375 Ga0207695_10006430
376 Ga0207695_10457117
377 Ga0207695_11413054
378 Ga0207671_10007717
379 Ga0207671_10571785
380 Ga0207660_10109222
381 Ga0207660_10668420
382 Ga0207662_10219786
383 Ga0207657_11096843
384 Ga0207652_10332921
385 Ga0207646_11189401
386 Ga0207700_10084568
387 Ga0207669_10136539
388 Ga0207665_10146921
389 Ga0207711_10038538
390 Ga0207711_10072466
391 Ga0207711_10379409
392 Ga0207711_10896272
393 Ga0207661_10000055
394 Ga0207679_11379835
395 Ga0207667_10478151
396 Ga0207667_10681447
397 Ga0207651_10724283
398 Ga0207703_11013931
399 Ga0207703_11585355
400 Ga0207703_11693933
401 Ga0207702_10647341
402 Ga0207702_12048950
403 Ga0207641_10049790
404 Ga0207641_10493693
405 Ga0207648_10306179
406 Ga0207676_10472256
407 Ga0207676_11099474
408 Ga0207675_101131619
409 Ga0207683_10202348
410 Ga0268266_10161322
411 Ga0268266_10560276
412 Ga0268266_10736913
413 Ga0268264_11424262
414 Ga0265323_10000308
415 Ga0265332_10016870
416 Ga0265328_10215889
417 Ga0265325_10115245
418 Ga0265329_10295965
419 Ga0265340_10056830
420 Ga0265331_10051119
421 Ga0265316_10001657
422 Ga0265316_10014830
423 Ga0265316_10070822
424 Ga0265316_10072870
425 Ga0265316_10147747
426 Ga0265316_10173538
427 Ga0265316_10287030
428 Ga0265316_10386651
429 Ga0265316_10503166
430 Ga0265316_10759267
431 Ga0316575_10245729
432 Ga0316576_10045225
433 Ga0316576_10293531
434 Ga0316576_11173504
435 Ga0373953_0073208
436 Ga0373954_0066258
437 Ga0373955_0457885
438 Ga0373955_1019782
439 Ga0373927_0259746
440 Ga0373927_0483751
441 Ga0373927_1089964
442 Ga0373933_0825278
443 Ga0373947_0270950
444 Ga0373937_0220881
445 Ga0373937_0355478
446 Ga0373937_1057898
447 Ga0316582_1013390
448 Ga0316584_0113534
449 Ga0316584_0729114
450 Ga0373925_0254594
451 Ga0373925_1112524
452 Ga0436364_0579727
453 Ga0436364_0722734
454 Ga0436364_0971586
455 Ga0436365_0666376
456 Ga0451577_1153015
457 Ga0451576_0000405
458 Ga0451576_0000911
459 Ga0451576_0017174
460 Ga0451576_0386154
461 Ga0451576_1080951
462 Ga0495603_0746662
463 Ga0495629_0255548
464 Ga0495651_0112245
465 Ga0495651_0294409
466 Ga0495653_0456439
467 Ga0495653_0519990
468 Ga0495580_0001715
469 Ga0495580_0009584
470 Ga0495580_0144953
471 Ga0495639_0203098
472 Ga0495639_0633480
473 Ga0495662_0324430
474 Ga0495664_0713750
475 Ga0495584_0461469
476 Ga0495594_0250444
477 Ga0495608_0346171
478 Ga0495618_0220718
479 Ga0495618_0604995
480 Ga0495628_0205213
481 Ga0495630_0315691
482 Ga0495642_0294296
483 Ga0495665_0114366
484 Ga0495640_0082912
485 Ga0495640_0174443
486 Ga0495640_0402860
487 Ga0495586_0836801
488 Ga0495645_0009511
489 Ga0495645_0193393
490 Ga0495667_0115275
491 Ga0495667_0127714
492 Ga0495667_0954362
493 Ga0495634_0308146
494 Ga0495635_0566935
495 Ga0495599_0120157
496 Ga0495599_0561028
497 Ga0495599_0764992
498 Ga0495623_0020895
499 Ga0495623_0149272
500 Ga0495623_0310575
501 Ga0495658_0458545
502 Ga0495613_0157933
503 Ga0495613_0569850
504 Ga0495581_0684847
505 Ga0495604_0023928
506 Ga0495604_0190690
507 Ga0495674_0004940
508 Ga0495674_0024324
509 Ga0495674_0103710
510 Ga0495674_0381656
511 Ga0495674_0971234
512 Ga0495675_0093594
513 Ga0495675_0149721
514 Ga0495675_0188808
515 Ga0495675_0235447
516 Ga0495675_0494186
517 Ga0495684_0022987
518 Ga0495684_0044276
519 Ga0495684_0093641
520 Ga0495684_0267859
521 Ga0495684_0570985
522 Ga0495593_0064580
523 Ga0495602_0050049
524 Ga0495602_0336412
525 Ga0495614_0048707
526 Ga0496106_1216706
527 Ga0496109_1110466
528 Ga0496112_0414192
529 Ga0496115_0124184
530 Ga0496115_0148623
531 Ga0501046_0145111
532 Ga0501047_0307278
533 Ga0501048_1146905
534 nmdc:mga00v17_71685_c1
535 Ga0495619_0256149
536 Ga0495619_0657134

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

57

136

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.9457 18 131
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.9457 28 124
4fgc-assembly1.cif.gz_A-2 crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 0.9387 16 127
5udg-assembly1.cif.gz_A mutant e97q crystal structure of bacillus subtilis quef with a disulfide cys 55-99 0.9372 21 127
4ghm-assembly1.cif.gz_B crystal structure of the h233a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq0 0.923 27 124
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9697 21 131 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8649 22 134 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.834 27 134 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8163 32 127 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.816 21 126 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A1W9IRN5-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF 0.9992 12 125 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A1Q6YG88-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9987 5 125 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A523DGH5-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9987 16 127 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A523ED95-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9946 20 125 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A2G4HYH6-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9941 2 124 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Map