F375482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 268 | 147 | 266 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10080497|Ga0105242_100804972 |
| Length | 449 |
| Sequence | LWSLSFRERSWAPSKAAPIFFFGVVPGSRYLELPAPDLYLPRMSNLPPGPFTRLSTLLGDSKPGKEPISLAVGDPAGAVPEFVKDALARGAAGFGNYPAIIGTEDWRQAAAEWLNRRFALNGAIDAEKNLLPLNGTREGLFSVLFPLMPESKAGQQPIVAMPNPFYQCYAAAALGSGAEPLYVAARKENGFLPDFAQLPEETLQRLAAVYICSPSNPEGAVADEAYWTRLFQLAERHDFMVLADECYADIWFDQEPVSALTSRLAQCFDRLLSFHSLSKRSGLPGLRSGLVAGDAARIEKFRAFRNVAGPTVPTPLLTASAACWRDEDHVIANRAAYQEKMEAAGRILGNRMTRPAGGFFLWLDVGNGEEFALRAWREQGVRLLPGAYMGRDVFDGRAGGASLTAQVAGRSGHEEKTQSNPGFSYVRVALVNDLSTIMTALERLREILD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 2 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 115 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 116 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 139 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 140 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 141 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 142 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 143 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 144 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 145 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0 |
| Isolates | 0.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.6 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 91.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 2 | JGI25153J46596_10000957 | 3300003215 | Bacteria | 17515 |
| 3 | rootL2_10067691 | 3300003322 | Bacteria | 1303 |
| 4 | Ga0070658_10011616 | 3300005327 | Bacteria | 7064 |
| 5 | Ga0070676_10076137 | 3300005328 | Bacteria | 2025 |
| 6 | Ga0070683_100091252 | 3300005329 | Bacteria | 2860 |
| 7 | Ga0070690_100038614 | 3300005330 | Bacteria | 3014 |
| 8 | Ga0070670_100147638 | 3300005331 | Bacteria | 2035 |
| 9 | Ga0068869_100005153 | 3300005334 | Bacteria | 8200 |
| 10 | Ga0068869_100026242 | 3300005334 | Bacteria | 4053 |
| 11 | Ga0070666_10001060 | 3300005335 | Bacteria | 16802 |
| 12 | Ga0068868_100028733 | 3300005338 | Bacteria | 4254 |
| 13 | Ga0070660_100046343 | 3300005339 | Bacteria | 3333 |
| 14 | Ga0070689_100079078 | 3300005340 | Bacteria | 2579 |
| 15 | Ga0070691_10000388 | 3300005341 | Bacteria | 15959 |
| 16 | Ga0070673_100016715 | 3300005364 | Bacteria | 5197 |
| 17 | Ga0070713_100143522 | 3300005436 | Bacteria | 2117 |
| 18 | Ga0070678_100003273 | 3300005456 | Bacteria | 9005 |
| 19 | Ga0070678_100016823 | 3300005456 | Bacteria | 4688 |
| 20 | Ga0070681_10063300 | 3300005458 | Unclassified | 3671 |
| 21 | Ga0070681_10109263 | 3300005458 | Bacteria | 2706 |
| 22 | Ga0070681_10140440 | 3300005458 | Bacteria | 2346 |
| 23 | Ga0070681_10375044 | 3300005458 | Bacteria | 1333 |
| 24 | Ga0068867_100010161 | 3300005459 | Bacteria | 6639 |
| 25 | Ga0070679_100007658 | 3300005530 | Bacteria | 10111 |
| 26 | Ga0070679_100101113 | 3300005530 | Bacteria | 2869 |
| 27 | Ga0070679_100126703 | 3300005530 | Bacteria | 2536 |
| 28 | Ga0068853_100150948 | 3300005539 | Bacteria | 2092 |
| 29 | Ga0068853_100249014 | 3300005539 | Bacteria | 1630 |
| 30 | Ga0070672_100056467 | 3300005543 | Bacteria | 3079 |
| 31 | Ga0070672_100065798 | 3300005543 | Bacteria | 2868 |
| 32 | Ga0070665_100001512 | 3300005548 | Bacteria | 26999 |
| 33 | Ga0070665_100125095 | 3300005548 | Bacteria | 2573 |
| 34 | Ga0070665_100149302 | 3300005548 | Bacteria | 2340 |
| 35 | Ga0070665_100390480 | 3300005548 | Unclassified | 1399 |
| 36 | Ga0068855_100009570 | 3300005563 | Bacteria | 11695 |
| 37 | Ga0068855_100024986 | 3300005563 | Bacteria | 7151 |
| 38 | Ga0068855_100045981 | 3300005563 | Bacteria | 5161 |
| 39 | Ga0068855_100108432 | 3300005563 | Bacteria | 3189 |
| 40 | Ga0068855_100151150 | 3300005563 | Bacteria | 2640 |
| 41 | Ga0070664_100060767 | 3300005564 | Bacteria | 3219 |
| 42 | Ga0068857_100204749 | 3300005577 | Bacteria | 1799 |
| 43 | Ga0068856_100160887 | 3300005614 | Bacteria | 2255 |
| 44 | Ga0070702_100084614 | 3300005615 | Bacteria | 1908 |
| 45 | Ga0068852_100272271 | 3300005616 | Unclassified | 1630 |
| 46 | Ga0068866_10018582 | 3300005718 | Bacteria | 3147 |
| 47 | Ga0068863_100429799 | 3300005841 | Bacteria | 1294 |
| 48 | Ga0068858_100045141 | 3300005842 | Bacteria | 4083 |
| 49 | Ga0068858_100059780 | 3300005842 | Bacteria | 3522 |
| 50 | Ga0068862_100038693 | 3300005844 | Bacteria | 4047 |
| 51 | Ga0070712_100006651 | 3300006175 | Bacteria | 7188 |
| 52 | Ga0097621_100030576 | 3300006237 | Bacteria | 4264 |
| 53 | Ga0097621_100100888 | 3300006237 | Bacteria | 2428 |
| 54 | Ga0097621_100301194 | 3300006237 | Bacteria | 1416 |
| 55 | Ga0068871_100002417 | 3300006358 | Bacteria | 12749 |
| 56 | Ga0068871_100038858 | 3300006358 | Bacteria | 3804 |
| 57 | Ga0068871_100092527 | 3300006358 | Bacteria | 2522 |
| 58 | Ga0075431_100118107 | 3300006847 | Bacteria | 2736 |
| 59 | Ga0068865_100090367 | 3300006881 | Bacteria | 2220 |
| 60 | Ga0075435_100008892 | 3300007076 | Bacteria | 7236 |
| 61 | Ga0105240_10008925 | 3300009093 | Bacteria | 14253 |
| 62 | Ga0105240_10009611 | 3300009093 | Bacteria | 13679 |
| 63 | Ga0105240_10017096 | 3300009093 | Bacteria | 9794 |
| 64 | Ga0105240_10099389 | 3300009093 | Bacteria | 3541 |
| 65 | Ga0105240_10141556 | 3300009093 | Bacteria | 2875 |
| 66 | Ga0105240_10272229 | 3300009093 | Bacteria | 1949 |
| 67 | Ga0105240_10279211 | 3300009093 | Bacteria | 1920 |
| 68 | Ga0105245_10004593 | 3300009098 | Bacteria | 12191 |
| 69 | Ga0105243_10008996 | 3300009148 | Bacteria | 7633 |
| 70 | Ga0105243_10197864 | 3300009148 | Unclassified | 1760 |
| 71 | Ga0105242_10052164 | 3300009176 | Bacteria | 3336 |
| 72 | Ga0105242_10080497 | 3300009176 | Bacteria | 2722 |
| 73 | Ga0105248_10009177 | 3300009177 | Bacteria | 10879 |
| 74 | Ga0105237_10111969 | 3300009545 | Bacteria | 2721 |
| 75 | Ga0105237_10130833 | 3300009545 | Unclassified | 2504 |
| 76 | Ga0105237_10178420 | 3300009545 | Bacteria | 2124 |
| 77 | Ga0105237_10367495 | 3300009545 | Bacteria | 1443 |
| 78 | Ga0105238_10016469 | 3300009551 | Bacteria | 7483 |
| 79 | Ga0105238_10018175 | 3300009551 | Bacteria | 7149 |
| 80 | Ga0105238_10022027 | 3300009551 | Bacteria | 6494 |
| 81 | Ga0105238_10055171 | 3300009551 | Bacteria | 3990 |
| 82 | Ga0105238_10073984 | 3300009551 | Bacteria | 3401 |
| 83 | Ga0105238_10075451 | 3300009551 | Bacteria | 3364 |
| 84 | Ga0105238_10256795 | 3300009551 | Bacteria | 1727 |
| 85 | Ga0105249_10053821 | 3300009553 | Bacteria | 3679 |
| 86 | Ga0105239_10055460 | 3300010375 | Bacteria | 4346 |
| 87 | Ga0105239_10117322 | 3300010375 | Bacteria | 2954 |
| 88 | Ga0105239_10149534 | 3300010375 | Unclassified | 2606 |
| 89 | Ga0105246_10007849 | 3300011119 | Bacteria | 6547 |
| 90 | Ga0105246_10033953 | 3300011119 | Bacteria | 3394 |
| 91 | Ga0157370_10035437 | 3300013104 | Bacteria | 4850 |
| 92 | Ga0157370_10048461 | 3300013104 | Bacteria | 4070 |
| 93 | Ga0157369_10250220 | 3300013105 | Bacteria | 1849 |
| 94 | Ga0157374_10408836 | 3300013296 | Bacteria | 1355 |
| 95 | Ga0157378_10044877 | 3300013297 | Bacteria | 3926 |
| 96 | Ga0157378_10235217 | 3300013297 | Bacteria | 1748 |
| 97 | Ga0163162_10085194 | 3300013306 | Bacteria | 3237 |
| 98 | Ga0163162_10102402 | 3300013306 | Bacteria | 2957 |
| 99 | Ga0157372_10080080 | 3300013307 | Bacteria | 3695 |
| 100 | Ga0157375_10042186 | 3300013308 | Bacteria | 4414 |
| 101 | Ga0163163_10000012 | 3300014325 | Bacteria | 257369 |
| 102 | Ga0157379_10026632 | 3300014968 | Bacteria | 5147 |
| 103 | Ga0157379_10077109 | 3300014968 | Bacteria | 2984 |
| 104 | Ga0163161_10015244 | 3300017792 | Bacteria | 5356 |
| 105 | Ga0209148_1000724 | 3300025254 | Bacteria | 25957 |
| 106 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 107 | Ga0209233_1007043 | 3300025261 | Bacteria | 3589 |
| 108 | Ga0209455_1000587 | 3300025272 | Bacteria | 23626 |
| 109 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 110 | Ga0207680_10038575 | 3300025903 | Bacteria | 2766 |
| 111 | Ga0207705_10012127 | 3300025909 | Bacteria | 6230 |
| 112 | Ga0207705_10028426 | 3300025909 | Bacteria | 3986 |
| 113 | Ga0207707_10059238 | 3300025912 | Bacteria | 3332 |
| 114 | Ga0207707_10153433 | 3300025912 | Unclassified | 2013 |
| 115 | Ga0207695_10006044 | 3300025913 | Bacteria | 15800 |
| 116 | Ga0207695_10010064 | 3300025913 | Bacteria | 11612 |
| 117 | Ga0207695_10058944 | 3300025913 | Bacteria | 3984 |
| 118 | Ga0207695_10106974 | 3300025913 | Bacteria | 2783 |
| 119 | Ga0207695_10132414 | 3300025913 | Bacteria | 2450 |
| 120 | Ga0207695_10233049 | 3300025913 | Unclassified | 1745 |
| 121 | Ga0207671_10047583 | 3300025914 | Bacteria | 3174 |
| 122 | Ga0207671_10155294 | 3300025914 | Bacteria | 1770 |
| 123 | Ga0207657_10018331 | 3300025919 | Bacteria | 6686 |
| 124 | Ga0207657_10089078 | 3300025919 | Bacteria | 2578 |
| 125 | Ga0207649_10058553 | 3300025920 | Bacteria | 2413 |
| 126 | Ga0207652_10036556 | 3300025921 | Bacteria | 4151 |
| 127 | Ga0207652_10182735 | 3300025921 | Bacteria | 1885 |
| 128 | Ga0207694_10025971 | 3300025924 | Bacteria | 4453 |
| 129 | Ga0207694_10049990 | 3300025924 | Bacteria | 3237 |
| 130 | Ga0207694_10055134 | 3300025924 | Bacteria | 3086 |
| 131 | Ga0207694_10112955 | 3300025924 | Bacteria | 2162 |
| 132 | Ga0207650_10135003 | 3300025925 | Unclassified | 1934 |
| 133 | Ga0207687_10021879 | 3300025927 | Bacteria | 4250 |
| 134 | Ga0207687_10084852 | 3300025927 | Bacteria | 2296 |
| 135 | Ga0207700_10145469 | 3300025928 | Bacteria | 1953 |
| 136 | Ga0207690_10010848 | 3300025932 | Bacteria | 5429 |
| 137 | Ga0207686_10016921 | 3300025934 | Bacteria | 4098 |
| 138 | Ga0207704_10010537 | 3300025938 | Bacteria | 4515 |
| 139 | Ga0207691_10131367 | 3300025940 | Bacteria | 2212 |
| 140 | Ga0207711_10104638 | 3300025941 | Bacteria | 2508 |
| 141 | Ga0207689_10020216 | 3300025942 | Bacteria | 5607 |
| 142 | Ga0207689_10034946 | 3300025942 | Bacteria | 4175 |
| 143 | Ga0207667_10015902 | 3300025949 | Bacteria | 8521 |
| 144 | Ga0207667_10148780 | 3300025949 | Bacteria | 2410 |
| 145 | Ga0207712_10028174 | 3300025961 | Bacteria | 3755 |
| 146 | Ga0207658_10084392 | 3300025986 | Bacteria | 2444 |
| 147 | Ga0207703_10082905 | 3300026035 | Bacteria | 2678 |
| 148 | Ga0207639_10107008 | 3300026041 | Bacteria | 2271 |
| 149 | Ga0207639_10169386 | 3300026041 | Unclassified | 1848 |
| 150 | Ga0207702_10315457 | 3300026078 | Unclassified | 1487 |
| 151 | Ga0207641_10030768 | 3300026088 | Bacteria | 4447 |
| 152 | Ga0207648_10012097 | 3300026089 | Bacteria | 8093 |
| 153 | Ga0207648_10034240 | 3300026089 | Bacteria | 4478 |
| 154 | Ga0207674_10054845 | 3300026116 | Bacteria | 4056 |
| 155 | Ga0207674_10139520 | 3300026116 | Bacteria | 2384 |
| 156 | Ga0207683_10004326 | 3300026121 | Bacteria | 12265 |
| 157 | Ga0207698_10123094 | 3300026142 | Unclassified | 2199 |
| 158 | Ga0268266_10000510 | 3300028379 | Bacteria | 54868 |
| 159 | Ga0268266_10011409 | 3300028379 | Bacteria | 7726 |
| 160 | Ga0268266_10097658 | 3300028379 | Bacteria | 2583 |
| 161 | Ga0268266_10203284 | 3300028379 | Bacteria | 1814 |
| 162 | Ga0268266_10237877 | 3300028379 | Bacteria | 1679 |
| 163 | Ga0265318_10001617 | 3300028577 | Bacteria | 13029 |
| 164 | Ga0265338_10000649 | 3300028800 | Bacteria | 60084 |
| 165 | Ga0265338_10037970 | 3300028800 | Bacteria | 4572 |
| 166 | Ga0265338_10141601 | 3300028800 | Bacteria | 1883 |
| 167 | Ga0265332_10015240 | 3300031238 | Bacteria | 3393 |
| 168 | Ga0265332_10018566 | 3300031238 | Bacteria | 3068 |
| 169 | Ga0265320_10000114 | 3300031240 | Bacteria | 69880 |
| 170 | Ga0265320_10020307 | 3300031240 | Bacteria | 3604 |
| 171 | Ga0265325_10002146 | 3300031241 | Bacteria | 13452 |
| 172 | Ga0265325_10007064 | 3300031241 | Bacteria | 6762 |
| 173 | Ga0265340_10045343 | 3300031247 | Bacteria | 2148 |
| 174 | Ga0265339_10006221 | 3300031249 | Bacteria | 7859 |
| 175 | Ga0265339_10013333 | 3300031249 | Bacteria | 4984 |
| 176 | Ga0265339_10039862 | 3300031249 | Bacteria | 2613 |
| 177 | Ga0265339_10055979 | 3300031249 | Bacteria | 2137 |
| 178 | Ga0265331_10030491 | 3300031250 | Bacteria | 2685 |
| 179 | Ga0265331_10040204 | 3300031250 | Bacteria | 2276 |
| 180 | Ga0265331_10074810 | 3300031250 | Bacteria | 1580 |
| 181 | Ga0265316_10036393 | 3300031344 | Bacteria | 3981 |
| 182 | Ga0265313_10006868 | 3300031595 | Bacteria | 7929 |
| 183 | Ga0265314_10013126 | 3300031711 | Bacteria | 6711 |
| 184 | Ga0265314_10021144 | 3300031711 | Bacteria | 5011 |
| 185 | Ga0265314_10043519 | 3300031711 | Bacteria | 3191 |
| 186 | Ga0265314_10047892 | 3300031711 | Bacteria | 3004 |
| 187 | Ga0265314_10093887 | 3300031711 | Bacteria | 1946 |
| 188 | Ga0373933_0046909 | 3300035724 | Bacteria | 2567 |
| 189 | Ga0373937_0012546 | 3300036401 | Bacteria | 7455 |
| 190 | Ga0395900_0055834 | 3300037418 | Bacteria | 4066 |
| 191 | Ga0400483_032440 | 3300039062 | Bacteria | 2616 |
| 192 | Ga0400483_151609 | 3300039062 | Bacteria | 1455 |
| 193 | Ga0436365_0727357 | 3300039437 | Bacteria | 3049 |
| 194 | Ga0436363_1452481 | 3300039450 | Bacteria | 1592 |
| 195 | Ga0495606_0045577 | 3300046507 | Bacteria | 2905 |
| 196 | Ga0496121_0005060 | 3300048924 | Bacteria | 17222 |
| 197 | Ga0496126_0001076 | 3300048929 | Bacteria | 45962 |
| 198 | Ga0501031_0001308 | 3300049568 | Bacteria | 15277 |
| 199 | Ga0501032_0004758 | 3300049569 | Bacteria | 10175 |
| 200 | Ga0501033_0005736 | 3300049570 | Bacteria | 9786 |
| 201 | Ga0501033_0007975 | 3300049570 | Bacteria | 8202 |
| 202 | Ga0501033_0014011 | 3300049570 | Bacteria | 6099 |
| 203 | Ga0501033_0028115 | 3300049570 | Bacteria | 4227 |
| 204 | Ga0501033_0042935 | 3300049570 | Bacteria | 3369 |
| 205 | Ga0501033_0046005 | 3300049570 | Bacteria | 3245 |
| 206 | Ga0501033_0046142 | 3300049570 | Bacteria | 3240 |
| 207 | Ga0501034_0001944 | 3300049571 | Bacteria | 26175 |
| 208 | Ga0501034_0236377 | 3300049571 | Bacteria | 1775 |
| 209 | Ga0501034_0310724 | 3300049571 | Bacteria | 1511 |
| 210 | Ga0501036_0000558 | 3300049572 | Bacteria | 26755 |
| 211 | Ga0501036_0047797 | 3300049572 | Bacteria | 3623 |
| 212 | Ga0501038_0077690 | 3300049574 | Bacteria | 2802 |
| 213 | Ga0501038_0112420 | 3300049574 | Bacteria | 2255 |
| 214 | Ga0501038_0202645 | 3300049574 | Bacteria | 1592 |
| 215 | Ga0501039_0001271 | 3300049575 | Bacteria | 18461 |
| 216 | Ga0501042_0022207 | 3300049578 | Bacteria | 4432 |
| 217 | Ga0501043_0006529 | 3300049579 | Bacteria | 9357 |
| 218 | Ga0501043_0028908 | 3300049579 | Bacteria | 4351 |
| 219 | Ga0501046_0000928 | 3300049580 | Bacteria | 28785 |
| 220 | Ga0501046_0015086 | 3300049580 | Bacteria | 6497 |
| 221 | Ga0501046_0019651 | 3300049580 | Bacteria | 5599 |
| 222 | Ga0501046_0020223 | 3300049580 | Bacteria | 5510 |
| 223 | Ga0501047_0002500 | 3300049581 | Bacteria | 17526 |
| 224 | Ga0501047_0005391 | 3300049581 | Bacteria | 12022 |
| 225 | Ga0501047_0010277 | 3300049581 | Bacteria | 8854 |
| 226 | Ga0501047_0042782 | 3300049581 | Bacteria | 4376 |
| 227 | Ga0501047_0051800 | 3300049581 | Bacteria | 3967 |
| 228 | Ga0501047_0061317 | 3300049581 | Bacteria | 3629 |
| 229 | Ga0501047_0111658 | 3300049581 | Bacteria | 2616 |
| 230 | Ga0501047_0136997 | 3300049581 | Bacteria | 2328 |
| 231 | Ga0501047_0238862 | 3300049581 | Bacteria | 1668 |
| 232 | Ga0501047_0265802 | 3300049581 | Bacteria | 1562 |
| 233 | Ga0501067_0002123 | 3300049583 | Bacteria | 10908 |
| 234 | Ga0501070_0043344 | 3300049586 | Bacteria | 3745 |
| 235 | Ga0501072_0105790 | 3300049588 | Bacteria | 2238 |
| 236 | Ga0501073_0093551 | 3300049589 | Bacteria | 2088 |
| 237 | Ga0501073_0144417 | 3300049589 | Unclassified | 1649 |
| 238 | Ga0501074_0001271 | 3300049590 | Bacteria | 16679 |
| 239 | Ga0501079_0001529 | 3300049741 | Bacteria | 16356 |
| 240 | Ga0501080_0017179 | 3300049742 | Bacteria | 6684 |
| 241 | Ga0501080_0219102 | 3300049742 | Bacteria | 1742 |
| 242 | Ga0501035_0033218 | 3300049822 | Bacteria | 4692 |
| 243 | Ga0501035_0058796 | 3300049822 | Bacteria | 3424 |
| 244 | Ga0501035_0072869 | 3300049822 | Bacteria | 3039 |
| 245 | Ga0501035_0209058 | 3300049822 | Unclassified | 1670 |
| 246 | Ga0501035_0244255 | 3300049822 | Unclassified | 1526 |
| 247 | Ga0501044_0002060 | 3300049823 | Bacteria | 23168 |
| 248 | Ga0501044_0004079 | 3300049823 | Bacteria | 16380 |
| 249 | Ga0501044_0036110 | 3300049823 | Bacteria | 5171 |
| 250 | Ga0501044_0103967 | 3300049823 | Bacteria | 2854 |
| 251 | Ga0501044_0146498 | 3300049823 | Bacteria | 2346 |
| 252 | Ga0501044_0467138 | 3300049823 | Bacteria | 1166 |
| 253 | Ga0501045_0044942 | 3300049824 | Bacteria | 3217 |
| 254 | nmdc:mga0rr50_7847_c1 | 3300050513 | Bacteria | 6616 |
| 255 | Ga0500635_0021353 | 3300053080 | Bacteria | 1994 |
| 256 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 257 | Ga0500595_011665 | 3300053119 | Bacteria | 3428 |
| 258 | Ga0500595_041721 | 3300053119 | Unclassified | 1473 |
| 259 | Ga0500559_0026730 | 3300053136 | Bacteria | 2460 |
| 260 | Ga0500568_0047281 | 3300053139 | Bacteria | 1705 |
| 261 | Ga0500573_0000032 | 3300053140 | Bacteria | 131098 |
| 262 | Ga0500577_0067502 | 3300053142 | Unclassified | 1394 |
| 263 | Ga0501084_0001251 | 3300054114 | Bacteria | 19995 |
| 264 | Ga0501082_0009708 | 3300060353 | Bacteria | 8287 |
| 265 | Ga0501082_0079710 | 3300060353 | Bacteria | 2825 |
| 266 | Ga0530510_0020701 | 3300061734 | Bacteria | 4678 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0467138 | Ga0501044_0467138_31_1152 | 354 |
| 2 | 3300028379 | Ga0268266_10237877 | Ga0268266_102378772 | 355 |
| 3 | 3300005577 | Ga0068857_100204749 | Ga0068857_1002047492 | 360 |
| 4 | 3300031711 | Ga0265314_10093887 | Ga0265314_100938871 | 368 |
| 5 | 3300049581 | Ga0501047_0136997 | Ga0501047_0136997_68_1183 | 371 |
| 6 | 3300006237 | Ga0097621_100030576 | Ga0097621_1000305763 | 373 |
| 7 | 3300006358 | Ga0068871_100002417 | Ga0068871_10000241712 | 373 |
| 8 | 3300025928 | Ga0207700_10145469 | Ga0207700_101454692 | 374 |
| 9 | 3300039450 | Ga0436363_1452481 | Ga0436363_1452481_397_1578 | 374 |
| 10 | 3300028800 | Ga0265338_10037970 | Ga0265338_100379701 | 377 |
| 11 | 3300011119 | Ga0105246_10033953 | Ga0105246_100339533 | 378 |
| 12 | 3300037418 | Ga0395900_0055834 | Ga0395900_0055834_150_1286 | 378 |
| 13 | 3300049589 | Ga0501073_0144417 | Ga0501073_0144417_424_1560 | 378 |
| 14 | 3300005436 | Ga0070713_100143522 | Ga0070713_1001435222 | 382 |
| 15 | iso_pu_bacteria | 2854681122 | 2854681196 | 383 |
| 16 | iso_pu_bacteria | 3000017691 | 3000020630 | 383 |
| 17 | 3300039062 | Ga0400483_032440 | Ga0400483_032440_846_2033 | 385 |
| 18 | 3300039062 | Ga0400483_151609 | Ga0400483_151609_224_1411 | 385 |
| 19 | 3300009148 | Ga0105243_10197864 | Ga0105243_101978641 | 386 |
| 20 | 3300026035 | Ga0207703_10082905 | Ga0207703_100829053 | 386 |
| 21 | 3300005530 | Ga0070679_100101113 | Ga0070679_1001011132 | 387 |
| 22 | 3300009551 | Ga0105238_10018175 | Ga0105238_100181752 | 387 |
| 23 | 3300013296 | Ga0157374_10408836 | Ga0157374_104088361 | 387 |
| 24 | 3300025903 | Ga0207680_10038575 | Ga0207680_100385752 | 387 |
| 25 | 3300053080 | Ga0500635_0021353 | Ga0500635_0021353_189_1352 | 387 |
| 26 | 3300005334 | Ga0068869_100026242 | Ga0068869_1000262423 | 389 |
| 27 | 3300005340 | Ga0070689_100079078 | Ga0070689_1000790783 | 389 |
| 28 | 3300005364 | Ga0070673_100016715 | Ga0070673_1000167153 | 389 |
| 29 | 3300005543 | Ga0070672_100056467 | Ga0070672_1000564672 | 389 |
| 30 | 3300009148 | Ga0105243_10008996 | Ga0105243_100089961 | 389 |
| 31 | 3300009177 | Ga0105248_10009177 | Ga0105248_100091779 | 389 |
| 32 | 3300009551 | Ga0105238_10256795 | Ga0105238_102567952 | 389 |
| 33 | 3300009553 | Ga0105249_10053821 | Ga0105249_100538212 | 389 |
| 34 | 3300010375 | Ga0105239_10117322 | Ga0105239_101173222 | 389 |
| 35 | 3300013297 | Ga0157378_10044877 | Ga0157378_100448771 | 389 |
| 36 | 3300013297 | Ga0157378_10235217 | Ga0157378_102352172 | 389 |
| 37 | 3300013306 | Ga0163162_10085194 | Ga0163162_100851942 | 389 |
| 38 | 3300013307 | Ga0157372_10080080 | Ga0157372_100800802 | 389 |
| 39 | 3300014968 | Ga0157379_10026632 | Ga0157379_100266324 | 389 |
| 40 | 3300014968 | Ga0157379_10077109 | Ga0157379_100771092 | 389 |
| 41 | 3300025942 | Ga0207689_10034946 | Ga0207689_100349462 | 389 |
| 42 | 3300026089 | Ga0207648_10012097 | Ga0207648_100120972 | 389 |
| 43 | 3300031249 | Ga0265339_10013333 | Ga0265339_100133333 | 389 |
| 44 | 3300046507 | Ga0495606_0045577 | Ga0495606_0045577_464_1633 | 389 |
| 45 | 3300005335 | Ga0070666_10001060 | Ga0070666_100010609 | 390 |
| 46 | 3300005341 | Ga0070691_10000388 | Ga0070691_1000038815 | 390 |
| 47 | 3300005458 | Ga0070681_10063300 | Ga0070681_100633002 | 390 |
| 48 | 3300005539 | Ga0068853_100249014 | Ga0068853_1002490141 | 390 |
| 49 | 3300005563 | Ga0068855_100045981 | Ga0068855_1000459814 | 390 |
| 50 | 3300005564 | Ga0070664_100060767 | Ga0070664_1000607672 | 390 |
| 51 | 3300006847 | Ga0075431_100118107 | Ga0075431_1001181072 | 390 |
| 52 | 3300007076 | Ga0075435_100008892 | Ga0075435_1000088922 | 390 |
| 53 | 3300010375 | Ga0105239_10149534 | Ga0105239_101495342 | 390 |
| 54 | 3300025254 | Ga0209148_1000724 | Ga0209148_100072422 | 390 |
| 55 | 3300025272 | Ga0209455_1000587 | Ga0209455_100058722 | 390 |
| 56 | 3300025909 | Ga0207705_10028426 | Ga0207705_100284264 | 390 |
| 57 | 3300025912 | Ga0207707_10153433 | Ga0207707_101534331 | 390 |
| 58 | 3300025913 | Ga0207695_10006044 | Ga0207695_1000604411 | 390 |
| 59 | 3300025913 | Ga0207695_10132414 | Ga0207695_101324142 | 390 |
| 60 | 3300025949 | Ga0207667_10015902 | Ga0207667_100159026 | 390 |
| 61 | 3300026041 | Ga0207639_10107008 | Ga0207639_101070082 | 390 |
| 62 | 3300026116 | Ga0207674_10139520 | Ga0207674_101395202 | 390 |
| 63 | 3300028379 | Ga0268266_10011409 | Ga0268266_100114098 | 390 |
| 64 | 3300028800 | Ga0265338_10141601 | Ga0265338_101416011 | 390 |
| 65 | 3300031240 | Ga0265320_10000114 | Ga0265320_1000011411 | 390 |
| 66 | 3300031241 | Ga0265325_10007064 | Ga0265325_100070644 | 390 |
| 67 | 3300031249 | Ga0265339_10055979 | Ga0265339_100559792 | 390 |
| 68 | 3300035724 | Ga0373933_0046909 | Ga0373933_0046909_693_1892 | 390 |
| 69 | 3300036401 | Ga0373937_0012546 | Ga0373937_0012546_1795_2994 | 390 |
| 70 | 3300039437 | Ga0436365_0727357 | Ga0436365_0727357_1519_2712 | 390 |
| 71 | 3300048929 | Ga0496126_0001076 | Ga0496126_0001076_27196_28398 | 390 |
| 72 | 3300049581 | Ga0501047_0051800 | Ga0501047_0051800_182_1381 | 390 |
| 73 | 3300049588 | Ga0501072_0105790 | Ga0501072_0105790_208_1464 | 390 |
| 74 | 3300049742 | Ga0501080_0219102 | Ga0501080_0219102_419_1618 | 390 |
| 75 | 3300049823 | Ga0501044_0103967 | Ga0501044_0103967_1533_2732 | 390 |
| 76 | 3300050513 | nmdc:mga0rr50_7847_c1 | nmdc:mga0rr50_7847_c1_972_2171 | 390 |
| 77 | 3300061734 | Ga0530510_0020701 | Ga0530510_0020701_81_1337 | 390 |
| 78 | 3300049822 | Ga0501035_0209058 | Ga0501035_0209058_456_1631 | 391 |
| 79 | 3300005458 | Ga0070681_10375044 | Ga0070681_103750441 | 392 |
| 80 | 3300005530 | Ga0070679_100126703 | Ga0070679_1001267032 | 392 |
| 81 | 3300005563 | Ga0068855_100024986 | Ga0068855_1000249864 | 392 |
| 82 | 3300009093 | Ga0105240_10272229 | Ga0105240_102722292 | 392 |
| 83 | 3300013104 | Ga0157370_10035437 | Ga0157370_100354372 | 392 |
| 84 | 3300025921 | Ga0207652_10182735 | Ga0207652_101827352 | 392 |
| 85 | 3300025932 | Ga0207690_10010848 | Ga0207690_100108484 | 392 |
| 86 | 3300049568 | Ga0501031_0001308 | Ga0501031_0001308_8188_9366 | 392 |
| 87 | 3300049569 | Ga0501032_0004758 | Ga0501032_0004758_4781_5959 | 392 |
| 88 | 3300049570 | Ga0501033_0005736 | Ga0501033_0005736_4653_5831 | 392 |
| 89 | 3300049571 | Ga0501034_0001944 | Ga0501034_0001944_19083_20261 | 392 |
| 90 | 3300049571 | Ga0501034_0236377 | Ga0501034_0236377_241_1419 | 392 |
| 91 | 3300049572 | Ga0501036_0000558 | Ga0501036_0000558_3956_5134 | 392 |
| 92 | 3300049575 | Ga0501039_0001271 | Ga0501039_0001271_5910_7088 | 392 |
| 93 | 3300049578 | Ga0501042_0022207 | Ga0501042_0022207_3137_4315 | 392 |
| 94 | 3300049580 | Ga0501046_0000928 | Ga0501046_0000928_5813_6991 | 392 |
| 95 | 3300049581 | Ga0501047_0002500 | Ga0501047_0002500_14391_15569 | 392 |
| 96 | 3300049581 | Ga0501047_0238862 | Ga0501047_0238862_326_1504 | 392 |
| 97 | 3300049583 | Ga0501067_0002123 | Ga0501067_0002123_9149_10327 | 392 |
| 98 | 3300049590 | Ga0501074_0001271 | Ga0501074_0001271_5859_7037 | 392 |
| 99 | 3300049741 | Ga0501079_0001529 | Ga0501079_0001529_5859_7037 | 392 |
| 100 | 3300049823 | Ga0501044_0004079 | Ga0501044_0004079_9922_11100 | 392 |
| 101 | 3300049824 | Ga0501045_0044942 | Ga0501045_0044942_408_1586 | 392 |
| 102 | 3300054114 | Ga0501084_0001251 | Ga0501084_0001251_5020_6198 | 392 |
| 103 | 3300060353 | Ga0501082_0009708 | Ga0501082_0009708_1214_2392 | 392 |
| 104 | 3300009093 | Ga0105240_10099389 | Ga0105240_100993892 | 393 |
| 105 | 3300049574 | Ga0501038_0112420 | Ga0501038_0112420_764_1969 | 393 |
| 106 | 3300049579 | Ga0501043_0028908 | Ga0501043_0028908_2891_4096 | 393 |
| 107 | 3300049581 | Ga0501047_0061317 | Ga0501047_0061317_1988_3193 | 393 |
| 108 | 3300049586 | Ga0501070_0043344 | Ga0501070_0043344_460_1665 | 393 |
| 109 | 3300003215 | JGI25153J46596_10000957 | JGI25153J46596_1000095718 | 394 |
| 110 | 3300005563 | Ga0068855_100108432 | Ga0068855_1001084322 | 394 |
| 111 | 3300009545 | Ga0105237_10367495 | Ga0105237_103674951 | 394 |
| 112 | 3300013104 | Ga0157370_10048461 | Ga0157370_100484612 | 394 |
| 113 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008164 | 394 |
| 114 | 3300049570 | Ga0501033_0028115 | Ga0501033_0028115_815_2002 | 394 |
| 115 | 3300049570 | Ga0501033_0042935 | Ga0501033_0042935_652_1836 | 394 |
| 116 | 3300049571 | Ga0501034_0310724 | Ga0501034_0310724_114_1298 | 394 |
| 117 | 3300049574 | Ga0501038_0202645 | Ga0501038_0202645_250_1434 | 394 |
| 118 | 3300005327 | Ga0070658_10011616 | Ga0070658_100116162 | 395 |
| 119 | 3300005329 | Ga0070683_100091252 | Ga0070683_1000912522 | 395 |
| 120 | 3300005330 | Ga0070690_100038614 | Ga0070690_1000386142 | 395 |
| 121 | 3300005339 | Ga0070660_100046343 | Ga0070660_1000463432 | 395 |
| 122 | 3300005458 | Ga0070681_10109263 | Ga0070681_101092632 | 395 |
| 123 | 3300005458 | Ga0070681_10140440 | Ga0070681_101404402 | 395 |
| 124 | 3300005530 | Ga0070679_100007658 | Ga0070679_10000765810 | 395 |
| 125 | 3300005539 | Ga0068853_100150948 | Ga0068853_1001509481 | 395 |
| 126 | 3300005548 | Ga0070665_100001512 | Ga0070665_10000151228 | 395 |
| 127 | 3300005548 | Ga0070665_100125095 | Ga0070665_1001250951 | 395 |
| 128 | 3300005548 | Ga0070665_100149302 | Ga0070665_1001493022 | 395 |
| 129 | 3300005563 | Ga0068855_100151150 | Ga0068855_1001511502 | 395 |
| 130 | 3300005616 | Ga0068852_100272271 | Ga0068852_1002722712 | 395 |
| 131 | 3300005841 | Ga0068863_100429799 | Ga0068863_1004297991 | 395 |
| 132 | 3300005842 | Ga0068858_100045141 | Ga0068858_1000451412 | 395 |
| 133 | 3300005842 | Ga0068858_100059780 | Ga0068858_1000597802 | 395 |
| 134 | 3300005844 | Ga0068862_100038693 | Ga0068862_1000386931 | 395 |
| 135 | 3300006237 | Ga0097621_100100888 | Ga0097621_1001008882 | 395 |
| 136 | 3300009093 | Ga0105240_10008925 | Ga0105240_100089256 | 395 |
| 137 | 3300009093 | Ga0105240_10009611 | Ga0105240_1000961115 | 395 |
| 138 | 3300009093 | Ga0105240_10279211 | Ga0105240_102792112 | 395 |
| 139 | 3300009098 | Ga0105245_10004593 | Ga0105245_100045932 | 395 |
| 140 | 3300009545 | Ga0105237_10111969 | Ga0105237_101119692 | 395 |
| 141 | 3300009545 | Ga0105237_10178420 | Ga0105237_101784202 | 395 |
| 142 | 3300009551 | Ga0105238_10073984 | Ga0105238_100739842 | 395 |
| 143 | 3300009551 | Ga0105238_10075451 | Ga0105238_100754512 | 395 |
| 144 | 3300010375 | Ga0105239_10055460 | Ga0105239_100554603 | 395 |
| 145 | 3300011119 | Ga0105246_10007849 | Ga0105246_100078493 | 395 |
| 146 | 3300025909 | Ga0207705_10012127 | Ga0207705_100121275 | 395 |
| 147 | 3300025912 | Ga0207707_10059238 | Ga0207707_100592382 | 395 |
| 148 | 3300025913 | Ga0207695_10058944 | Ga0207695_100589442 | 395 |
| 149 | 3300025913 | Ga0207695_10233049 | Ga0207695_102330491 | 395 |
| 150 | 3300025919 | Ga0207657_10089078 | Ga0207657_100890782 | 395 |
| 151 | 3300025920 | Ga0207649_10058553 | Ga0207649_100585532 | 395 |
| 152 | 3300025921 | Ga0207652_10036556 | Ga0207652_100365562 | 395 |
| 153 | 3300025924 | Ga0207694_10049990 | Ga0207694_100499903 | 395 |
| 154 | 3300025927 | Ga0207687_10084852 | Ga0207687_100848522 | 395 |
| 155 | 3300025941 | Ga0207711_10104638 | Ga0207711_101046381 | 395 |
| 156 | 3300025961 | Ga0207712_10028174 | Ga0207712_100281742 | 395 |
| 157 | 3300025986 | Ga0207658_10084392 | Ga0207658_100843922 | 395 |
| 158 | 3300026041 | Ga0207639_10169386 | Ga0207639_101693862 | 395 |
| 159 | 3300026088 | Ga0207641_10030768 | Ga0207641_100307682 | 395 |
| 160 | 3300026116 | Ga0207674_10054845 | Ga0207674_100548452 | 395 |
| 161 | 3300026142 | Ga0207698_10123094 | Ga0207698_101230941 | 395 |
| 162 | 3300028379 | Ga0268266_10000510 | Ga0268266_1000051019 | 395 |
| 163 | 3300028379 | Ga0268266_10097658 | Ga0268266_100976582 | 395 |
| 164 | 3300028800 | Ga0265338_10000649 | Ga0265338_1000064926 | 395 |
| 165 | 3300031238 | Ga0265332_10018566 | Ga0265332_100185662 | 395 |
| 166 | 3300031247 | Ga0265340_10045343 | Ga0265340_100453432 | 395 |
| 167 | 3300031249 | Ga0265339_10039862 | Ga0265339_100398621 | 395 |
| 168 | 3300031711 | Ga0265314_10043519 | Ga0265314_100435192 | 395 |
| 169 | 3300048924 | Ga0496121_0005060 | Ga0496121_0005060_10388_11575 | 395 |
| 170 | 3300049570 | Ga0501033_0014011 | Ga0501033_0014011_3232_4425 | 395 |
| 171 | 3300049570 | Ga0501033_0046005 | Ga0501033_0046005_1100_2287 | 395 |
| 172 | 3300049570 | Ga0501033_0046142 | Ga0501033_0046142_1226_2416 | 395 |
| 173 | 3300049572 | Ga0501036_0047797 | Ga0501036_0047797_1242_2429 | 395 |
| 174 | 3300049574 | Ga0501038_0077690 | Ga0501038_0077690_1010_2197 | 395 |
| 175 | 3300049579 | Ga0501043_0006529 | Ga0501043_0006529_6464_7651 | 395 |
| 176 | 3300049580 | Ga0501046_0015086 | Ga0501046_0015086_3177_4364 | 395 |
| 177 | 3300049580 | Ga0501046_0019651 | Ga0501046_0019651_2340_3590 | 395 |
| 178 | 3300049581 | Ga0501047_0005391 | Ga0501047_0005391_7472_8722 | 395 |
| 179 | 3300049581 | Ga0501047_0010277 | Ga0501047_0010277_1517_2704 | 395 |
| 180 | 3300049581 | Ga0501047_0042782 | Ga0501047_0042782_211_1404 | 395 |
| 181 | 3300049589 | Ga0501073_0093551 | Ga0501073_0093551_592_1836 | 395 |
| 182 | 3300049742 | Ga0501080_0017179 | Ga0501080_0017179_5310_6506 | 395 |
| 183 | 3300049822 | Ga0501035_0033218 | Ga0501035_0033218_2626_3819 | 395 |
| 184 | 3300049822 | Ga0501035_0058796 | Ga0501035_0058796_1132_2328 | 395 |
| 185 | 3300049822 | Ga0501035_0072869 | Ga0501035_0072869_1454_2641 | 395 |
| 186 | 3300049822 | Ga0501035_0244255 | Ga0501035_0244255_242_1432 | 395 |
| 187 | 3300049823 | Ga0501044_0002060 | Ga0501044_0002060_14254_15447 | 395 |
| 188 | 3300049823 | Ga0501044_0036110 | Ga0501044_0036110_2024_3211 | 395 |
| 189 | 3300049823 | Ga0501044_0146498 | Ga0501044_0146498_591_1826 | 395 |
| 190 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_163163_164350 | 395 |
| 191 | 3300053136 | Ga0500559_0026730 | Ga0500559_0026730_170_1357 | 395 |
| 192 | 3300053139 | Ga0500568_0047281 | Ga0500568_0047281_474_1661 | 395 |
| 193 | 3300028577 | Ga0265318_10001617 | Ga0265318_1000161713 | 396 |
| 194 | 3300031238 | Ga0265332_10015240 | Ga0265332_100152402 | 396 |
| 195 | 3300031240 | Ga0265320_10020307 | Ga0265320_100203072 | 396 |
| 196 | 3300031241 | Ga0265325_10002146 | Ga0265325_100021466 | 396 |
| 197 | 3300031249 | Ga0265339_10006221 | Ga0265339_100062213 | 396 |
| 198 | 3300031250 | Ga0265331_10030491 | Ga0265331_100304911 | 396 |
| 199 | 3300031250 | Ga0265331_10040204 | Ga0265331_100402042 | 396 |
| 200 | 3300031250 | Ga0265331_10074810 | Ga0265331_100748101 | 396 |
| 201 | 3300031344 | Ga0265316_10036393 | Ga0265316_100363932 | 396 |
| 202 | 3300031595 | Ga0265313_10006868 | Ga0265313_100068683 | 396 |
| 203 | 3300031711 | Ga0265314_10013126 | Ga0265314_100131262 | 396 |
| 204 | 3300031711 | Ga0265314_10021144 | Ga0265314_100211444 | 396 |
| 205 | 3300031711 | Ga0265314_10047892 | Ga0265314_100478922 | 396 |
| 206 | 3300049580 | Ga0501046_0020223 | Ga0501046_0020223_2062_3252 | 396 |
| 207 | 3300049581 | Ga0501047_0111658 | Ga0501047_0111658_1008_2198 | 396 |
| 208 | 3300053119 | Ga0500595_041721 | Ga0500595_041721_49_1257 | 396 |
| 209 | 3300005563 | Ga0068855_100009570 | Ga0068855_1000095706 | 397 |
| 210 | 3300006175 | Ga0070712_100006651 | Ga0070712_1000066513 | 397 |
| 211 | 3300009093 | Ga0105240_10141556 | Ga0105240_101415562 | 397 |
| 212 | 3300009176 | Ga0105242_10080497 | Ga0105242_100804972 | 397 |
| 213 | 3300009545 | Ga0105237_10130833 | Ga0105237_101308332 | 397 |
| 214 | 3300009551 | Ga0105238_10016469 | Ga0105238_100164692 | 397 |
| 215 | 3300025913 | Ga0207695_10010064 | Ga0207695_100100646 | 397 |
| 216 | 3300025914 | Ga0207671_10155294 | Ga0207671_101552941 | 397 |
| 217 | 3300025919 | Ga0207657_10018331 | Ga0207657_100183315 | 397 |
| 218 | 3300025924 | Ga0207694_10112955 | Ga0207694_101129552 | 397 |
| 219 | 3300025949 | Ga0207667_10148780 | Ga0207667_101487802 | 397 |
| 220 | 3300053119 | Ga0500595_011665 | Ga0500595_011665_146_1369 | 398 |
| 221 | 3300005328 | Ga0070676_10076137 | Ga0070676_100761372 | 399 |
| 222 | 3300005331 | Ga0070670_100147638 | Ga0070670_1001476381 | 399 |
| 223 | 3300005334 | Ga0068869_100005153 | Ga0068869_1000051536 | 399 |
| 224 | 3300005338 | Ga0068868_100028733 | Ga0068868_1000287332 | 399 |
| 225 | 3300005456 | Ga0070678_100003273 | Ga0070678_1000032736 | 399 |
| 226 | 3300005456 | Ga0070678_100016823 | Ga0070678_1000168232 | 399 |
| 227 | 3300005459 | Ga0068867_100010161 | Ga0068867_1000101614 | 399 |
| 228 | 3300005543 | Ga0070672_100065798 | Ga0070672_1000657983 | 399 |
| 229 | 3300005548 | Ga0070665_100390480 | Ga0070665_1003904801 | 399 |
| 230 | 3300005614 | Ga0068856_100160887 | Ga0068856_1001608871 | 399 |
| 231 | 3300005615 | Ga0070702_100084614 | Ga0070702_1000846142 | 399 |
| 232 | 3300005718 | Ga0068866_10018582 | Ga0068866_100185822 | 399 |
| 233 | 3300006237 | Ga0097621_100301194 | Ga0097621_1003011941 | 399 |
| 234 | 3300006358 | Ga0068871_100038858 | Ga0068871_1000388582 | 399 |
| 235 | 3300006358 | Ga0068871_100092527 | Ga0068871_1000925272 | 399 |
| 236 | 3300006881 | Ga0068865_100090367 | Ga0068865_1000903672 | 399 |
| 237 | 3300009093 | Ga0105240_10017096 | Ga0105240_100170966 | 399 |
| 238 | 3300009176 | Ga0105242_10052164 | Ga0105242_100521641 | 399 |
| 239 | 3300009551 | Ga0105238_10022027 | Ga0105238_100220277 | 399 |
| 240 | 3300009551 | Ga0105238_10055171 | Ga0105238_100551712 | 399 |
| 241 | 3300013105 | Ga0157369_10250220 | Ga0157369_102502202 | 399 |
| 242 | 3300013306 | Ga0163162_10102402 | Ga0163162_101024022 | 399 |
| 243 | 3300013308 | Ga0157375_10042186 | Ga0157375_100421862 | 399 |
| 244 | 3300014325 | Ga0163163_10000012 | Ga0163163_10000012267 | 399 |
| 245 | 3300017792 | Ga0163161_10015244 | Ga0163161_100152442 | 399 |
| 246 | 3300025261 | Ga0209233_1007043 | Ga0209233_10070432 | 399 |
| 247 | 3300025913 | Ga0207695_10106974 | Ga0207695_101069742 | 399 |
| 248 | 3300025914 | Ga0207671_10047583 | Ga0207671_100475832 | 399 |
| 249 | 3300025924 | Ga0207694_10025971 | Ga0207694_100259713 | 399 |
| 250 | 3300025924 | Ga0207694_10055134 | Ga0207694_100551342 | 399 |
| 251 | 3300025925 | Ga0207650_10135003 | Ga0207650_101350032 | 399 |
| 252 | 3300025927 | Ga0207687_10021879 | Ga0207687_100218794 | 399 |
| 253 | 3300025934 | Ga0207686_10016921 | Ga0207686_100169212 | 399 |
| 254 | 3300025938 | Ga0207704_10010537 | Ga0207704_100105373 | 399 |
| 255 | 3300025940 | Ga0207691_10131367 | Ga0207691_101313672 | 399 |
| 256 | 3300025942 | Ga0207689_10020216 | Ga0207689_100202163 | 399 |
| 257 | 3300026078 | Ga0207702_10315457 | Ga0207702_103154571 | 399 |
| 258 | 3300026089 | Ga0207648_10034240 | Ga0207648_100342402 | 399 |
| 259 | 3300026121 | Ga0207683_10004326 | Ga0207683_100043263 | 399 |
| 260 | 3300028379 | Ga0268266_10203284 | Ga0268266_102032842 | 399 |
| 261 | 3300049570 | Ga0501033_0007975 | Ga0501033_0007975_6172_7380 | 399 |
| 262 | 3300049581 | Ga0501047_0265802 | Ga0501047_0265802_298_1542 | 399 |
| 263 | 3300053140 | Ga0500573_0000032 | Ga0500573_0000032_79554_80753 | 399 |
| 264 | 3300053142 | Ga0500577_0067502 | Ga0500577_0067502_81_1283 | 399 |
| 265 | 3300060353 | Ga0501082_0079710 | Ga0501082_0079710_379_1671 | 399 |
| 266 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_1000035296 | 400 |
| 267 | 3300003322 | rootL2_10067691 | rootL2_100676911 | 400 |
| 268 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006785 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ezs-assembly1.cif.gz_B | crystal structure of aminotransferase aspb (np_207418.1) from helicobacter pylori 26695 at 2.19 a resolution | 0.9463 | 16 | 397 |
| 3jtx-assembly1.cif.gz_B | crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution | 0.9363 | 10 | 400 |
| 3jtx-assembly1.cif.gz_A | crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution | 0.929 | 4 | 400 |
| 3jtx-assembly1.cif.gz_B | crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution | 0.927 | 10 | 400 |
| 3jtx-assembly1.cif.gz_A | crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution | 0.9267 | 4 | 400 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3jtxA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9391 | 47 | 294 | 3.40.640.10 |
| 2douB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.938 | 64 | 294 | 3.40.640.10 |
| af_Q58786_71_297_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9351 | 64 | 294 | 3.40.640.10 |
| 3jtxA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9316 | 47 | 294 | 3.40.640.10 |
| 2douB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9298 | 64 | 294 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A525NLI7-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9798 | 10 | 304 |
GO:0008483
GO:0009058 GO:0030170 |
| AF-A0A6L5Z3W5-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.978 | 10 | 399 |
GO:0008483
GO:0009058 GO:0030170 |
| AF-A0A3Q9TB63-F1-model_v4 | deleted | 0.9643 | 10 | 398 |
|
| AF-A0A3D9HPT0-F1-model_v4 | N-succinyldiaminopimelate aminotransferase | 0.9625 | 9 | 399 |
GO:0008483
GO:0009058 GO:0030170 |
| AF-A0A525NLI7-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9604 | 10 | 304 |
GO:0008483
GO:0009058 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar