F375482

General Info

Members Datasets Scaffolds Average Seq Length
268 147 266 398

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10080497|Ga0105242_100804972
Length 449
Sequence LWSLSFRERSWAPSKAAPIFFFGVVPGSRYLELPAPDLYLPRMSNLPPGPFTRLSTLLGDSKPGKEPISLAVGDPAGAVPEFVKDALARGAAGFGNYPAIIGTEDWRQAAAEWLNRRFALNGAIDAEKNLLPLNGTREGLFSVLFPLMPESKAGQQPIVAMPNPFYQCYAAAALGSGAEPLYVAARKENGFLPDFAQLPEETLQRLAAVYICSPSNPEGAVADEAYWTRLFQLAERHDFMVLADECYADIWFDQEPVSALTSRLAQCFDRLLSFHSLSKRSGLPGLRSGLVAGDAARIEKFRAFRNVAGPTVPTPLLTASAACWRDEDHVIANRAAYQEKMEAAGRILGNRMTRPAGGFFLWLDVGNGEEFALRAWREQGVRLLPGAYMGRDVFDGRAGGASLTAQVAGRSGHEEKTQSNPGFSYVRVALVNDLSTIMTALERLREILD

Samples

Sample ID Description Type Environment
1 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
2 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 0
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10000957 3300003215 Bacteria 17515
3 rootL2_10067691 3300003322 Bacteria 1303
4 Ga0070658_10011616 3300005327 Bacteria 7064
5 Ga0070676_10076137 3300005328 Bacteria 2025
6 Ga0070683_100091252 3300005329 Bacteria 2860
7 Ga0070690_100038614 3300005330 Bacteria 3014
8 Ga0070670_100147638 3300005331 Bacteria 2035
9 Ga0068869_100005153 3300005334 Bacteria 8200
10 Ga0068869_100026242 3300005334 Bacteria 4053
11 Ga0070666_10001060 3300005335 Bacteria 16802
12 Ga0068868_100028733 3300005338 Bacteria 4254
13 Ga0070660_100046343 3300005339 Bacteria 3333
14 Ga0070689_100079078 3300005340 Bacteria 2579
15 Ga0070691_10000388 3300005341 Bacteria 15959
16 Ga0070673_100016715 3300005364 Bacteria 5197
17 Ga0070713_100143522 3300005436 Bacteria 2117
18 Ga0070678_100003273 3300005456 Bacteria 9005
19 Ga0070678_100016823 3300005456 Bacteria 4688
20 Ga0070681_10063300 3300005458 Unclassified 3671
21 Ga0070681_10109263 3300005458 Bacteria 2706
22 Ga0070681_10140440 3300005458 Bacteria 2346
23 Ga0070681_10375044 3300005458 Bacteria 1333
24 Ga0068867_100010161 3300005459 Bacteria 6639
25 Ga0070679_100007658 3300005530 Bacteria 10111
26 Ga0070679_100101113 3300005530 Bacteria 2869
27 Ga0070679_100126703 3300005530 Bacteria 2536
28 Ga0068853_100150948 3300005539 Bacteria 2092
29 Ga0068853_100249014 3300005539 Bacteria 1630
30 Ga0070672_100056467 3300005543 Bacteria 3079
31 Ga0070672_100065798 3300005543 Bacteria 2868
32 Ga0070665_100001512 3300005548 Bacteria 26999
33 Ga0070665_100125095 3300005548 Bacteria 2573
34 Ga0070665_100149302 3300005548 Bacteria 2340
35 Ga0070665_100390480 3300005548 Unclassified 1399
36 Ga0068855_100009570 3300005563 Bacteria 11695
37 Ga0068855_100024986 3300005563 Bacteria 7151
38 Ga0068855_100045981 3300005563 Bacteria 5161
39 Ga0068855_100108432 3300005563 Bacteria 3189
40 Ga0068855_100151150 3300005563 Bacteria 2640
41 Ga0070664_100060767 3300005564 Bacteria 3219
42 Ga0068857_100204749 3300005577 Bacteria 1799
43 Ga0068856_100160887 3300005614 Bacteria 2255
44 Ga0070702_100084614 3300005615 Bacteria 1908
45 Ga0068852_100272271 3300005616 Unclassified 1630
46 Ga0068866_10018582 3300005718 Bacteria 3147
47 Ga0068863_100429799 3300005841 Bacteria 1294
48 Ga0068858_100045141 3300005842 Bacteria 4083
49 Ga0068858_100059780 3300005842 Bacteria 3522
50 Ga0068862_100038693 3300005844 Bacteria 4047
51 Ga0070712_100006651 3300006175 Bacteria 7188
52 Ga0097621_100030576 3300006237 Bacteria 4264
53 Ga0097621_100100888 3300006237 Bacteria 2428
54 Ga0097621_100301194 3300006237 Bacteria 1416
55 Ga0068871_100002417 3300006358 Bacteria 12749
56 Ga0068871_100038858 3300006358 Bacteria 3804
57 Ga0068871_100092527 3300006358 Bacteria 2522
58 Ga0075431_100118107 3300006847 Bacteria 2736
59 Ga0068865_100090367 3300006881 Bacteria 2220
60 Ga0075435_100008892 3300007076 Bacteria 7236
61 Ga0105240_10008925 3300009093 Bacteria 14253
62 Ga0105240_10009611 3300009093 Bacteria 13679
63 Ga0105240_10017096 3300009093 Bacteria 9794
64 Ga0105240_10099389 3300009093 Bacteria 3541
65 Ga0105240_10141556 3300009093 Bacteria 2875
66 Ga0105240_10272229 3300009093 Bacteria 1949
67 Ga0105240_10279211 3300009093 Bacteria 1920
68 Ga0105245_10004593 3300009098 Bacteria 12191
69 Ga0105243_10008996 3300009148 Bacteria 7633
70 Ga0105243_10197864 3300009148 Unclassified 1760
71 Ga0105242_10052164 3300009176 Bacteria 3336
72 Ga0105242_10080497 3300009176 Bacteria 2722
73 Ga0105248_10009177 3300009177 Bacteria 10879
74 Ga0105237_10111969 3300009545 Bacteria 2721
75 Ga0105237_10130833 3300009545 Unclassified 2504
76 Ga0105237_10178420 3300009545 Bacteria 2124
77 Ga0105237_10367495 3300009545 Bacteria 1443
78 Ga0105238_10016469 3300009551 Bacteria 7483
79 Ga0105238_10018175 3300009551 Bacteria 7149
80 Ga0105238_10022027 3300009551 Bacteria 6494
81 Ga0105238_10055171 3300009551 Bacteria 3990
82 Ga0105238_10073984 3300009551 Bacteria 3401
83 Ga0105238_10075451 3300009551 Bacteria 3364
84 Ga0105238_10256795 3300009551 Bacteria 1727
85 Ga0105249_10053821 3300009553 Bacteria 3679
86 Ga0105239_10055460 3300010375 Bacteria 4346
87 Ga0105239_10117322 3300010375 Bacteria 2954
88 Ga0105239_10149534 3300010375 Unclassified 2606
89 Ga0105246_10007849 3300011119 Bacteria 6547
90 Ga0105246_10033953 3300011119 Bacteria 3394
91 Ga0157370_10035437 3300013104 Bacteria 4850
92 Ga0157370_10048461 3300013104 Bacteria 4070
93 Ga0157369_10250220 3300013105 Bacteria 1849
94 Ga0157374_10408836 3300013296 Bacteria 1355
95 Ga0157378_10044877 3300013297 Bacteria 3926
96 Ga0157378_10235217 3300013297 Bacteria 1748
97 Ga0163162_10085194 3300013306 Bacteria 3237
98 Ga0163162_10102402 3300013306 Bacteria 2957
99 Ga0157372_10080080 3300013307 Bacteria 3695
100 Ga0157375_10042186 3300013308 Bacteria 4414
101 Ga0163163_10000012 3300014325 Bacteria 257369
102 Ga0157379_10026632 3300014968 Bacteria 5147
103 Ga0157379_10077109 3300014968 Bacteria 2984
104 Ga0163161_10015244 3300017792 Bacteria 5356
105 Ga0209148_1000724 3300025254 Bacteria 25957
106 Ga0209233_1000006 3300025261 Bacteria 1473685
107 Ga0209233_1007043 3300025261 Bacteria 3589
108 Ga0209455_1000587 3300025272 Bacteria 23626
109 Ga0209758_1000008 3300025297 Bacteria 1215263
110 Ga0207680_10038575 3300025903 Bacteria 2766
111 Ga0207705_10012127 3300025909 Bacteria 6230
112 Ga0207705_10028426 3300025909 Bacteria 3986
113 Ga0207707_10059238 3300025912 Bacteria 3332
114 Ga0207707_10153433 3300025912 Unclassified 2013
115 Ga0207695_10006044 3300025913 Bacteria 15800
116 Ga0207695_10010064 3300025913 Bacteria 11612
117 Ga0207695_10058944 3300025913 Bacteria 3984
118 Ga0207695_10106974 3300025913 Bacteria 2783
119 Ga0207695_10132414 3300025913 Bacteria 2450
120 Ga0207695_10233049 3300025913 Unclassified 1745
121 Ga0207671_10047583 3300025914 Bacteria 3174
122 Ga0207671_10155294 3300025914 Bacteria 1770
123 Ga0207657_10018331 3300025919 Bacteria 6686
124 Ga0207657_10089078 3300025919 Bacteria 2578
125 Ga0207649_10058553 3300025920 Bacteria 2413
126 Ga0207652_10036556 3300025921 Bacteria 4151
127 Ga0207652_10182735 3300025921 Bacteria 1885
128 Ga0207694_10025971 3300025924 Bacteria 4453
129 Ga0207694_10049990 3300025924 Bacteria 3237
130 Ga0207694_10055134 3300025924 Bacteria 3086
131 Ga0207694_10112955 3300025924 Bacteria 2162
132 Ga0207650_10135003 3300025925 Unclassified 1934
133 Ga0207687_10021879 3300025927 Bacteria 4250
134 Ga0207687_10084852 3300025927 Bacteria 2296
135 Ga0207700_10145469 3300025928 Bacteria 1953
136 Ga0207690_10010848 3300025932 Bacteria 5429
137 Ga0207686_10016921 3300025934 Bacteria 4098
138 Ga0207704_10010537 3300025938 Bacteria 4515
139 Ga0207691_10131367 3300025940 Bacteria 2212
140 Ga0207711_10104638 3300025941 Bacteria 2508
141 Ga0207689_10020216 3300025942 Bacteria 5607
142 Ga0207689_10034946 3300025942 Bacteria 4175
143 Ga0207667_10015902 3300025949 Bacteria 8521
144 Ga0207667_10148780 3300025949 Bacteria 2410
145 Ga0207712_10028174 3300025961 Bacteria 3755
146 Ga0207658_10084392 3300025986 Bacteria 2444
147 Ga0207703_10082905 3300026035 Bacteria 2678
148 Ga0207639_10107008 3300026041 Bacteria 2271
149 Ga0207639_10169386 3300026041 Unclassified 1848
150 Ga0207702_10315457 3300026078 Unclassified 1487
151 Ga0207641_10030768 3300026088 Bacteria 4447
152 Ga0207648_10012097 3300026089 Bacteria 8093
153 Ga0207648_10034240 3300026089 Bacteria 4478
154 Ga0207674_10054845 3300026116 Bacteria 4056
155 Ga0207674_10139520 3300026116 Bacteria 2384
156 Ga0207683_10004326 3300026121 Bacteria 12265
157 Ga0207698_10123094 3300026142 Unclassified 2199
158 Ga0268266_10000510 3300028379 Bacteria 54868
159 Ga0268266_10011409 3300028379 Bacteria 7726
160 Ga0268266_10097658 3300028379 Bacteria 2583
161 Ga0268266_10203284 3300028379 Bacteria 1814
162 Ga0268266_10237877 3300028379 Bacteria 1679
163 Ga0265318_10001617 3300028577 Bacteria 13029
164 Ga0265338_10000649 3300028800 Bacteria 60084
165 Ga0265338_10037970 3300028800 Bacteria 4572
166 Ga0265338_10141601 3300028800 Bacteria 1883
167 Ga0265332_10015240 3300031238 Bacteria 3393
168 Ga0265332_10018566 3300031238 Bacteria 3068
169 Ga0265320_10000114 3300031240 Bacteria 69880
170 Ga0265320_10020307 3300031240 Bacteria 3604
171 Ga0265325_10002146 3300031241 Bacteria 13452
172 Ga0265325_10007064 3300031241 Bacteria 6762
173 Ga0265340_10045343 3300031247 Bacteria 2148
174 Ga0265339_10006221 3300031249 Bacteria 7859
175 Ga0265339_10013333 3300031249 Bacteria 4984
176 Ga0265339_10039862 3300031249 Bacteria 2613
177 Ga0265339_10055979 3300031249 Bacteria 2137
178 Ga0265331_10030491 3300031250 Bacteria 2685
179 Ga0265331_10040204 3300031250 Bacteria 2276
180 Ga0265331_10074810 3300031250 Bacteria 1580
181 Ga0265316_10036393 3300031344 Bacteria 3981
182 Ga0265313_10006868 3300031595 Bacteria 7929
183 Ga0265314_10013126 3300031711 Bacteria 6711
184 Ga0265314_10021144 3300031711 Bacteria 5011
185 Ga0265314_10043519 3300031711 Bacteria 3191
186 Ga0265314_10047892 3300031711 Bacteria 3004
187 Ga0265314_10093887 3300031711 Bacteria 1946
188 Ga0373933_0046909 3300035724 Bacteria 2567
189 Ga0373937_0012546 3300036401 Bacteria 7455
190 Ga0395900_0055834 3300037418 Bacteria 4066
191 Ga0400483_032440 3300039062 Bacteria 2616
192 Ga0400483_151609 3300039062 Bacteria 1455
193 Ga0436365_0727357 3300039437 Bacteria 3049
194 Ga0436363_1452481 3300039450 Bacteria 1592
195 Ga0495606_0045577 3300046507 Bacteria 2905
196 Ga0496121_0005060 3300048924 Bacteria 17222
197 Ga0496126_0001076 3300048929 Bacteria 45962
198 Ga0501031_0001308 3300049568 Bacteria 15277
199 Ga0501032_0004758 3300049569 Bacteria 10175
200 Ga0501033_0005736 3300049570 Bacteria 9786
201 Ga0501033_0007975 3300049570 Bacteria 8202
202 Ga0501033_0014011 3300049570 Bacteria 6099
203 Ga0501033_0028115 3300049570 Bacteria 4227
204 Ga0501033_0042935 3300049570 Bacteria 3369
205 Ga0501033_0046005 3300049570 Bacteria 3245
206 Ga0501033_0046142 3300049570 Bacteria 3240
207 Ga0501034_0001944 3300049571 Bacteria 26175
208 Ga0501034_0236377 3300049571 Bacteria 1775
209 Ga0501034_0310724 3300049571 Bacteria 1511
210 Ga0501036_0000558 3300049572 Bacteria 26755
211 Ga0501036_0047797 3300049572 Bacteria 3623
212 Ga0501038_0077690 3300049574 Bacteria 2802
213 Ga0501038_0112420 3300049574 Bacteria 2255
214 Ga0501038_0202645 3300049574 Bacteria 1592
215 Ga0501039_0001271 3300049575 Bacteria 18461
216 Ga0501042_0022207 3300049578 Bacteria 4432
217 Ga0501043_0006529 3300049579 Bacteria 9357
218 Ga0501043_0028908 3300049579 Bacteria 4351
219 Ga0501046_0000928 3300049580 Bacteria 28785
220 Ga0501046_0015086 3300049580 Bacteria 6497
221 Ga0501046_0019651 3300049580 Bacteria 5599
222 Ga0501046_0020223 3300049580 Bacteria 5510
223 Ga0501047_0002500 3300049581 Bacteria 17526
224 Ga0501047_0005391 3300049581 Bacteria 12022
225 Ga0501047_0010277 3300049581 Bacteria 8854
226 Ga0501047_0042782 3300049581 Bacteria 4376
227 Ga0501047_0051800 3300049581 Bacteria 3967
228 Ga0501047_0061317 3300049581 Bacteria 3629
229 Ga0501047_0111658 3300049581 Bacteria 2616
230 Ga0501047_0136997 3300049581 Bacteria 2328
231 Ga0501047_0238862 3300049581 Bacteria 1668
232 Ga0501047_0265802 3300049581 Bacteria 1562
233 Ga0501067_0002123 3300049583 Bacteria 10908
234 Ga0501070_0043344 3300049586 Bacteria 3745
235 Ga0501072_0105790 3300049588 Bacteria 2238
236 Ga0501073_0093551 3300049589 Bacteria 2088
237 Ga0501073_0144417 3300049589 Unclassified 1649
238 Ga0501074_0001271 3300049590 Bacteria 16679
239 Ga0501079_0001529 3300049741 Bacteria 16356
240 Ga0501080_0017179 3300049742 Bacteria 6684
241 Ga0501080_0219102 3300049742 Bacteria 1742
242 Ga0501035_0033218 3300049822 Bacteria 4692
243 Ga0501035_0058796 3300049822 Bacteria 3424
244 Ga0501035_0072869 3300049822 Bacteria 3039
245 Ga0501035_0209058 3300049822 Unclassified 1670
246 Ga0501035_0244255 3300049822 Unclassified 1526
247 Ga0501044_0002060 3300049823 Bacteria 23168
248 Ga0501044_0004079 3300049823 Bacteria 16380
249 Ga0501044_0036110 3300049823 Bacteria 5171
250 Ga0501044_0103967 3300049823 Bacteria 2854
251 Ga0501044_0146498 3300049823 Bacteria 2346
252 Ga0501044_0467138 3300049823 Bacteria 1166
253 Ga0501045_0044942 3300049824 Bacteria 3217
254 nmdc:mga0rr50_7847_c1 3300050513 Bacteria 6616
255 Ga0500635_0021353 3300053080 Bacteria 1994
256 Ga0500643_000027 3300053087 Bacteria 251062
257 Ga0500595_011665 3300053119 Bacteria 3428
258 Ga0500595_041721 3300053119 Unclassified 1473
259 Ga0500559_0026730 3300053136 Bacteria 2460
260 Ga0500568_0047281 3300053139 Bacteria 1705
261 Ga0500573_0000032 3300053140 Bacteria 131098
262 Ga0500577_0067502 3300053142 Unclassified 1394
263 Ga0501084_0001251 3300054114 Bacteria 19995
264 Ga0501082_0009708 3300060353 Bacteria 8287
265 Ga0501082_0079710 3300060353 Bacteria 2825
266 Ga0530510_0020701 3300061734 Bacteria 4678

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0467138 Ga0501044_0467138_31_1152 354
2 3300028379 Ga0268266_10237877 Ga0268266_102378772 355
3 3300005577 Ga0068857_100204749 Ga0068857_1002047492 360
4 3300031711 Ga0265314_10093887 Ga0265314_100938871 368
5 3300049581 Ga0501047_0136997 Ga0501047_0136997_68_1183 371
6 3300006237 Ga0097621_100030576 Ga0097621_1000305763 373
7 3300006358 Ga0068871_100002417 Ga0068871_10000241712 373
8 3300025928 Ga0207700_10145469 Ga0207700_101454692 374
9 3300039450 Ga0436363_1452481 Ga0436363_1452481_397_1578 374
10 3300028800 Ga0265338_10037970 Ga0265338_100379701 377
11 3300011119 Ga0105246_10033953 Ga0105246_100339533 378
12 3300037418 Ga0395900_0055834 Ga0395900_0055834_150_1286 378
13 3300049589 Ga0501073_0144417 Ga0501073_0144417_424_1560 378
14 3300005436 Ga0070713_100143522 Ga0070713_1001435222 382
15 iso_pu_bacteria 2854681122 2854681196 383
16 iso_pu_bacteria 3000017691 3000020630 383
17 3300039062 Ga0400483_032440 Ga0400483_032440_846_2033 385
18 3300039062 Ga0400483_151609 Ga0400483_151609_224_1411 385
19 3300009148 Ga0105243_10197864 Ga0105243_101978641 386
20 3300026035 Ga0207703_10082905 Ga0207703_100829053 386
21 3300005530 Ga0070679_100101113 Ga0070679_1001011132 387
22 3300009551 Ga0105238_10018175 Ga0105238_100181752 387
23 3300013296 Ga0157374_10408836 Ga0157374_104088361 387
24 3300025903 Ga0207680_10038575 Ga0207680_100385752 387
25 3300053080 Ga0500635_0021353 Ga0500635_0021353_189_1352 387
26 3300005334 Ga0068869_100026242 Ga0068869_1000262423 389
27 3300005340 Ga0070689_100079078 Ga0070689_1000790783 389
28 3300005364 Ga0070673_100016715 Ga0070673_1000167153 389
29 3300005543 Ga0070672_100056467 Ga0070672_1000564672 389
30 3300009148 Ga0105243_10008996 Ga0105243_100089961 389
31 3300009177 Ga0105248_10009177 Ga0105248_100091779 389
32 3300009551 Ga0105238_10256795 Ga0105238_102567952 389
33 3300009553 Ga0105249_10053821 Ga0105249_100538212 389
34 3300010375 Ga0105239_10117322 Ga0105239_101173222 389
35 3300013297 Ga0157378_10044877 Ga0157378_100448771 389
36 3300013297 Ga0157378_10235217 Ga0157378_102352172 389
37 3300013306 Ga0163162_10085194 Ga0163162_100851942 389
38 3300013307 Ga0157372_10080080 Ga0157372_100800802 389
39 3300014968 Ga0157379_10026632 Ga0157379_100266324 389
40 3300014968 Ga0157379_10077109 Ga0157379_100771092 389
41 3300025942 Ga0207689_10034946 Ga0207689_100349462 389
42 3300026089 Ga0207648_10012097 Ga0207648_100120972 389
43 3300031249 Ga0265339_10013333 Ga0265339_100133333 389
44 3300046507 Ga0495606_0045577 Ga0495606_0045577_464_1633 389
45 3300005335 Ga0070666_10001060 Ga0070666_100010609 390
46 3300005341 Ga0070691_10000388 Ga0070691_1000038815 390
47 3300005458 Ga0070681_10063300 Ga0070681_100633002 390
48 3300005539 Ga0068853_100249014 Ga0068853_1002490141 390
49 3300005563 Ga0068855_100045981 Ga0068855_1000459814 390
50 3300005564 Ga0070664_100060767 Ga0070664_1000607672 390
51 3300006847 Ga0075431_100118107 Ga0075431_1001181072 390
52 3300007076 Ga0075435_100008892 Ga0075435_1000088922 390
53 3300010375 Ga0105239_10149534 Ga0105239_101495342 390
54 3300025254 Ga0209148_1000724 Ga0209148_100072422 390
55 3300025272 Ga0209455_1000587 Ga0209455_100058722 390
56 3300025909 Ga0207705_10028426 Ga0207705_100284264 390
57 3300025912 Ga0207707_10153433 Ga0207707_101534331 390
58 3300025913 Ga0207695_10006044 Ga0207695_1000604411 390
59 3300025913 Ga0207695_10132414 Ga0207695_101324142 390
60 3300025949 Ga0207667_10015902 Ga0207667_100159026 390
61 3300026041 Ga0207639_10107008 Ga0207639_101070082 390
62 3300026116 Ga0207674_10139520 Ga0207674_101395202 390
63 3300028379 Ga0268266_10011409 Ga0268266_100114098 390
64 3300028800 Ga0265338_10141601 Ga0265338_101416011 390
65 3300031240 Ga0265320_10000114 Ga0265320_1000011411 390
66 3300031241 Ga0265325_10007064 Ga0265325_100070644 390
67 3300031249 Ga0265339_10055979 Ga0265339_100559792 390
68 3300035724 Ga0373933_0046909 Ga0373933_0046909_693_1892 390
69 3300036401 Ga0373937_0012546 Ga0373937_0012546_1795_2994 390
70 3300039437 Ga0436365_0727357 Ga0436365_0727357_1519_2712 390
71 3300048929 Ga0496126_0001076 Ga0496126_0001076_27196_28398 390
72 3300049581 Ga0501047_0051800 Ga0501047_0051800_182_1381 390
73 3300049588 Ga0501072_0105790 Ga0501072_0105790_208_1464 390
74 3300049742 Ga0501080_0219102 Ga0501080_0219102_419_1618 390
75 3300049823 Ga0501044_0103967 Ga0501044_0103967_1533_2732 390
76 3300050513 nmdc:mga0rr50_7847_c1 nmdc:mga0rr50_7847_c1_972_2171 390
77 3300061734 Ga0530510_0020701 Ga0530510_0020701_81_1337 390
78 3300049822 Ga0501035_0209058 Ga0501035_0209058_456_1631 391
79 3300005458 Ga0070681_10375044 Ga0070681_103750441 392
80 3300005530 Ga0070679_100126703 Ga0070679_1001267032 392
81 3300005563 Ga0068855_100024986 Ga0068855_1000249864 392
82 3300009093 Ga0105240_10272229 Ga0105240_102722292 392
83 3300013104 Ga0157370_10035437 Ga0157370_100354372 392
84 3300025921 Ga0207652_10182735 Ga0207652_101827352 392
85 3300025932 Ga0207690_10010848 Ga0207690_100108484 392
86 3300049568 Ga0501031_0001308 Ga0501031_0001308_8188_9366 392
87 3300049569 Ga0501032_0004758 Ga0501032_0004758_4781_5959 392
88 3300049570 Ga0501033_0005736 Ga0501033_0005736_4653_5831 392
89 3300049571 Ga0501034_0001944 Ga0501034_0001944_19083_20261 392
90 3300049571 Ga0501034_0236377 Ga0501034_0236377_241_1419 392
91 3300049572 Ga0501036_0000558 Ga0501036_0000558_3956_5134 392
92 3300049575 Ga0501039_0001271 Ga0501039_0001271_5910_7088 392
93 3300049578 Ga0501042_0022207 Ga0501042_0022207_3137_4315 392
94 3300049580 Ga0501046_0000928 Ga0501046_0000928_5813_6991 392
95 3300049581 Ga0501047_0002500 Ga0501047_0002500_14391_15569 392
96 3300049581 Ga0501047_0238862 Ga0501047_0238862_326_1504 392
97 3300049583 Ga0501067_0002123 Ga0501067_0002123_9149_10327 392
98 3300049590 Ga0501074_0001271 Ga0501074_0001271_5859_7037 392
99 3300049741 Ga0501079_0001529 Ga0501079_0001529_5859_7037 392
100 3300049823 Ga0501044_0004079 Ga0501044_0004079_9922_11100 392
101 3300049824 Ga0501045_0044942 Ga0501045_0044942_408_1586 392
102 3300054114 Ga0501084_0001251 Ga0501084_0001251_5020_6198 392
103 3300060353 Ga0501082_0009708 Ga0501082_0009708_1214_2392 392
104 3300009093 Ga0105240_10099389 Ga0105240_100993892 393
105 3300049574 Ga0501038_0112420 Ga0501038_0112420_764_1969 393
106 3300049579 Ga0501043_0028908 Ga0501043_0028908_2891_4096 393
107 3300049581 Ga0501047_0061317 Ga0501047_0061317_1988_3193 393
108 3300049586 Ga0501070_0043344 Ga0501070_0043344_460_1665 393
109 3300003215 JGI25153J46596_10000957 JGI25153J46596_1000095718 394
110 3300005563 Ga0068855_100108432 Ga0068855_1001084322 394
111 3300009545 Ga0105237_10367495 Ga0105237_103674951 394
112 3300013104 Ga0157370_10048461 Ga0157370_100484612 394
113 3300025297 Ga0209758_1000008 Ga0209758_1000008164 394
114 3300049570 Ga0501033_0028115 Ga0501033_0028115_815_2002 394
115 3300049570 Ga0501033_0042935 Ga0501033_0042935_652_1836 394
116 3300049571 Ga0501034_0310724 Ga0501034_0310724_114_1298 394
117 3300049574 Ga0501038_0202645 Ga0501038_0202645_250_1434 394
118 3300005327 Ga0070658_10011616 Ga0070658_100116162 395
119 3300005329 Ga0070683_100091252 Ga0070683_1000912522 395
120 3300005330 Ga0070690_100038614 Ga0070690_1000386142 395
121 3300005339 Ga0070660_100046343 Ga0070660_1000463432 395
122 3300005458 Ga0070681_10109263 Ga0070681_101092632 395
123 3300005458 Ga0070681_10140440 Ga0070681_101404402 395
124 3300005530 Ga0070679_100007658 Ga0070679_10000765810 395
125 3300005539 Ga0068853_100150948 Ga0068853_1001509481 395
126 3300005548 Ga0070665_100001512 Ga0070665_10000151228 395
127 3300005548 Ga0070665_100125095 Ga0070665_1001250951 395
128 3300005548 Ga0070665_100149302 Ga0070665_1001493022 395
129 3300005563 Ga0068855_100151150 Ga0068855_1001511502 395
130 3300005616 Ga0068852_100272271 Ga0068852_1002722712 395
131 3300005841 Ga0068863_100429799 Ga0068863_1004297991 395
132 3300005842 Ga0068858_100045141 Ga0068858_1000451412 395
133 3300005842 Ga0068858_100059780 Ga0068858_1000597802 395
134 3300005844 Ga0068862_100038693 Ga0068862_1000386931 395
135 3300006237 Ga0097621_100100888 Ga0097621_1001008882 395
136 3300009093 Ga0105240_10008925 Ga0105240_100089256 395
137 3300009093 Ga0105240_10009611 Ga0105240_1000961115 395
138 3300009093 Ga0105240_10279211 Ga0105240_102792112 395
139 3300009098 Ga0105245_10004593 Ga0105245_100045932 395
140 3300009545 Ga0105237_10111969 Ga0105237_101119692 395
141 3300009545 Ga0105237_10178420 Ga0105237_101784202 395
142 3300009551 Ga0105238_10073984 Ga0105238_100739842 395
143 3300009551 Ga0105238_10075451 Ga0105238_100754512 395
144 3300010375 Ga0105239_10055460 Ga0105239_100554603 395
145 3300011119 Ga0105246_10007849 Ga0105246_100078493 395
146 3300025909 Ga0207705_10012127 Ga0207705_100121275 395
147 3300025912 Ga0207707_10059238 Ga0207707_100592382 395
148 3300025913 Ga0207695_10058944 Ga0207695_100589442 395
149 3300025913 Ga0207695_10233049 Ga0207695_102330491 395
150 3300025919 Ga0207657_10089078 Ga0207657_100890782 395
151 3300025920 Ga0207649_10058553 Ga0207649_100585532 395
152 3300025921 Ga0207652_10036556 Ga0207652_100365562 395
153 3300025924 Ga0207694_10049990 Ga0207694_100499903 395
154 3300025927 Ga0207687_10084852 Ga0207687_100848522 395
155 3300025941 Ga0207711_10104638 Ga0207711_101046381 395
156 3300025961 Ga0207712_10028174 Ga0207712_100281742 395
157 3300025986 Ga0207658_10084392 Ga0207658_100843922 395
158 3300026041 Ga0207639_10169386 Ga0207639_101693862 395
159 3300026088 Ga0207641_10030768 Ga0207641_100307682 395
160 3300026116 Ga0207674_10054845 Ga0207674_100548452 395
161 3300026142 Ga0207698_10123094 Ga0207698_101230941 395
162 3300028379 Ga0268266_10000510 Ga0268266_1000051019 395
163 3300028379 Ga0268266_10097658 Ga0268266_100976582 395
164 3300028800 Ga0265338_10000649 Ga0265338_1000064926 395
165 3300031238 Ga0265332_10018566 Ga0265332_100185662 395
166 3300031247 Ga0265340_10045343 Ga0265340_100453432 395
167 3300031249 Ga0265339_10039862 Ga0265339_100398621 395
168 3300031711 Ga0265314_10043519 Ga0265314_100435192 395
169 3300048924 Ga0496121_0005060 Ga0496121_0005060_10388_11575 395
170 3300049570 Ga0501033_0014011 Ga0501033_0014011_3232_4425 395
171 3300049570 Ga0501033_0046005 Ga0501033_0046005_1100_2287 395
172 3300049570 Ga0501033_0046142 Ga0501033_0046142_1226_2416 395
173 3300049572 Ga0501036_0047797 Ga0501036_0047797_1242_2429 395
174 3300049574 Ga0501038_0077690 Ga0501038_0077690_1010_2197 395
175 3300049579 Ga0501043_0006529 Ga0501043_0006529_6464_7651 395
176 3300049580 Ga0501046_0015086 Ga0501046_0015086_3177_4364 395
177 3300049580 Ga0501046_0019651 Ga0501046_0019651_2340_3590 395
178 3300049581 Ga0501047_0005391 Ga0501047_0005391_7472_8722 395
179 3300049581 Ga0501047_0010277 Ga0501047_0010277_1517_2704 395
180 3300049581 Ga0501047_0042782 Ga0501047_0042782_211_1404 395
181 3300049589 Ga0501073_0093551 Ga0501073_0093551_592_1836 395
182 3300049742 Ga0501080_0017179 Ga0501080_0017179_5310_6506 395
183 3300049822 Ga0501035_0033218 Ga0501035_0033218_2626_3819 395
184 3300049822 Ga0501035_0058796 Ga0501035_0058796_1132_2328 395
185 3300049822 Ga0501035_0072869 Ga0501035_0072869_1454_2641 395
186 3300049822 Ga0501035_0244255 Ga0501035_0244255_242_1432 395
187 3300049823 Ga0501044_0002060 Ga0501044_0002060_14254_15447 395
188 3300049823 Ga0501044_0036110 Ga0501044_0036110_2024_3211 395
189 3300049823 Ga0501044_0146498 Ga0501044_0146498_591_1826 395
190 3300053087 Ga0500643_000027 Ga0500643_000027_163163_164350 395
191 3300053136 Ga0500559_0026730 Ga0500559_0026730_170_1357 395
192 3300053139 Ga0500568_0047281 Ga0500568_0047281_474_1661 395
193 3300028577 Ga0265318_10001617 Ga0265318_1000161713 396
194 3300031238 Ga0265332_10015240 Ga0265332_100152402 396
195 3300031240 Ga0265320_10020307 Ga0265320_100203072 396
196 3300031241 Ga0265325_10002146 Ga0265325_100021466 396
197 3300031249 Ga0265339_10006221 Ga0265339_100062213 396
198 3300031250 Ga0265331_10030491 Ga0265331_100304911 396
199 3300031250 Ga0265331_10040204 Ga0265331_100402042 396
200 3300031250 Ga0265331_10074810 Ga0265331_100748101 396
201 3300031344 Ga0265316_10036393 Ga0265316_100363932 396
202 3300031595 Ga0265313_10006868 Ga0265313_100068683 396
203 3300031711 Ga0265314_10013126 Ga0265314_100131262 396
204 3300031711 Ga0265314_10021144 Ga0265314_100211444 396
205 3300031711 Ga0265314_10047892 Ga0265314_100478922 396
206 3300049580 Ga0501046_0020223 Ga0501046_0020223_2062_3252 396
207 3300049581 Ga0501047_0111658 Ga0501047_0111658_1008_2198 396
208 3300053119 Ga0500595_041721 Ga0500595_041721_49_1257 396
209 3300005563 Ga0068855_100009570 Ga0068855_1000095706 397
210 3300006175 Ga0070712_100006651 Ga0070712_1000066513 397
211 3300009093 Ga0105240_10141556 Ga0105240_101415562 397
212 3300009176 Ga0105242_10080497 Ga0105242_100804972 397
213 3300009545 Ga0105237_10130833 Ga0105237_101308332 397
214 3300009551 Ga0105238_10016469 Ga0105238_100164692 397
215 3300025913 Ga0207695_10010064 Ga0207695_100100646 397
216 3300025914 Ga0207671_10155294 Ga0207671_101552941 397
217 3300025919 Ga0207657_10018331 Ga0207657_100183315 397
218 3300025924 Ga0207694_10112955 Ga0207694_101129552 397
219 3300025949 Ga0207667_10148780 Ga0207667_101487802 397
220 3300053119 Ga0500595_011665 Ga0500595_011665_146_1369 398
221 3300005328 Ga0070676_10076137 Ga0070676_100761372 399
222 3300005331 Ga0070670_100147638 Ga0070670_1001476381 399
223 3300005334 Ga0068869_100005153 Ga0068869_1000051536 399
224 3300005338 Ga0068868_100028733 Ga0068868_1000287332 399
225 3300005456 Ga0070678_100003273 Ga0070678_1000032736 399
226 3300005456 Ga0070678_100016823 Ga0070678_1000168232 399
227 3300005459 Ga0068867_100010161 Ga0068867_1000101614 399
228 3300005543 Ga0070672_100065798 Ga0070672_1000657983 399
229 3300005548 Ga0070665_100390480 Ga0070665_1003904801 399
230 3300005614 Ga0068856_100160887 Ga0068856_1001608871 399
231 3300005615 Ga0070702_100084614 Ga0070702_1000846142 399
232 3300005718 Ga0068866_10018582 Ga0068866_100185822 399
233 3300006237 Ga0097621_100301194 Ga0097621_1003011941 399
234 3300006358 Ga0068871_100038858 Ga0068871_1000388582 399
235 3300006358 Ga0068871_100092527 Ga0068871_1000925272 399
236 3300006881 Ga0068865_100090367 Ga0068865_1000903672 399
237 3300009093 Ga0105240_10017096 Ga0105240_100170966 399
238 3300009176 Ga0105242_10052164 Ga0105242_100521641 399
239 3300009551 Ga0105238_10022027 Ga0105238_100220277 399
240 3300009551 Ga0105238_10055171 Ga0105238_100551712 399
241 3300013105 Ga0157369_10250220 Ga0157369_102502202 399
242 3300013306 Ga0163162_10102402 Ga0163162_101024022 399
243 3300013308 Ga0157375_10042186 Ga0157375_100421862 399
244 3300014325 Ga0163163_10000012 Ga0163163_10000012267 399
245 3300017792 Ga0163161_10015244 Ga0163161_100152442 399
246 3300025261 Ga0209233_1007043 Ga0209233_10070432 399
247 3300025913 Ga0207695_10106974 Ga0207695_101069742 399
248 3300025914 Ga0207671_10047583 Ga0207671_100475832 399
249 3300025924 Ga0207694_10025971 Ga0207694_100259713 399
250 3300025924 Ga0207694_10055134 Ga0207694_100551342 399
251 3300025925 Ga0207650_10135003 Ga0207650_101350032 399
252 3300025927 Ga0207687_10021879 Ga0207687_100218794 399
253 3300025934 Ga0207686_10016921 Ga0207686_100169212 399
254 3300025938 Ga0207704_10010537 Ga0207704_100105373 399
255 3300025940 Ga0207691_10131367 Ga0207691_101313672 399
256 3300025942 Ga0207689_10020216 Ga0207689_100202163 399
257 3300026078 Ga0207702_10315457 Ga0207702_103154571 399
258 3300026089 Ga0207648_10034240 Ga0207648_100342402 399
259 3300026121 Ga0207683_10004326 Ga0207683_100043263 399
260 3300028379 Ga0268266_10203284 Ga0268266_102032842 399
261 3300049570 Ga0501033_0007975 Ga0501033_0007975_6172_7380 399
262 3300049581 Ga0501047_0265802 Ga0501047_0265802_298_1542 399
263 3300053140 Ga0500573_0000032 Ga0500573_0000032_79554_80753 399
264 3300053142 Ga0500577_0067502 Ga0500577_0067502_81_1283 399
265 3300060353 Ga0501082_0079710 Ga0501082_0079710_379_1671 399
266 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035296 400
267 3300003322 rootL2_10067691 rootL2_100676911 400
268 3300025261 Ga0209233_1000006 Ga0209233_1000006785 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

65

407

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ezs-assembly1.cif.gz_B crystal structure of aminotransferase aspb (np_207418.1) from helicobacter pylori 26695 at 2.19 a resolution 0.9463 16 397
3jtx-assembly1.cif.gz_B crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution 0.9363 10 400
3jtx-assembly1.cif.gz_A crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution 0.929 4 400
3jtx-assembly1.cif.gz_B crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution 0.927 10 400
3jtx-assembly1.cif.gz_A crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution 0.9267 4 400
ID Description Score Start End Superfamily
3jtxA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9391 47 294 3.40.640.10
2douB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.938 64 294 3.40.640.10
af_Q58786_71_297_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9351 64 294 3.40.640.10
3jtxA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9316 47 294 3.40.640.10
2douB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9298 64 294 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A525NLI7-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9798 10 304 GO:0008483
GO:0009058
GO:0030170
AF-A0A6L5Z3W5-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.978 10 399 GO:0008483
GO:0009058
GO:0030170
AF-A0A3Q9TB63-F1-model_v4 deleted 0.9643 10 398
AF-A0A3D9HPT0-F1-model_v4 N-succinyldiaminopimelate aminotransferase 0.9625 9 399 GO:0008483
GO:0009058
GO:0030170
AF-A0A525NLI7-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9604 10 304 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
93.54 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map