F375290

General Info

Members Datasets Scaffolds Average Seq Length
268 158 536 135

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100327922|Ga0070680_1003279222
Length 140
Sequence MLLPMANRSLANVGGTPGGLGSFFMGFVMTCVGGYLISNQVSVVGSYWNSFGITLLPMLFGIGILFFSGRSTIGWLLTIGGALFILAGVIANMHIYFRPTSLFNTVVMLVLLVGGLGLIARSLRSHPASAQTEKEKSQSA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.1
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 41.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100327922 3300005336 Bacteria 1300
2 Ga0070683_100468559 3300005329 Bacteria 1203
3 Ga0070683_101476572 3300005329 Unclassified 653
4 Ga0070666_10519230 3300005335 Bacteria 864
5 Ga0070680_100240737 3300005336 Unclassified 1529
6 Ga0070680_101515893 3300005336 Unclassified 581
7 Ga0068868_100003243 3300005338 Bacteria 11322
8 Ga0070671_100031069 3300005355 Bacteria 4410
9 Ga0070714_101133337 3300005435 Bacteria 763
10 Ga0070713_101367356 3300005436 Bacteria 686
11 Ga0070662_101175499 3300005457 Bacteria 659
12 Ga0070681_10011400 3300005458 Bacteria 8797
13 Ga0070681_10818895 3300005458 Bacteria 848
14 Ga0070706_100206975 3300005467 Bacteria 1832
15 Ga0070698_100519049 3300005471 Bacteria 1130
16 Ga0070679_100044030 3300005530 Bacteria 4446
17 Ga0070684_100201350 3300005535 Bacteria 1813
18 Ga0070697_100589818 3300005536 Bacteria 976
19 Ga0068853_100052323 3300005539 Bacteria 3518
20 Ga0070693_100024278 3300005547 Unclassified 3249
21 Ga0070704_100758615 3300005549 Bacteria 864
22 Ga0070664_100499300 3300005564 Unclassified 1121
23 Ga0068854_100603492 3300005578 Unclassified 937
24 Ga0068856_100001026 3300005614 Bacteria 29725
25 Ga0068856_100224593 3300005614 Bacteria 1893
26 Ga0068852_100010280 3300005616 Bacteria 6982
27 Ga0068852_102167892 3300005616 Bacteria 577
28 Ga0068859_100668364 3300005617 Unclassified 1130
29 Ga0068864_100026812 3300005618 Bacteria 4860
30 Ga0068866_10115771 3300005718 Unclassified 1503
31 Ga0068861_101029331 3300005719 Bacteria 788
32 Ga0068863_100560871 3300005841 Unclassified 1128
33 Ga0068858_100024260 3300005842 Bacteria 5652
34 Ga0068858_100837316 3300005842 Bacteria 898
35 Ga0068858_101204965 3300005842 Unclassified 744
36 Ga0068860_100303975 3300005843 Unclassified 1563
37 Ga0070717_10005008 3300006028 Bacteria 9641
38 Ga0070717_10119002 3300006028 Bacteria 2261
39 Ga0070717_10125879 3300006028 Bacteria 2200
40 Ga0070717_10188342 3300006028 Unclassified 1802
41 Ga0070717_10192171 3300006028 Bacteria 1784
42 Ga0070717_10288410 3300006028 Bacteria 1457
43 Ga0070715_10180702 3300006163 Unclassified 1058
44 Ga0070712_100270207 3300006175 Unclassified 1365
45 Ga0070712_100605818 3300006175 Bacteria 927
46 Ga0070712_101256309 3300006175 Unclassified 645
47 Ga0097621_100000851 3300006237 Bacteria 21527
48 Ga0097621_100377385 3300006237 Unclassified 1266
49 Ga0068871_100002076 3300006358 Bacteria 13550
50 Ga0068871_101332968 3300006358 Bacteria 675
51 Ga0075428_100252496 3300006844 Bacteria 1900
52 Ga0075430_100111176 3300006846 Unclassified 2284
53 Ga0075434_100001058 3300006871 Bacteria 22461
54 Ga0075434_100045031 3300006871 Bacteria 4377
55 Ga0075429_100024079 3300006880 Bacteria 5280
56 Ga0075429_100317609 3300006880 Unclassified 1363
57 Ga0075436_100092150 3300006914 Bacteria 2107
58 Ga0097620_100668378 3300006931 Unclassified 1130
59 Ga0075435_100000625 3300007076 Bacteria 21720
60 Ga0075435_100008827 3300007076 Bacteria 7261
61 Ga0099794_10011336 3300007265 Unclassified 3813
62 Ga0105240_10001011 3300009093 Bacteria 50192
63 Ga0105240_10438349 3300009093 Unclassified 1464
64 Ga0105240_11775324 3300009093 Unclassified 643
65 Ga0105240_11897922 3300009093 Unclassified 620
66 Ga0105245_10047113 3300009098 Bacteria 3853
67 Ga0105247_10562188 3300009101 Unclassified 840
68 Ga0114129_10064020 3300009147 Bacteria 5131
69 Ga0114129_10119166 3300009147 Bacteria 3636
70 Ga0114129_10144138 3300009147 Unclassified 3264
71 Ga0114129_10206081 3300009147 Bacteria 2661
72 Ga0114129_10442716 3300009147 Unclassified 1705
73 Ga0114129_10856459 3300009147 Bacteria 1155
74 Ga0105243_10624937 3300009148 Bacteria 1040
75 Ga0105243_12002149 3300009148 Unclassified 614
76 Ga0105241_10158250 3300009174 Unclassified 1860
77 Ga0105241_10306313 3300009174 Unclassified 1365
78 Ga0105241_10424347 3300009174 Unclassified 1171
79 Ga0105241_10668468 3300009174 Bacteria 945
80 Ga0105242_10177415 3300009176 Unclassified 1877
81 Ga0105248_10015609 3300009177 Bacteria 8372
82 Ga0105248_10043269 3300009177 Bacteria 5050
83 Ga0105248_11372869 3300009177 Bacteria 799
84 Ga0105237_10118273 3300009545 Bacteria 2644
85 Ga0105237_11769143 3300009545 Bacteria 625
86 Ga0105237_12112487 3300009545 Unclassified 572
87 Ga0105238_10177971 3300009551 Unclassified 2104
88 Ga0105238_10317799 3300009551 Bacteria 1543
89 Ga0105238_10589464 3300009551 Bacteria 1119
90 Ga0105238_10656945 3300009551 Bacteria 1059
91 Ga0105238_10798717 3300009551 Unclassified 959
92 Ga0105238_10841841 3300009551 Bacteria 934
93 Ga0105238_11091018 3300009551 Unclassified 821
94 Ga0105239_10235751 3300010375 Bacteria 2054
95 Ga0157371_10105423 3300013102 Unclassified 2000
96 Ga0157370_10249480 3300013104 Unclassified 1642
97 Ga0157369_10783969 3300013105 Bacteria 980
98 Ga0157369_10803437 3300013105 Unclassified 966
99 Ga0157374_10000227 3300013296 Bacteria 52312
100 Ga0157374_10226583 3300013296 Bacteria 1835
101 Ga0157374_11268396 3300013296 Unclassified 759
102 Ga0157378_10002052 3300013297 Bacteria 18029
103 Ga0157378_10004446 3300013297 Bacteria 12330
104 Ga0157378_10546575 3300013297 Bacteria 1163
105 Ga0163162_12160635 3300013306 Unclassified 639
106 Ga0157372_10001093 3300013307 Bacteria 29481
107 Ga0157372_10963384 3300013307 Bacteria 989
108 Ga0157372_11651224 3300013307 Unclassified 737
109 Ga0157375_10719027 3300013308 Unclassified 1151
110 Ga0163163_11380359 3300014325 Unclassified 766
111 Ga0157379_10781460 3300014968 Bacteria 900
112 Ga0157379_12270691 3300014968 Unclassified 540
113 Ga0157376_10001152 3300014969 Bacteria 17369
114 Ga0157376_10014795 3300014969 Bacteria 5872
115 Ga0157376_10468382 3300014969 Bacteria 1232
116 Ga0157376_12179259 3300014969 Unclassified 593
117 Ga0224712_10198415 3300022467 Bacteria 911
118 Ga0207707_10055843 3300025912 Bacteria 3435
119 Ga0207707_10332784 3300025912 Unclassified 1310
120 Ga0207695_10312878 3300025913 Unclassified 1460
121 Ga0207671_10069913 3300025914 Bacteria 2616
122 Ga0207693_10478551 3300025915 Bacteria 972
123 Ga0207693_10703270 3300025915 Bacteria 783
124 Ga0207663_11135181 3300025916 Unclassified 628
125 Ga0207660_10344417 3300025917 Bacteria 1194
126 Ga0207660_11046134 3300025917 Unclassified 666
127 Ga0207652_10012559 3300025921 Bacteria 6846
128 Ga0207694_10044644 3300025924 Bacteria 3422
129 Ga0207694_10631779 3300025924 Unclassified 902
130 Ga0207700_10894170 3300025928 Bacteria 795
131 Ga0207664_10176783 3300025929 Bacteria 1831
132 Ga0207644_10039927 3300025931 Bacteria 3315
133 Ga0207686_10191005 3300025934 Unclassified 1460
134 Ga0207686_10304562 3300025934 Bacteria 1185
135 Ga0207686_10332995 3300025934 Unclassified 1138
136 Ga0207670_10479580 3300025936 Bacteria 1007
137 Ga0207711_10006604 3300025941 Bacteria 9769
138 Ga0207661_10467283 3300025944 Bacteria 1150
139 Ga0207661_11206401 3300025944 Unclassified 696
140 Ga0207667_10004719 3300025949 Bacteria 16684
141 Ga0207667_10039640 3300025949 Bacteria 5019
142 Ga0207640_10722014 3300025981 Unclassified 856
143 Ga0207677_10498605 3300026023 Unclassified 1052
144 Ga0207677_10515711 3300026023 Bacteria 1036
145 Ga0207703_10017043 3300026035 Bacteria 5665
146 Ga0207639_10121494 3300026041 Bacteria 2147
147 Ga0207702_10005248 3300026078 Bacteria 11376
148 Ga0207641_10750188 3300026088 Unclassified 963
149 Ga0207676_10088817 3300026095 Unclassified 2531
150 Ga0207698_10030531 3300026142 Bacteria 3877
151 Ga0207698_10241414 3300026142 Bacteria 1647
152 Ga0209588_1024536 3300027671 Unclassified 1904
153 Ga0265338_10177364 3300028800 Bacteria 1628
154 Ga0265338_10301132 3300028800 Bacteria 1165
155 Ga0265324_10013311 3300029957 Unclassified 3073
156 Ga0265328_10215759 3300031239 Bacteria 730
157 Ga0265320_10119514 3300031240 Bacteria 1202
158 Ga0265340_10030698 3300031247 Bacteria 2693
159 Ga0265340_10248617 3300031247 Unclassified 793
160 Ga0265339_10418771 3300031249 Unclassified 624
161 Ga0265331_10010959 3300031250 Unclassified 4980
162 Ga0265316_10036376 3300031344 Unclassified 3981
163 Ga0265316_10219541 3300031344 Unclassified 1403
164 Ga0307509_10486899 3300031507 Unclassified 920
165 Ga0265314_10198076 3300031711 Bacteria 1190
166 Ga0265342_10601203 3300031712 Bacteria 555
167 Ga0373926_0002010 3300035083 Bacteria 6389
168 Ga0373926_0011613 3300035083 Unclassified 2966
169 Ga0373944_0129372 3300035089 Unclassified 876
170 Ga0373923_0000538 3300035111 Bacteria 9220
171 Ga0373936_0155534 3300035113 Unclassified 993
172 Ga0373945_0002305 3300035116 Bacteria 5972
173 Ga0373953_0372799 3300035117 Bacteria 627
174 Ga0373953_0553129 3300035117 Unclassified 512
175 Ga0373956_0113384 3300035119 Bacteria 1263
176 Ga0373957_0084358 3300035120 Unclassified 1257
177 Ga0373943_0023579 3300035170 Unclassified 2863
178 Ga0373943_0027856 3300035170 Bacteria 2658
179 Ga0373943_0105579 3300035170 Unclassified 1479
180 Ga0373946_0069876 3300035171 Unclassified 1514
181 Ga0373946_0743670 3300035171 Unclassified 514
182 Ga0373924_0000694 3300035410 Bacteria 10480
183 Ga0373924_0122239 3300035410 Bacteria 1130
184 Ga0373935_0006538 3300035692 Bacteria 6962
185 Ga0373935_0433157 3300035692 Unclassified 948
186 Ga0373935_0772834 3300035692 Unclassified 708
187 Ga0373927_0002297 3300035695 Bacteria 13979
188 Ga0373927_0460979 3300035695 Unclassified 839
189 Ga0373927_0569435 3300035695 Unclassified 749
190 Ga0373927_0697337 3300035695 Bacteria 671
191 Ga0373927_1031528 3300035695 Unclassified 543
192 Ga0373947_0138849 3300035725 Bacteria 1557
193 Ga0373947_0147470 3300035725 Unclassified 1513
194 Ga0373947_0406891 3300035725 Unclassified 918
195 Ga0373947_0540846 3300035725 Bacteria 793
196 Ga0373947_0635254 3300035725 Unclassified 728
197 Ga0373937_0098995 3300036401 Bacteria 2705
198 Ga0373937_0894397 3300036401 Unclassified 837
199 Ga0373925_0000942 3300037068 Bacteria 26483
200 Ga0373925_0013447 3300037068 Bacteria 5924
201 Ga0373925_0019715 3300037068 Bacteria 4908
202 Ga0373925_0788140 3300037068 Bacteria 784
203 Ga0373925_0910875 3300037068 Unclassified 724
204 Ga0436364_0040779 3300037853 Bacteria 4877
205 Ga0436364_0511910 3300037853 Unclassified 1060
206 Ga0436364_0697909 3300037853 Unclassified 684
207 Ga0436365_0017314 3300039437 Unclassified 535
208 Ga0436365_1147510 3300039437 Bacteria 800
209 Ga0451853_3271196 3300041512 Unclassified 512
210 Ga0439446_0223262 3300042156 Unclassified 643
211 Ga0451576_1870080 3300045051 Unclassified 620
212 Ga0466958_0095742 3300045836 Bacteria 1841
213 Ga0495651_0336866 3300046462 Unclassified 1001
214 Ga0495651_0670841 3300046462 Unclassified 648
215 Ga0495580_0008381 3300046472 Bacteria 8223
216 Ga0495582_0227610 3300046473 Unclassified 1067
217 Ga0495639_0036895 3300046475 Unclassified 2190
218 Ga0495639_0120766 3300046475 Bacteria 1250
219 Ga0495639_0390357 3300046475 Unclassified 702
220 Ga0495608_0029682 3300046511 Bacteria 3707
221 Ga0495630_0030525 3300046517 Unclassified 4010
222 Ga0495652_0172659 3300046529 Bacteria 1667
223 Ga0495665_0015719 3300046531 Unclassified 4075
224 Ga0495665_0090154 3300046531 Unclassified 1611
225 Ga0495586_0377471 3300046535 Unclassified 815
226 Ga0495667_0025338 3300046559 Bacteria 3997
227 Ga0495667_0142347 3300046559 Bacteria 1545
228 Ga0495635_0126617 3300046663 Bacteria 1742
229 Ga0495623_0074078 3300046679 Bacteria 2116
230 Ga0495669_0008990 3300046684 Unclassified 4210
231 Ga0495581_0059104 3300047315 Bacteria 2215
232 Ga0495604_0047296 3300047317 Bacteria 3351
233 Ga0495604_0105683 3300047317 Bacteria 2060
234 Ga0495676_0256616 3300047321 Bacteria 1191
235 Ga0495680_0349774 3300047322 Bacteria 1029
236 Ga0495684_0000301 3300047471 Bacteria 40307
237 Ga0495593_0154789 3300047673 Unclassified 1159
238 Ga0496102_0284124 3300048905 Bacteria 1560
239 Ga0496102_0466482 3300048905 Bacteria 1184
240 Ga0496110_0149964 3300048913 Unclassified 2111
241 Ga0496110_0846697 3300048913 Unclassified 820
242 Ga0496110_0890396 3300048913 Unclassified 796
243 Ga0496111_0000542 3300048914 Bacteria 19525
244 Ga0496112_0012089 3300048915 Bacteria 7922
245 Ga0496112_0073322 3300048915 Bacteria 3384
246 Ga0496112_0369051 3300048915 Unclassified 1377
247 Ga0496113_0002351 3300048916 Bacteria 10948
248 Ga0496114_0906396 3300048917 Bacteria 763
249 nmdc:mga05p37_21519_c1 3300050507 Bacteria 7812
250 nmdc:mga05p37_694745_c1 3300050507 Bacteria 1131
251 nmdc:mga05p37_750505_c1 3300050507 Unclassified 1076
252 nmdc:mga09592_10140_c1 3300050508 Bacteria 7666
253 nmdc:mga09592_124081_c1 3300050508 Bacteria 2219
254 nmdc:mga09592_267882_c1 3300050508 Bacteria 1481
255 nmdc:mga06r32_269514_c1 3300050510 Unclassified 1690
256 nmdc:mga08y16_21773_c1 3300050511 Bacteria 6764
257 nmdc:mga0n895_189947_c1 3300050512 Bacteria 2085
258 nmdc:mga0n895_26190_c1 3300050512 Bacteria 5519
259 nmdc:mga0n895_26702_c1 3300050512 Bacteria 5474
260 nmdc:mga0rr50_642760_c1 3300050513 Unclassified 905
261 nmdc:mga0rr50_70364_c1 3300050513 Bacteria 2666
262 nmdc:mga0rr50_7295_c1 3300050513 Bacteria 6802
263 nmdc:mga08x19_2989_c1 3300050514 Bacteria 10156
264 nmdc:mga0a205_417779_c1 3300050515 Unclassified 1203
265 nmdc:mga0a205_73971_c1 3300050515 Unclassified 3292
266 Ga0495619_0474354 3300053085 Unclassified 862
267 Ga0587071_087030 3300060344 Bacteria 704
268 Ga0501082_0000242 3300060353 Bacteria 47791
269 Ga0070680_100327922
270 Ga0070683_100468559
271 Ga0070683_101476572
272 Ga0070666_10519230
273 Ga0070680_100240737
274 Ga0070680_101515893
275 Ga0068868_100003243
276 Ga0070671_100031069
277 Ga0070714_101133337
278 Ga0070713_101367356
279 Ga0070662_101175499
280 Ga0070681_10011400
281 Ga0070681_10818895
282 Ga0070706_100206975
283 Ga0070698_100519049
284 Ga0070679_100044030
285 Ga0070684_100201350
286 Ga0070697_100589818
287 Ga0068853_100052323
288 Ga0070693_100024278
289 Ga0070704_100758615
290 Ga0070664_100499300
291 Ga0068854_100603492
292 Ga0068856_100001026
293 Ga0068856_100224593
294 Ga0068852_100010280
295 Ga0068852_102167892
296 Ga0068859_100668364
297 Ga0068864_100026812
298 Ga0068866_10115771
299 Ga0068861_101029331
300 Ga0068863_100560871
301 Ga0068858_100024260
302 Ga0068858_100837316
303 Ga0068858_101204965
304 Ga0068860_100303975
305 Ga0070717_10005008
306 Ga0070717_10119002
307 Ga0070717_10125879
308 Ga0070717_10188342
309 Ga0070717_10192171
310 Ga0070717_10288410
311 Ga0070715_10180702
312 Ga0070712_100270207
313 Ga0070712_100605818
314 Ga0070712_101256309
315 Ga0097621_100000851
316 Ga0097621_100377385
317 Ga0068871_100002076
318 Ga0068871_101332968
319 Ga0075428_100252496
320 Ga0075430_100111176
321 Ga0075434_100001058
322 Ga0075434_100045031
323 Ga0075429_100024079
324 Ga0075429_100317609
325 Ga0075436_100092150
326 Ga0097620_100668378
327 Ga0075435_100000625
328 Ga0075435_100008827
329 Ga0099794_10011336
330 Ga0105240_10001011
331 Ga0105240_10438349
332 Ga0105240_11775324
333 Ga0105240_11897922
334 Ga0105245_10047113
335 Ga0105247_10562188
336 Ga0114129_10064020
337 Ga0114129_10119166
338 Ga0114129_10144138
339 Ga0114129_10206081
340 Ga0114129_10442716
341 Ga0114129_10856459
342 Ga0105243_10624937
343 Ga0105243_12002149
344 Ga0105241_10158250
345 Ga0105241_10306313
346 Ga0105241_10424347
347 Ga0105241_10668468
348 Ga0105242_10177415
349 Ga0105248_10015609
350 Ga0105248_10043269
351 Ga0105248_11372869
352 Ga0105237_10118273
353 Ga0105237_11769143
354 Ga0105237_12112487
355 Ga0105238_10177971
356 Ga0105238_10317799
357 Ga0105238_10589464
358 Ga0105238_10656945
359 Ga0105238_10798717
360 Ga0105238_10841841
361 Ga0105238_11091018
362 Ga0105239_10235751
363 Ga0157371_10105423
364 Ga0157370_10249480
365 Ga0157369_10783969
366 Ga0157369_10803437
367 Ga0157374_10000227
368 Ga0157374_10226583
369 Ga0157374_11268396
370 Ga0157378_10002052
371 Ga0157378_10004446
372 Ga0157378_10546575
373 Ga0163162_12160635
374 Ga0157372_10001093
375 Ga0157372_10963384
376 Ga0157372_11651224
377 Ga0157375_10719027
378 Ga0163163_11380359
379 Ga0157379_10781460
380 Ga0157379_12270691
381 Ga0157376_10001152
382 Ga0157376_10014795
383 Ga0157376_10468382
384 Ga0157376_12179259
385 Ga0224712_10198415
386 Ga0207707_10055843
387 Ga0207707_10332784
388 Ga0207695_10312878
389 Ga0207671_10069913
390 Ga0207693_10478551
391 Ga0207693_10703270
392 Ga0207663_11135181
393 Ga0207660_10344417
394 Ga0207660_11046134
395 Ga0207652_10012559
396 Ga0207694_10044644
397 Ga0207694_10631779
398 Ga0207700_10894170
399 Ga0207664_10176783
400 Ga0207644_10039927
401 Ga0207686_10191005
402 Ga0207686_10304562
403 Ga0207686_10332995
404 Ga0207670_10479580
405 Ga0207711_10006604
406 Ga0207661_10467283
407 Ga0207661_11206401
408 Ga0207667_10004719
409 Ga0207667_10039640
410 Ga0207640_10722014
411 Ga0207677_10498605
412 Ga0207677_10515711
413 Ga0207703_10017043
414 Ga0207639_10121494
415 Ga0207702_10005248
416 Ga0207641_10750188
417 Ga0207676_10088817
418 Ga0207698_10030531
419 Ga0207698_10241414
420 Ga0209588_1024536
421 Ga0265338_10177364
422 Ga0265338_10301132
423 Ga0265324_10013311
424 Ga0265328_10215759
425 Ga0265320_10119514
426 Ga0265340_10030698
427 Ga0265340_10248617
428 Ga0265339_10418771
429 Ga0265331_10010959
430 Ga0265316_10036376
431 Ga0265316_10219541
432 Ga0307509_10486899
433 Ga0265314_10198076
434 Ga0265342_10601203
435 Ga0373926_0002010
436 Ga0373926_0011613
437 Ga0373944_0129372
438 Ga0373923_0000538
439 Ga0373936_0155534
440 Ga0373945_0002305
441 Ga0373953_0372799
442 Ga0373953_0553129
443 Ga0373956_0113384
444 Ga0373957_0084358
445 Ga0373943_0023579
446 Ga0373943_0027856
447 Ga0373943_0105579
448 Ga0373946_0069876
449 Ga0373946_0743670
450 Ga0373924_0000694
451 Ga0373924_0122239
452 Ga0373935_0006538
453 Ga0373935_0433157
454 Ga0373935_0772834
455 Ga0373927_0002297
456 Ga0373927_0460979
457 Ga0373927_0569435
458 Ga0373927_0697337
459 Ga0373927_1031528
460 Ga0373947_0138849
461 Ga0373947_0147470
462 Ga0373947_0406891
463 Ga0373947_0540846
464 Ga0373947_0635254
465 Ga0373937_0098995
466 Ga0373937_0894397
467 Ga0373925_0000942
468 Ga0373925_0013447
469 Ga0373925_0019715
470 Ga0373925_0788140
471 Ga0373925_0910875
472 Ga0436364_0040779
473 Ga0436364_0511910
474 Ga0436364_0697909
475 Ga0436365_0017314
476 Ga0436365_1147510
477 Ga0451853_3271196
478 Ga0439446_0223262
479 Ga0451576_1870080
480 Ga0466958_0095742
481 Ga0495651_0336866
482 Ga0495651_0670841
483 Ga0495580_0008381
484 Ga0495582_0227610
485 Ga0495639_0036895
486 Ga0495639_0120766
487 Ga0495639_0390357
488 Ga0495608_0029682
489 Ga0495630_0030525
490 Ga0495652_0172659
491 Ga0495665_0015719
492 Ga0495665_0090154
493 Ga0495586_0377471
494 Ga0495667_0025338
495 Ga0495667_0142347
496 Ga0495635_0126617
497 Ga0495623_0074078
498 Ga0495669_0008990
499 Ga0495581_0059104
500 Ga0495604_0047296
501 Ga0495604_0105683
502 Ga0495676_0256616
503 Ga0495680_0349774
504 Ga0495684_0000301
505 Ga0495593_0154789
506 Ga0496102_0284124
507 Ga0496102_0466482
508 Ga0496110_0149964
509 Ga0496110_0846697
510 Ga0496110_0890396
511 Ga0496111_0000542
512 Ga0496112_0012089
513 Ga0496112_0073322
514 Ga0496112_0369051
515 Ga0496113_0002351
516 Ga0496114_0906396
517 nmdc:mga05p37_21519_c1
518 nmdc:mga05p37_694745_c1
519 nmdc:mga05p37_750505_c1
520 nmdc:mga09592_10140_c1
521 nmdc:mga09592_124081_c1
522 nmdc:mga09592_267882_c1
523 nmdc:mga06r32_269514_c1
524 nmdc:mga08y16_21773_c1
525 nmdc:mga0n895_189947_c1
526 nmdc:mga0n895_26190_c1
527 nmdc:mga0n895_26702_c1
528 nmdc:mga0rr50_642760_c1
529 nmdc:mga0rr50_70364_c1
530 nmdc:mga0rr50_7295_c1
531 nmdc:mga08x19_2989_c1
532 nmdc:mga0a205_417779_c1
533 nmdc:mga0a205_73971_c1
534 Ga0495619_0474354
535 Ga0587071_087030
536 Ga0501082_0000242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map