F375283

General Info

Members Datasets Scaffolds Average Seq Length
268 166 536 326

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10111303|Ga0070677_101113031
Length 373
Sequence MERIAPIGSIGILCRFFNNRGPVTAITPRRGSKPRHRLKRDMNQAKRNSVWVAASLVLLALLGCNKASKEGAGTAEGKVVKIAFVTNNASQFWKIAEAGLRKYEKEAKVQVDMKMPPNGTPEDQNQILQNLASQGYDAIAVSVIAPKDQLRILNEVAEKTNLITFDSDAEKSKRLLYIGTNNFAAGQALGERIVKLLPDGGRIAVFVGMLSTDNAAQRLGGIEAALKGHKIEIVDKREDNTDRAKARSNVEDIINSHKDLSLVVGLWNYNGPAIAAAIEGLGKQGKIKAAVFDEDDATLDAIKAGTIDATVVQKPFQFGYLSAKWMHDLATKKEEAKKALPPSGVIDTGVTVIDKSNVESFRAELREMKKSVQ

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
140 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 3.36
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 4.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10111303 3300005333 Unclassified 1223
2 Ga0006759J45824_1038894 3300003163 Bacteria 1299
3 Ga0006759J45824_1044504 3300003163 Bacteria 1594
4 rootH2_10057364 3300003320 Bacteria 3027
5 Ga0032354_1067582 3300003693 Bacteria 1910
6 Ga0070658_10050997 3300005327 Unclassified 3353
7 Ga0070676_10011820 3300005328 Bacteria 4753
8 Ga0070676_10212971 3300005328 Bacteria 1272
9 Ga0070683_100287923 3300005329 Bacteria 1563
10 Ga0070683_100379573 3300005329 Unclassified 1347
11 Ga0070683_100443414 3300005329 Bacteria 1239
12 Ga0070690_100006554 3300005330 Bacteria 6609
13 Ga0070690_100006950 3300005330 Bacteria 6441
14 Ga0070690_100059124 3300005330 Bacteria 2463
15 Ga0070670_100044831 3300005331 Bacteria 3802
16 Ga0070670_100168061 3300005331 Bacteria 1902
17 Ga0070680_100006818 3300005336 Bacteria 8703
18 Ga0070682_100001475 3300005337 Bacteria 13184
19 Ga0070682_100009479 3300005337 Bacteria 5510
20 Ga0070682_100010056 3300005337 Bacteria 5361
21 Ga0070682_100151123 3300005337 Bacteria 1593
22 Ga0070682_100270458 3300005337 Bacteria 1234
23 Ga0070689_100000004 3300005340 Bacteria 497771
24 Ga0070689_100003206 3300005340 Bacteria 10839
25 Ga0070689_100034069 3300005340 Bacteria 3884
26 Ga0070689_100059622 3300005340 Bacteria 2966
27 Ga0070691_10012261 3300005341 Bacteria 3923
28 Ga0070691_10117128 3300005341 Bacteria 1338
29 Ga0070687_100009961 3300005343 Bacteria 4090
30 Ga0070687_100083791 3300005343 Bacteria 1746
31 Ga0070668_100173730 3300005347 Bacteria 1755
32 Ga0070669_100017771 3300005353 Bacteria 5075
33 Ga0070669_100028286 3300005353 Bacteria 4037
34 Ga0070675_100111031 3300005354 Bacteria 2320
35 Ga0070675_100127368 3300005354 Bacteria 2167
36 Ga0070675_100318760 3300005354 Bacteria 1373
37 Ga0070673_100009036 3300005364 Bacteria 6673
38 Ga0070673_100048542 3300005364 Bacteria 3310
39 Ga0070673_100053743 3300005364 Bacteria 3165
40 Ga0070673_100065771 3300005364 Bacteria 2893
41 Ga0070673_100078582 3300005364 Bacteria 2670
42 Ga0070688_100022833 3300005365 Bacteria 3672
43 Ga0070688_100054319 3300005365 Bacteria 2508
44 Ga0070688_100074792 3300005365 Bacteria 2176
45 Ga0070659_100190597 3300005366 Bacteria 1685
46 Ga0070659_100191582 3300005366 Bacteria 1681
47 Ga0070667_100259201 3300005367 Bacteria 1556
48 Ga0070713_100253228 3300005436 Bacteria 1607
49 Ga0070705_100066661 3300005440 Bacteria 2159
50 Ga0070700_100029256 3300005441 Bacteria 3283
51 Ga0070663_100034520 3300005455 Bacteria 3504
52 Ga0070678_100022205 3300005456 Bacteria 4199
53 Ga0070662_100022847 3300005457 Bacteria 4288
54 Ga0070681_10334155 3300005458 Bacteria 1425
55 Ga0068867_100014043 3300005459 Bacteria 5673
56 Ga0070685_10053263 3300005466 Bacteria 2344
57 Ga0070685_10137583 3300005466 Bacteria 1534
58 Ga0070679_100023431 3300005530 Bacteria 6042
59 Ga0070679_100281904 3300005530 Bacteria 1614
60 Ga0070684_100100891 3300005535 Bacteria 2578
61 Ga0068853_100000566 3300005539 Bacteria 25338
62 Ga0070672_100024945 3300005543 Bacteria 4427
63 Ga0070672_100031808 3300005543 Bacteria 3976
64 Ga0070672_100378343 3300005543 Unclassified 1211
65 Ga0070686_100007968 3300005544 Bacteria 5922
66 Ga0070686_100007977 3300005544 Bacteria 5919
67 Ga0070686_100012842 3300005544 Bacteria 4781
68 Ga0070686_100017176 3300005544 Bacteria 4224
69 Ga0070665_100523822 3300005548 Bacteria 1197
70 Ga0070704_100322403 3300005549 Bacteria 1295
71 Ga0068855_100000150 3300005563 Bacteria 88674
72 Ga0068855_100000505 3300005563 Bacteria 48258
73 Ga0068855_100023052 3300005563 Bacteria 7461
74 Ga0068855_100025909 3300005563 Bacteria 7014
75 Ga0068856_100304074 3300005614 Bacteria 1613
76 Ga0070702_100064654 3300005615 Bacteria 2141
77 Ga0068852_100256282 3300005616 Bacteria 1678
78 Ga0068859_100269541 3300005617 Bacteria 1794
79 Ga0068866_10051835 3300005718 Bacteria 2091
80 Ga0068863_100065378 3300005841 Bacteria 3441
81 Ga0068858_100033567 3300005842 Bacteria 4760
82 Ga0068858_100176934 3300005842 Bacteria 2013
83 Ga0068860_100039627 3300005843 Bacteria 4506
84 Ga0068862_100062020 3300005844 Bacteria 3215
85 Ga0070717_10112389 3300006028 Bacteria 2325
86 Ga0075367_10041120 3300006178 Bacteria 2702
87 Ga0075366_10016857 3300006195 Bacteria 4199
88 Ga0097621_100174324 3300006237 Unclassified 1856
89 Ga0097621_100348664 3300006237 Bacteria 1316
90 Ga0068865_100044804 3300006881 Bacteria 3030
91 Ga0097620_100269542 3300006931 Bacteria 1794
92 Ga0105240_10001976 3300009093 Bacteria 33906
93 Ga0111539_10142696 3300009094 Bacteria 2803
94 Ga0111539_10152400 3300009094 Bacteria 2705
95 Ga0105245_10405508 3300009098 Bacteria 1363
96 Ga0105242_10138716 3300009176 Bacteria 2107
97 Ga0105237_10000114 3300009545 Bacteria 113057
98 Ga0105237_10121350 3300009545 Bacteria 2608
99 Ga0105238_10003189 3300009551 Bacteria 16364
100 Ga0105238_10005079 3300009551 Bacteria 13010
101 Ga0105238_10023005 3300009551 Bacteria 6354
102 Ga0105249_10036696 3300009553 Bacteria 4446
103 Ga0105249_10089639 3300009553 Bacteria 2874
104 Ga0105239_10158060 3300010375 Bacteria 2532
105 Ga0105239_10563543 3300010375 Bacteria 1298
106 Ga0157374_10291950 3300013296 Bacteria 1612
107 Ga0157378_10031125 3300013297 Bacteria 4712
108 Ga0157378_10035177 3300013297 Bacteria 4430
109 Ga0157375_10394028 3300013308 Unclassified 1551
110 Ga0163163_10019726 3300014325 Bacteria 6338
111 Ga0157380_10066565 3300014326 Bacteria 2898
112 Ga0157376_10032217 3300014969 Bacteria 4206
113 Ga0213876_10055743 3300021384 Bacteria 2087
114 Ga0207666_1004774 3300025271 Bacteria 1711
115 Ga0207642_10138262 3300025899 Unclassified 1281
116 Ga0207647_10070801 3300025904 Bacteria 2105
117 Ga0207645_10001555 3300025907 Bacteria 18778
118 Ga0207705_10149681 3300025909 Bacteria 1748
119 Ga0207707_10038318 3300025912 Bacteria 4189
120 Ga0207707_10320508 3300025912 Unclassified 1338
121 Ga0207695_10001316 3300025913 Bacteria 42089
122 Ga0207671_10003506 3300025914 Bacteria 15586
123 Ga0207663_10089146 3300025916 Bacteria 2042
124 Ga0207660_10127793 3300025917 Bacteria 1932
125 Ga0207662_10010355 3300025918 Bacteria 5147
126 Ga0207662_10022033 3300025918 Bacteria 3647
127 Ga0207662_10101501 3300025918 Bacteria 1783
128 Ga0207652_10007395 3300025921 Bacteria 8855
129 Ga0207681_10000571 3300025923 Bacteria 25110
130 Ga0207681_10000735 3300025923 Bacteria 21456
131 Ga0207694_10013377 3300025924 Bacteria 6180
132 Ga0207694_10036881 3300025924 Bacteria 3752
133 Ga0207650_10082536 3300025925 Bacteria 2440
134 Ga0207659_10024659 3300025926 Bacteria 4033
135 Ga0207659_10208441 3300025926 Bacteria 1565
136 Ga0207690_10194040 3300025932 Bacteria 1538
137 Ga0207690_10195809 3300025932 Bacteria 1531
138 Ga0207706_10041979 3300025933 Bacteria 4053
139 Ga0207706_10427292 3300025933 Bacteria 1147
140 Ga0207709_10247527 3300025935 Bacteria 1300
141 Ga0207670_10000007 3300025936 Bacteria 376171
142 Ga0207670_10055431 3300025936 Bacteria 2679
143 Ga0207670_10087692 3300025936 Bacteria 2193
144 Ga0207670_10115944 3300025936 Bacteria 1938
145 Ga0207669_10002260 3300025937 Bacteria 8192
146 Ga0207669_10004591 3300025937 Bacteria 6094
147 Ga0207704_10023188 3300025938 Bacteria 3341
148 Ga0207691_10010373 3300025940 Bacteria 8937
149 Ga0207691_10053132 3300025940 Bacteria 3699
150 Ga0207661_10117903 3300025944 Bacteria 2256
151 Ga0207667_10001892 3300025949 Bacteria 26289
152 Ga0207667_10019846 3300025949 Bacteria 7490
153 Ga0207667_10075873 3300025949 Bacteria 3489
154 Ga0207651_10002159 3300025960 Bacteria 9304
155 Ga0207651_10006591 3300025960 Bacteria 6098
156 Ga0207651_10133761 3300025960 Bacteria 1903
157 Ga0207651_10159960 3300025960 Bacteria 1764
158 Ga0207668_10025933 3300025972 Bacteria 3800
159 Ga0207703_10138944 3300026035 Bacteria 2106
160 Ga0207639_10003068 3300026041 Bacteria 11237
161 Ga0207639_10100757 3300026041 Bacteria 2334
162 Ga0207678_10007930 3300026067 Bacteria 9362
163 Ga0207708_10000754 3300026075 Bacteria 24241
164 Ga0207702_10034492 3300026078 Bacteria 4231
165 Ga0207702_10136342 3300026078 Bacteria 2215
166 Ga0207702_10348966 3300026078 Bacteria 1415
167 Ga0207641_10083452 3300026088 Bacteria 2779
168 Ga0207648_10062107 3300026089 Bacteria 3258
169 Ga0207676_10500943 3300026095 Bacteria 1153
170 Ga0207675_100015979 3300026118 Bacteria 7006
171 Ga0207675_100213683 3300026118 Bacteria 1856
172 Ga0207683_10210606 3300026121 Unclassified 1769
173 Ga0207683_10276513 3300026121 Bacteria 1534
174 Ga0209998_10009161 3300027717 Bacteria 2053
175 Ga0207428_10009329 3300027907 Bacteria 8801
176 Ga0268264_10023161 3300028381 Bacteria 5068
177 Ga0265326_10030654 3300028558 Bacteria 1532
178 Ga0265319_1006440 3300028563 Bacteria 5436
179 Ga0265334_10015737 3300028573 Bacteria 3139
180 Ga0265334_10044549 3300028573 Bacteria 1722
181 Ga0265318_10000042 3300028577 Bacteria 130384
182 Ga0265318_10000357 3300028577 Bacteria 36336
183 Ga0265338_10002021 3300028800 Bacteria 31454
184 Ga0265330_10000026 3300031235 Bacteria 140332
185 Ga0265330_10011299 3300031235 Bacteria 4193
186 Ga0265332_10000257 3300031238 Bacteria 42299
187 Ga0265332_10001456 3300031238 Bacteria 13266
188 Ga0265332_10056607 3300031238 Bacteria 1680
189 Ga0265332_10078275 3300031238 Unclassified 1404
190 Ga0265328_10000525 3300031239 Bacteria 17862
191 Ga0265328_10001203 3300031239 Bacteria 11993
192 Ga0265320_10000079 3300031240 Bacteria 83732
193 Ga0265320_10001874 3300031240 Bacteria 14880
194 Ga0265320_10002220 3300031240 Bacteria 13624
195 Ga0265320_10004287 3300031240 Bacteria 9375
196 Ga0265329_10002890 3300031242 Bacteria 7638
197 Ga0265339_10009126 3300031249 Bacteria 6262
198 Ga0265331_10000010 3300031250 Bacteria 312076
199 Ga0265331_10003046 3300031250 Bacteria 11000
200 Ga0265316_10002787 3300031344 Bacteria 17911
201 Ga0265316_10011412 3300031344 Bacteria 8016
202 Ga0265313_10000814 3300031595 Bacteria 31531
203 Ga0265313_10032115 3300031595 Bacteria 2685
204 Ga0307508_10001496 3300031616 Bacteria 26212
205 Ga0307508_10010183 3300031616 Bacteria 8604
206 Ga0265314_10000035 3300031711 Bacteria 240629
207 Ga0265314_10002672 3300031711 Bacteria 17875
208 Ga0265314_10010664 3300031711 Bacteria 7646
209 Ga0265314_10053694 3300031711 Bacteria 2794
210 Ga0265342_10000274 3300031712 Bacteria 57923
211 Ga0265342_10001303 3300031712 Bacteria 23402
212 Ga0265342_10002182 3300031712 Bacteria 17209
213 Ga0265342_10002451 3300031712 Bacteria 15995
214 Ga0373934_0026138 3300035086 Bacteria 2264
215 Ga0373945_0051624 3300035116 Bacteria 1513
216 Ga0373954_0007241 3300035118 Bacteria 4848
217 Ga0373956_0053890 3300035119 Bacteria 1811
218 Ga0373943_0092037 3300035170 Bacteria 1572
219 Ga0373955_0016861 3300035172 Bacteria 3603
220 Ga0373955_0031861 3300035172 Bacteria 2763
221 Ga0373924_0026196 3300035410 Bacteria 2311
222 Ga0373935_0069862 3300035692 Bacteria 2263
223 Ga0373935_0186671 3300035692 Bacteria 1426
224 Ga0373947_0051340 3300035725 Bacteria 2481
225 Ga0373947_0151689 3300035725 Bacteria 1493
226 Ga0373937_0000511 3300036401 Bacteria 35044
227 Ga0373937_0056151 3300036401 Bacteria 3615
228 Ga0373937_0157027 3300036401 Bacteria 2132
229 Ga0373925_0037112 3300037068 Bacteria 3596
230 Ga0373925_0104422 3300037068 Bacteria 2182
231 Ga0436365_1208785 3300039437 Bacteria 2816
232 Ga0436365_1522242 3300039437 Bacteria 5500
233 Ga0451807_0322474 3300041486 Bacteria 3150
234 Ga0451837_1293527 3300041494 Bacteria 1175
235 Ga0451849_1005054 3300041505 Bacteria 1345
236 Ga0451853_0090135 3300041512 Bacteria 32137
237 Ga0466967_0076980 3300045976 Bacteria 3002
238 Ga0495641_0036790 3300046461 Bacteria 2298
239 Ga0495651_0150242 3300046462 Bacteria 1680
240 Ga0495630_0013945 3300046517 Bacteria 5847
241 Ga0495634_0001418 3300046642 Bacteria 21402
242 Ga0495634_0052535 3300046642 Bacteria 2731
243 Ga0495674_0001307 3300047319 Bacteria 24226
244 Ga0495674_0145196 3300047319 Unclassified 1992
245 Ga0495680_0063174 3300047322 Bacteria 2844
246 Ga0496100_0003915 3300048903 Bacteria 7824
247 Ga0496100_0003921 3300048903 Bacteria 7818
248 Ga0496101_0012586 3300048904 Bacteria 5650
249 Ga0496105_0320168 3300048908 Bacteria 1243
250 Ga0496112_0110892 3300048915 Bacteria 2713
251 Ga0496114_0000157 3300048917 Bacteria 48126
252 Ga0496114_0001056 3300048917 Bacteria 20708
253 Ga0496115_0325757 3300048918 Bacteria 1256
254 Ga0501308_006787 3300049128 Bacteria 1182
255 Ga0501047_0080086 3300049581 Bacteria 3140
256 Ga0501067_0028970 3300049583 Bacteria 3069
257 Ga0501073_0003025 3300049589 Bacteria 12606
258 Ga0501073_0005452 3300049589 Bacteria 9532
259 Ga0501077_0098373 3300049593 Bacteria 1854
260 nmdc:mga0k408_11417_c1 3300050493 Bacteria 4837
261 nmdc:mga06z11_114441_c1 3300050494 Bacteria 1497
262 nmdc:mga08y16_1005_c1 3300050511 Bacteria 27559
263 nmdc:mga08y16_13931_c1 3300050511 Bacteria 8463
264 Ga0495619_0141647 3300053085 Bacteria 1656
265 Ga0495619_0223566 3300053085 Bacteria 1304
266 Ga0500552_007912 3300053733 Bacteria 1241
267 Ga0501084_0091597 3300054114 Bacteria 2552
268 Ga0501082_0217349 3300060353 Bacteria 1663
269 Ga0070677_10111303
270 Ga0006759J45824_1038894
271 Ga0006759J45824_1044504
272 rootH2_10057364
273 Ga0032354_1067582
274 Ga0070658_10050997
275 Ga0070676_10011820
276 Ga0070676_10212971
277 Ga0070683_100287923
278 Ga0070683_100379573
279 Ga0070683_100443414
280 Ga0070690_100006554
281 Ga0070690_100006950
282 Ga0070690_100059124
283 Ga0070670_100044831
284 Ga0070670_100168061
285 Ga0070680_100006818
286 Ga0070682_100001475
287 Ga0070682_100009479
288 Ga0070682_100010056
289 Ga0070682_100151123
290 Ga0070682_100270458
291 Ga0070689_100000004
292 Ga0070689_100003206
293 Ga0070689_100034069
294 Ga0070689_100059622
295 Ga0070691_10012261
296 Ga0070691_10117128
297 Ga0070687_100009961
298 Ga0070687_100083791
299 Ga0070668_100173730
300 Ga0070669_100017771
301 Ga0070669_100028286
302 Ga0070675_100111031
303 Ga0070675_100127368
304 Ga0070675_100318760
305 Ga0070673_100009036
306 Ga0070673_100048542
307 Ga0070673_100053743
308 Ga0070673_100065771
309 Ga0070673_100078582
310 Ga0070688_100022833
311 Ga0070688_100054319
312 Ga0070688_100074792
313 Ga0070659_100190597
314 Ga0070659_100191582
315 Ga0070667_100259201
316 Ga0070713_100253228
317 Ga0070705_100066661
318 Ga0070700_100029256
319 Ga0070663_100034520
320 Ga0070678_100022205
321 Ga0070662_100022847
322 Ga0070681_10334155
323 Ga0068867_100014043
324 Ga0070685_10053263
325 Ga0070685_10137583
326 Ga0070679_100023431
327 Ga0070679_100281904
328 Ga0070684_100100891
329 Ga0068853_100000566
330 Ga0070672_100024945
331 Ga0070672_100031808
332 Ga0070672_100378343
333 Ga0070686_100007968
334 Ga0070686_100007977
335 Ga0070686_100012842
336 Ga0070686_100017176
337 Ga0070665_100523822
338 Ga0070704_100322403
339 Ga0068855_100000150
340 Ga0068855_100000505
341 Ga0068855_100023052
342 Ga0068855_100025909
343 Ga0068856_100304074
344 Ga0070702_100064654
345 Ga0068852_100256282
346 Ga0068859_100269541
347 Ga0068866_10051835
348 Ga0068863_100065378
349 Ga0068858_100033567
350 Ga0068858_100176934
351 Ga0068860_100039627
352 Ga0068862_100062020
353 Ga0070717_10112389
354 Ga0075367_10041120
355 Ga0075366_10016857
356 Ga0097621_100174324
357 Ga0097621_100348664
358 Ga0068865_100044804
359 Ga0097620_100269542
360 Ga0105240_10001976
361 Ga0111539_10142696
362 Ga0111539_10152400
363 Ga0105245_10405508
364 Ga0105242_10138716
365 Ga0105237_10000114
366 Ga0105237_10121350
367 Ga0105238_10003189
368 Ga0105238_10005079
369 Ga0105238_10023005
370 Ga0105249_10036696
371 Ga0105249_10089639
372 Ga0105239_10158060
373 Ga0105239_10563543
374 Ga0157374_10291950
375 Ga0157378_10031125
376 Ga0157378_10035177
377 Ga0157375_10394028
378 Ga0163163_10019726
379 Ga0157380_10066565
380 Ga0157376_10032217
381 Ga0213876_10055743
382 Ga0207666_1004774
383 Ga0207642_10138262
384 Ga0207647_10070801
385 Ga0207645_10001555
386 Ga0207705_10149681
387 Ga0207707_10038318
388 Ga0207707_10320508
389 Ga0207695_10001316
390 Ga0207671_10003506
391 Ga0207663_10089146
392 Ga0207660_10127793
393 Ga0207662_10010355
394 Ga0207662_10022033
395 Ga0207662_10101501
396 Ga0207652_10007395
397 Ga0207681_10000571
398 Ga0207681_10000735
399 Ga0207694_10013377
400 Ga0207694_10036881
401 Ga0207650_10082536
402 Ga0207659_10024659
403 Ga0207659_10208441
404 Ga0207690_10194040
405 Ga0207690_10195809
406 Ga0207706_10041979
407 Ga0207706_10427292
408 Ga0207709_10247527
409 Ga0207670_10000007
410 Ga0207670_10055431
411 Ga0207670_10087692
412 Ga0207670_10115944
413 Ga0207669_10002260
414 Ga0207669_10004591
415 Ga0207704_10023188
416 Ga0207691_10010373
417 Ga0207691_10053132
418 Ga0207661_10117903
419 Ga0207667_10001892
420 Ga0207667_10019846
421 Ga0207667_10075873
422 Ga0207651_10002159
423 Ga0207651_10006591
424 Ga0207651_10133761
425 Ga0207651_10159960
426 Ga0207668_10025933
427 Ga0207703_10138944
428 Ga0207639_10003068
429 Ga0207639_10100757
430 Ga0207678_10007930
431 Ga0207708_10000754
432 Ga0207702_10034492
433 Ga0207702_10136342
434 Ga0207702_10348966
435 Ga0207641_10083452
436 Ga0207648_10062107
437 Ga0207676_10500943
438 Ga0207675_100015979
439 Ga0207675_100213683
440 Ga0207683_10210606
441 Ga0207683_10276513
442 Ga0209998_10009161
443 Ga0207428_10009329
444 Ga0268264_10023161
445 Ga0265326_10030654
446 Ga0265319_1006440
447 Ga0265334_10015737
448 Ga0265334_10044549
449 Ga0265318_10000042
450 Ga0265318_10000357
451 Ga0265338_10002021
452 Ga0265330_10000026
453 Ga0265330_10011299
454 Ga0265332_10000257
455 Ga0265332_10001456
456 Ga0265332_10056607
457 Ga0265332_10078275
458 Ga0265328_10000525
459 Ga0265328_10001203
460 Ga0265320_10000079
461 Ga0265320_10001874
462 Ga0265320_10002220
463 Ga0265320_10004287
464 Ga0265329_10002890
465 Ga0265339_10009126
466 Ga0265331_10000010
467 Ga0265331_10003046
468 Ga0265316_10002787
469 Ga0265316_10011412
470 Ga0265313_10000814
471 Ga0265313_10032115
472 Ga0307508_10001496
473 Ga0307508_10010183
474 Ga0265314_10000035
475 Ga0265314_10002672
476 Ga0265314_10010664
477 Ga0265314_10053694
478 Ga0265342_10000274
479 Ga0265342_10001303
480 Ga0265342_10002182
481 Ga0265342_10002451
482 Ga0373934_0026138
483 Ga0373945_0051624
484 Ga0373954_0007241
485 Ga0373956_0053890
486 Ga0373943_0092037
487 Ga0373955_0016861
488 Ga0373955_0031861
489 Ga0373924_0026196
490 Ga0373935_0069862
491 Ga0373935_0186671
492 Ga0373947_0051340
493 Ga0373947_0151689
494 Ga0373937_0000511
495 Ga0373937_0056151
496 Ga0373937_0157027
497 Ga0373925_0037112
498 Ga0373925_0104422
499 Ga0436365_1208785
500 Ga0436365_1522242
501 Ga0451807_0322474
502 Ga0451837_1293527
503 Ga0451849_1005054
504 Ga0451853_0090135
505 Ga0466967_0076980
506 Ga0495641_0036790
507 Ga0495651_0150242
508 Ga0495630_0013945
509 Ga0495634_0001418
510 Ga0495634_0052535
511 Ga0495674_0001307
512 Ga0495674_0145196
513 Ga0495680_0063174
514 Ga0496100_0003915
515 Ga0496100_0003921
516 Ga0496101_0012586
517 Ga0496105_0320168
518 Ga0496112_0110892
519 Ga0496114_0000157
520 Ga0496114_0001056
521 Ga0496115_0325757
522 Ga0501308_006787
523 Ga0501047_0080086
524 Ga0501067_0028970
525 Ga0501073_0003025
526 Ga0501073_0005452
527 Ga0501077_0098373
528 nmdc:mga0k408_11417_c1
529 nmdc:mga06z11_114441_c1
530 nmdc:mga08y16_1005_c1
531 nmdc:mga08y16_13931_c1
532 Ga0495619_0141647
533 Ga0495619_0223566
534 Ga0500552_007912
535 Ga0501084_0091597
536 Ga0501082_0217349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

82

334

0.96

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

81

340

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g1w-assembly1.cif.gz_B crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9121 46 327
3g1w-assembly1.cif.gz_A crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.8979 47 327
6sw4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8966 47 327
3g1w-assembly1.cif.gz_B crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.8849 46 327
5hsg-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein from klebsiella pneumoniae (kpn_01730, target efi-511059), apo open structure 0.8834 49 330
ID Description Score Start End Superfamily
2qvcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9265 149 332 3.40.50.2300
5hqjA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9226 148 276 3.40.50.2300
4wutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9201 149 276 3.40.50.2300
2qvcB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9176 47 147 3.40.50.2300
1gudA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9128 147 281 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C6JXN6-F1-model_v4 Substrate-binding domain-containing protein 0.9249 47 331 GO:0007165
GO:0016020
AF-A0A6C1QXF3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9232 57 329 GO:0005886
GO:0030246
GO:0030313
AF-A0A436H095-F1-model_v4 deleted 0.9173 146 327
AF-A0A015NMW8-F1-model_v4 deleted 0.9147 42 323
AF-A0A353P2I1-F1-model_v4 HTH lacI-type domain-containing protein 0.9114 44 322 GO:0003677
GO:0006355
GO:0030313

Map