F375237

General Info

Members Datasets Scaffolds Average Seq Length
268 147 536 188

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10005970|JGI25405J52794_100059702
Length 192
Sequence VASIRPSDVIEGVVVVEPDIHGDERGIFIETYRRQWFNGGREMIQGNRGDRRAGAVVGLHYHLHQADYWYVPFGMCRVVLHDLRVGSPTDGKTLTVDLGSTPGTPGVDHDHRGVYIPPGVAHGFAALTDMTITYLVDGYYNPADELGVAWDDPEVGADWGVSNPVLSARDQSNPRRADLPGDRRPHAALRTG

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
63 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
64 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
80 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
81 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
82 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
83 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
84 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.34
Nodule 0
Rhizoplane 4.1
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10005970 3300003911 Bacteria 2217
2 Ga0070683_100122326 3300005329 Bacteria 2459
3 Ga0068868_100618945 3300005338 Bacteria 961
4 Ga0070668_101197898 3300005347 Bacteria 688
5 Ga0070671_100712332 3300005355 Bacteria 871
6 Ga0070673_100522420 3300005364 Bacteria 1076
7 Ga0070714_100416543 3300005435 Bacteria 1272
8 Ga0070708_100011713 3300005445 Bacteria 7138
9 Ga0070708_100012118 3300005445 Bacteria 7028
10 Ga0070681_10155140 3300005458 Bacteria 2215
11 Ga0070697_100700023 3300005536 Bacteria 894
12 Ga0068863_100240860 3300005841 Bacteria 1746
13 Ga0068858_100132886 3300005842 Bacteria 2334
14 Ga0068860_100851662 3300005843 Bacteria 926
15 Ga0081455_10001364 3300005937 Bacteria 30135
16 Ga0081538_10004634 3300005981 Bacteria 12622
17 Ga0081538_10014623 3300005981 Bacteria 6135
18 Ga0081539_10006513 3300005985 Bacteria 11161
19 Ga0075365_10139582 3300006038 Unclassified 1682
20 Ga0075365_10335810 3300006038 Bacteria 1065
21 Ga0075365_10529810 3300006038 Bacteria 833
22 Ga0075368_10224883 3300006042 Bacteria 798
23 Ga0075364_10022570 3300006051 Bacteria 3976
24 Ga0075364_10095295 3300006051 Bacteria 1978
25 Ga0075362_10240788 3300006177 Bacteria 888
26 Ga0075367_10008307 3300006178 Bacteria 5376
27 Ga0075367_10048211 3300006178 Bacteria 2508
28 Ga0097621_101426288 3300006237 Unclassified 656
29 Ga0075428_100001384 3300006844 Bacteria 25812
30 Ga0075428_100014047 3300006844 Bacteria 8912
31 Ga0075428_100187995 3300006844 Bacteria 2234
32 Ga0075428_100204919 3300006844 Bacteria 2132
33 Ga0075428_100274522 3300006844 Bacteria 1814
34 Ga0075428_100512827 3300006844 Bacteria 1283
35 Ga0075428_100813908 3300006844 Bacteria 993
36 Ga0075428_100840412 3300006844 Bacteria 975
37 Ga0075430_100001126 3300006846 Bacteria 21275
38 Ga0075430_100017695 3300006846 Bacteria 6068
39 Ga0075430_100066599 3300006846 Bacteria 3024
40 Ga0075430_100091965 3300006846 Bacteria 2536
41 Ga0075430_100221303 3300006846 Bacteria 1570
42 Ga0075431_100008935 3300006847 Bacteria 10040
43 Ga0075431_100014399 3300006847 Bacteria 7999
44 Ga0075431_100061253 3300006847 Bacteria 3883
45 Ga0075431_100071121 3300006847 Bacteria 3589
46 Ga0075431_100216710 3300006847 Bacteria 1953
47 Ga0075431_100683165 3300006847 Bacteria 1005
48 Ga0075429_100000610 3300006880 Bacteria 27549
49 Ga0075429_100008536 3300006880 Bacteria 8913
50 Ga0075429_100969365 3300006880 Bacteria 744
51 Ga0075429_101242939 3300006880 Bacteria 650
52 Ga0111539_10243811 3300009094 Bacteria 2092
53 Ga0111539_10353637 3300009094 Bacteria 1710
54 Ga0111539_10964020 3300009094 Bacteria 992
55 Ga0111539_11004762 3300009094 Bacteria 970
56 Ga0105245_10000907 3300009098 Bacteria 26932
57 Ga0105245_10001200 3300009098 Bacteria 23450
58 Ga0105245_10802359 3300009098 Bacteria 979
59 Ga0105247_10385430 3300009101 Bacteria 995
60 Ga0114129_10002678 3300009147 Bacteria 24786
61 Ga0114129_10034567 3300009147 Bacteria 7141
62 Ga0114129_10063134 3300009147 Bacteria 5173
63 Ga0114129_10103855 3300009147 Bacteria 3928
64 Ga0114129_10132619 3300009147 Bacteria 3421
65 Ga0114129_10235792 3300009147 Bacteria 2462
66 Ga0105243_10216219 3300009148 Bacteria 1691
67 Ga0105241_10426420 3300009174 Bacteria 1168
68 Ga0105242_10943166 3300009176 Bacteria 866
69 Ga0105246_11264238 3300011119 Bacteria 682
70 Ga0157369_10394680 3300013105 Bacteria 1435
71 Ga0157378_11824248 3300013297 Bacteria 656
72 Ga0163162_10360186 3300013306 Bacteria 1587
73 Ga0163163_10002857 3300014325 Bacteria 14600
74 Ga0163163_10763542 3300014325 Bacteria 1030
75 Ga0157380_10391080 3300014326 Bacteria 1316
76 Ga0206351_10659106 3300020077 Bacteria 1041
77 Ga0207710_10219828 3300025900 Bacteria 943
78 Ga0207646_10957634 3300025922 Bacteria 758
79 Ga0207659_10656293 3300025926 Bacteria 897
80 Ga0207687_10006375 3300025927 Bacteria 7796
81 Ga0207686_10083111 3300025934 Bacteria 2095
82 Ga0207686_10642214 3300025934 Bacteria 839
83 Ga0207709_10162378 3300025935 Bacteria 1559
84 Ga0207661_10018450 3300025944 Bacteria 5183
85 Ga0207708_10759122 3300026075 Bacteria 833
86 Ga0207641_10248604 3300026088 Bacteria 1660
87 Ga0207675_100394934 3300026118 Bacteria 1362
88 Ga0207428_10067077 3300027907 Bacteria 2826
89 Ga0207428_10468509 3300027907 Bacteria 917
90 Ga0268266_11261667 3300028379 Bacteria 714
91 Ga0268264_10749041 3300028381 Bacteria 973
92 Ga0268264_11324262 3300028381 Bacteria 730
93 Ga0265328_10119664 3300031239 Bacteria 982
94 Ga0265327_10036522 3300031251 Bacteria 2700
95 Ga0307408_100305175 3300031548 Bacteria 1335
96 Ga0316579_10055404 3300031691 Bacteria 1859
97 Ga0316576_10004476 3300031727 Bacteria 8392
98 Ga0316576_10170776 3300031727 Bacteria 1641
99 Ga0316576_10483169 3300031727 Bacteria 912
100 Ga0316578_10007388 3300031728 Bacteria 5506
101 Ga0316578_10292419 3300031728 Bacteria 975
102 Ga0316577_10046378 3300031733 Bacteria 2427
103 Ga0307409_100448144 3300031995 Bacteria 1245
104 Ga0373950_0043779 3300034818 Bacteria 864
105 Ga0373928_0028717 3300035084 Bacteria 1219
106 Ga0373932_0007095 3300035112 Bacteria 2663
107 Ga0373956_0198919 3300035119 Bacteria 950
108 Ga0373943_0184448 3300035170 Bacteria 1148
109 Ga0373955_0044794 3300035172 Bacteria 2385
110 Ga0316574_0002090 3300035398 Bacteria 9884
111 Ga0316574_0017530 3300035398 Bacteria 4193
112 Ga0316574_0077095 3300035398 Bacteria 2112
113 Ga0316574_0262712 3300035398 Bacteria 1102
114 Ga0373931_0000149 3300035691 Bacteria 30847
115 Ga0373933_0164089 3300035724 Bacteria 1412
116 Ga0373937_0073045 3300036401 Bacteria 3164
117 Ga0316582_0017215 3300036647 Bacteria 4176
118 Ga0316582_0221437 3300036647 Bacteria 1294
119 Ga0316582_0448002 3300036647 Bacteria 890
120 Ga0316584_0013615 3300036712 Bacteria 5764
121 Ga0316584_0033566 3300036712 Bacteria 3803
122 Ga0316584_0099807 3300036712 Bacteria 2174
123 Ga0316584_0300685 3300036712 Bacteria 1162
124 Ga0316584_0532476 3300036712 Bacteria 822
125 Ga0373925_0699431 3300037068 Bacteria 836
126 Ga0400483_286087 3300039062 Bacteria 2158
127 Ga0436360_0130340 3300039438 Unclassified 845
128 Ga0436360_1112509 3300039438 Unclassified 932
129 Ga0436363_1168387 3300039450 Bacteria 797
130 Ga0436362_1047464 3300039453 Bacteria 1047
131 Ga0451837_0652190 3300041494 Bacteria 824
132 Ga0451837_0948767 3300041494 Bacteria 944
133 Ga0439450_010459 3300042008 Bacteria 1790
134 Ga0439455_0042512 3300042012 Bacteria 1168
135 Ga0450902_018641 3300042137 Bacteria 1139
136 Ga0439460_0002776 3300042461 Bacteria 4214
137 Ga0439440_0005110 3300042993 Bacteria 2592
138 Ga0466967_2161329 3300045976 Bacteria 553
139 Ga0495651_0268535 3300046462 Bacteria 1158
140 Ga0495653_0018276 3300046463 Bacteria 5697
141 Ga0495608_0466855 3300046511 Bacteria 767
142 Ga0495587_0005714 3300046536 Bacteria 8106
143 Ga0495667_0002170 3300046559 Bacteria 13096
144 Ga0495599_0311081 3300046678 Bacteria 950
145 Ga0495600_0579918 3300046809 Bacteria 683
146 Ga0495604_0093987 3300047317 Bacteria 2217
147 Ga0495680_0012764 3300047322 Bacteria 7368
148 Ga0495684_0099987 3300047471 Bacteria 2193
149 Ga0496104_0072646 3300048907 Bacteria 3272
150 Ga0496105_0511999 3300048908 Bacteria 941
151 Ga0496109_0227182 3300048912 Bacteria 1756
152 Ga0496109_0287309 3300048912 Bacteria 1550
153 Ga0496110_0063104 3300048913 Bacteria 3273
154 Ga0496110_0753351 3300048913 Bacteria 877
155 Ga0496110_0894861 3300048913 Bacteria 794
156 Ga0496111_0070953 3300048914 Bacteria 2535
157 Ga0496114_0013289 3300048917 Bacteria 6600
158 Ga0496114_0170276 3300048917 Bacteria 1898
159 Ga0496115_0162860 3300048918 Bacteria 1844
160 Ga0501031_0071330 3300049568 Bacteria 2262
161 Ga0501032_0002205 3300049569 Bacteria 15326
162 Ga0501033_0009474 3300049570 Bacteria 7501
163 Ga0501033_0067098 3300049570 Bacteria 2638
164 Ga0501033_0229631 3300049570 Bacteria 1319
165 Ga0501034_0002317 3300049571 Bacteria 23256
166 Ga0501034_0018024 3300049571 Bacteria 7244
167 Ga0501034_0255574 3300049571 Bacteria 1696
168 Ga0501034_1143493 3300049571 Bacteria 658
169 Ga0501036_0012469 3300049572 Bacteria 7046
170 Ga0501036_0048114 3300049572 Bacteria 3611
171 Ga0501036_0073869 3300049572 Bacteria 2883
172 Ga0501037_0001446 3300049573 Bacteria 17437
173 Ga0501037_0670265 3300049573 Bacteria 692
174 Ga0501038_0017409 3300049574 Bacteria 6496
175 Ga0501038_0083864 3300049574 Bacteria 2682
176 Ga0501039_0040296 3300049575 Bacteria 3606
177 Ga0501039_0112519 3300049575 Bacteria 2128
178 Ga0501039_0262424 3300049575 Bacteria 1358
179 Ga0501040_0027156 3300049576 Bacteria 3852
180 Ga0501041_0017852 3300049577 Bacteria 4222
181 Ga0501041_0069689 3300049577 Bacteria 2158
182 Ga0501041_0218171 3300049577 Bacteria 1197
183 Ga0501042_0040989 3300049578 Bacteria 3291
184 Ga0501043_0019491 3300049579 Bacteria 5324
185 Ga0501043_0179866 3300049579 Bacteria 1648
186 Ga0501043_0398787 3300049579 Bacteria 1040
187 Ga0501046_0002424 3300049580 Bacteria 17482
188 Ga0501046_0023000 3300049580 Bacteria 5131
189 Ga0501047_0003065 3300049581 Bacteria 15846
190 Ga0501047_0803389 3300049581 Bacteria 755
191 Ga0501048_0113604 3300049582 Bacteria 1913
192 Ga0501048_0421671 3300049582 Bacteria 955
193 Ga0501067_0076541 3300049583 Bacteria 1854
194 Ga0501068_0201909 3300049584 Bacteria 1261
195 Ga0501070_0002132 3300049586 Bacteria 17366
196 Ga0501070_0007026 3300049586 Bacteria 9576
197 Ga0501070_0471654 3300049586 Bacteria 1010
198 Ga0501071_0026234 3300049587 Bacteria 4088
199 Ga0501071_0158614 3300049587 Bacteria 1690
200 Ga0501071_0774622 3300049587 Bacteria 739
201 Ga0501072_0005098 3300049588 Bacteria 9993
202 Ga0501072_1135048 3300049588 Bacteria 608
203 Ga0501074_0015620 3300049590 Bacteria 5519
204 Ga0501074_0018837 3300049590 Bacteria 5014
205 Ga0501074_0406819 3300049590 Bacteria 965
206 Ga0501075_0008948 3300049591 Bacteria 6987
207 Ga0501075_0028052 3300049591 Bacteria 4153
208 Ga0501075_0204368 3300049591 Bacteria 1507
209 Ga0501076_0019276 3300049592 Bacteria 5212
210 Ga0501076_0050188 3300049592 Bacteria 3300
211 Ga0501076_0124646 3300049592 Bacteria 2087
212 Ga0501076_0811963 3300049592 Bacteria 772
213 Ga0501077_0005173 3300049593 Bacteria 7925
214 Ga0501077_0555412 3300049593 Bacteria 737
215 Ga0501079_0007732 3300049741 Bacteria 8138
216 Ga0501079_0105634 3300049741 Bacteria 2185
217 Ga0501079_0505156 3300049741 Bacteria 950
218 Ga0501080_0218406 3300049742 Bacteria 1745
219 Ga0501080_0672970 3300049742 Bacteria 914
220 Ga0501081_0005234 3300049743 Bacteria 8357
221 Ga0501081_0084080 3300049743 Bacteria 2232
222 Ga0501081_0303946 3300049743 Bacteria 1170
223 Ga0501035_0099765 3300049822 Bacteria 2549
224 Ga0501035_0120949 3300049822 Bacteria 2289
225 Ga0501044_0162168 3300049823 Bacteria 2211
226 Ga0501045_0007457 3300049824 Bacteria 7596
227 Ga0501045_0139002 3300049824 Bacteria 1806
228 nmdc:mga00v17_17884_c1 3300050491 Bacteria 4020
229 nmdc:mga00v17_253113_c1 3300050491 Bacteria 1142
230 nmdc:mga00v17_512575_c1 3300050491 Bacteria 777
231 nmdc:mga0yw44_109166_c1 3300050492 Bacteria 1771
232 nmdc:mga06z11_360858_c1 3300050494 Bacteria 871
233 nmdc:mga06z11_55453_c1 3300050494 Bacteria 2046
234 nmdc:mga04h51_192973_c1 3300050495 Bacteria 797
235 nmdc:mga05p37_209074_c1 3300050507 Bacteria 2360
236 nmdc:mga05p37_285874_c1 3300050507 Bacteria 1965
237 nmdc:mga05p37_3302_c1 3300050507 Bacteria 18813
238 nmdc:mga05p37_530936_c1 3300050507 Bacteria 1344
239 nmdc:mga05p37_99402_c1 3300050507 Bacteria 3583
240 nmdc:mga09592_101830_c1 3300050508 Bacteria 2461
241 nmdc:mga09592_1271_c1 3300050508 Bacteria 20249
242 nmdc:mga09592_635074_c1 3300050508 Bacteria 913
243 nmdc:mga09592_786543_c1 3300050508 Bacteria 805
244 nmdc:mga09592_9732_c2 3300050508 Bacteria 3465
245 nmdc:mga0qj67_136985_c1 3300050509 Bacteria 1984
246 nmdc:mga0qj67_30307_c1 3300050509 Bacteria 4210
247 nmdc:mga0qj67_328_c1 3300050509 Bacteria 32670
248 nmdc:mga0qj67_552209_c1 3300050509 Bacteria 924
249 nmdc:mga06r32_1306_c1 3300050510 Bacteria 22486
250 nmdc:mga06r32_18068_c1 3300050510 Bacteria 6449
251 nmdc:mga06r32_188334_c1 3300050510 Bacteria 2051
252 nmdc:mga06r32_436676_c1 3300050510 Bacteria 1290
253 nmdc:mga06r32_44600_c1 3300050510 Bacteria 4223
254 nmdc:mga06r32_883559_c1 3300050510 Bacteria 851
255 nmdc:mga08y16_490253_c1 3300050511 Bacteria 1250
256 nmdc:mga08y16_58346_c1 3300050511 Bacteria 4033
257 Ga0495595_0003817 3300053084 Bacteria 5998
258 Ga0495619_0073805 3300053085 Bacteria 2286
259 Ga0500620_140437 3300053155 Bacteria 844
260 Ga0501084_0029202 3300054114 Bacteria 4612
261 Ga0501084_0030220 3300054114 Bacteria 4531
262 Ga0501084_0167926 3300054114 Bacteria 1852
263 Ga0501084_0910307 3300054114 Bacteria 740
264 Ga0501082_0018180 3300060353 Bacteria 6053
265 Ga0530510_0014290 3300061734 Bacteria 5597
266 Ga0530510_0025385 3300061734 Bacteria 4236
267 Ga0530510_0039125 3300061734 Bacteria 3423
268 Ga0530510_0218260 3300061734 Bacteria 1417
269 JGI25405J52794_10005970
270 Ga0070683_100122326
271 Ga0068868_100618945
272 Ga0070668_101197898
273 Ga0070671_100712332
274 Ga0070673_100522420
275 Ga0070714_100416543
276 Ga0070708_100011713
277 Ga0070708_100012118
278 Ga0070681_10155140
279 Ga0070697_100700023
280 Ga0068863_100240860
281 Ga0068858_100132886
282 Ga0068860_100851662
283 Ga0081455_10001364
284 Ga0081538_10004634
285 Ga0081538_10014623
286 Ga0081539_10006513
287 Ga0075365_10139582
288 Ga0075365_10335810
289 Ga0075365_10529810
290 Ga0075368_10224883
291 Ga0075364_10022570
292 Ga0075364_10095295
293 Ga0075362_10240788
294 Ga0075367_10008307
295 Ga0075367_10048211
296 Ga0097621_101426288
297 Ga0075428_100001384
298 Ga0075428_100014047
299 Ga0075428_100187995
300 Ga0075428_100204919
301 Ga0075428_100274522
302 Ga0075428_100512827
303 Ga0075428_100813908
304 Ga0075428_100840412
305 Ga0075430_100001126
306 Ga0075430_100017695
307 Ga0075430_100066599
308 Ga0075430_100091965
309 Ga0075430_100221303
310 Ga0075431_100008935
311 Ga0075431_100014399
312 Ga0075431_100061253
313 Ga0075431_100071121
314 Ga0075431_100216710
315 Ga0075431_100683165
316 Ga0075429_100000610
317 Ga0075429_100008536
318 Ga0075429_100969365
319 Ga0075429_101242939
320 Ga0111539_10243811
321 Ga0111539_10353637
322 Ga0111539_10964020
323 Ga0111539_11004762
324 Ga0105245_10000907
325 Ga0105245_10001200
326 Ga0105245_10802359
327 Ga0105247_10385430
328 Ga0114129_10002678
329 Ga0114129_10034567
330 Ga0114129_10063134
331 Ga0114129_10103855
332 Ga0114129_10132619
333 Ga0114129_10235792
334 Ga0105243_10216219
335 Ga0105241_10426420
336 Ga0105242_10943166
337 Ga0105246_11264238
338 Ga0157369_10394680
339 Ga0157378_11824248
340 Ga0163162_10360186
341 Ga0163163_10002857
342 Ga0163163_10763542
343 Ga0157380_10391080
344 Ga0206351_10659106
345 Ga0207710_10219828
346 Ga0207646_10957634
347 Ga0207659_10656293
348 Ga0207687_10006375
349 Ga0207686_10083111
350 Ga0207686_10642214
351 Ga0207709_10162378
352 Ga0207661_10018450
353 Ga0207708_10759122
354 Ga0207641_10248604
355 Ga0207675_100394934
356 Ga0207428_10067077
357 Ga0207428_10468509
358 Ga0268266_11261667
359 Ga0268264_10749041
360 Ga0268264_11324262
361 Ga0265328_10119664
362 Ga0265327_10036522
363 Ga0307408_100305175
364 Ga0316579_10055404
365 Ga0316576_10004476
366 Ga0316576_10170776
367 Ga0316576_10483169
368 Ga0316578_10007388
369 Ga0316578_10292419
370 Ga0316577_10046378
371 Ga0307409_100448144
372 Ga0373950_0043779
373 Ga0373928_0028717
374 Ga0373932_0007095
375 Ga0373956_0198919
376 Ga0373943_0184448
377 Ga0373955_0044794
378 Ga0316574_0002090
379 Ga0316574_0017530
380 Ga0316574_0077095
381 Ga0316574_0262712
382 Ga0373931_0000149
383 Ga0373933_0164089
384 Ga0373937_0073045
385 Ga0316582_0017215
386 Ga0316582_0221437
387 Ga0316582_0448002
388 Ga0316584_0013615
389 Ga0316584_0033566
390 Ga0316584_0099807
391 Ga0316584_0300685
392 Ga0316584_0532476
393 Ga0373925_0699431
394 Ga0400483_286087
395 Ga0436360_0130340
396 Ga0436360_1112509
397 Ga0436363_1168387
398 Ga0436362_1047464
399 Ga0451837_0652190
400 Ga0451837_0948767
401 Ga0439450_010459
402 Ga0439455_0042512
403 Ga0450902_018641
404 Ga0439460_0002776
405 Ga0439440_0005110
406 Ga0466967_2161329
407 Ga0495651_0268535
408 Ga0495653_0018276
409 Ga0495608_0466855
410 Ga0495587_0005714
411 Ga0495667_0002170
412 Ga0495599_0311081
413 Ga0495600_0579918
414 Ga0495604_0093987
415 Ga0495680_0012764
416 Ga0495684_0099987
417 Ga0496104_0072646
418 Ga0496105_0511999
419 Ga0496109_0227182
420 Ga0496109_0287309
421 Ga0496110_0063104
422 Ga0496110_0753351
423 Ga0496110_0894861
424 Ga0496111_0070953
425 Ga0496114_0013289
426 Ga0496114_0170276
427 Ga0496115_0162860
428 Ga0501031_0071330
429 Ga0501032_0002205
430 Ga0501033_0009474
431 Ga0501033_0067098
432 Ga0501033_0229631
433 Ga0501034_0002317
434 Ga0501034_0018024
435 Ga0501034_0255574
436 Ga0501034_1143493
437 Ga0501036_0012469
438 Ga0501036_0048114
439 Ga0501036_0073869
440 Ga0501037_0001446
441 Ga0501037_0670265
442 Ga0501038_0017409
443 Ga0501038_0083864
444 Ga0501039_0040296
445 Ga0501039_0112519
446 Ga0501039_0262424
447 Ga0501040_0027156
448 Ga0501041_0017852
449 Ga0501041_0069689
450 Ga0501041_0218171
451 Ga0501042_0040989
452 Ga0501043_0019491
453 Ga0501043_0179866
454 Ga0501043_0398787
455 Ga0501046_0002424
456 Ga0501046_0023000
457 Ga0501047_0003065
458 Ga0501047_0803389
459 Ga0501048_0113604
460 Ga0501048_0421671
461 Ga0501067_0076541
462 Ga0501068_0201909
463 Ga0501070_0002132
464 Ga0501070_0007026
465 Ga0501070_0471654
466 Ga0501071_0026234
467 Ga0501071_0158614
468 Ga0501071_0774622
469 Ga0501072_0005098
470 Ga0501072_1135048
471 Ga0501074_0015620
472 Ga0501074_0018837
473 Ga0501074_0406819
474 Ga0501075_0008948
475 Ga0501075_0028052
476 Ga0501075_0204368
477 Ga0501076_0019276
478 Ga0501076_0050188
479 Ga0501076_0124646
480 Ga0501076_0811963
481 Ga0501077_0005173
482 Ga0501077_0555412
483 Ga0501079_0007732
484 Ga0501079_0105634
485 Ga0501079_0505156
486 Ga0501080_0218406
487 Ga0501080_0672970
488 Ga0501081_0005234
489 Ga0501081_0084080
490 Ga0501081_0303946
491 Ga0501035_0099765
492 Ga0501035_0120949
493 Ga0501044_0162168
494 Ga0501045_0007457
495 Ga0501045_0139002
496 nmdc:mga00v17_17884_c1
497 nmdc:mga00v17_253113_c1
498 nmdc:mga00v17_512575_c1
499 nmdc:mga0yw44_109166_c1
500 nmdc:mga06z11_360858_c1
501 nmdc:mga06z11_55453_c1
502 nmdc:mga04h51_192973_c1
503 nmdc:mga05p37_209074_c1
504 nmdc:mga05p37_285874_c1
505 nmdc:mga05p37_3302_c1
506 nmdc:mga05p37_530936_c1
507 nmdc:mga05p37_99402_c1
508 nmdc:mga09592_101830_c1
509 nmdc:mga09592_1271_c1
510 nmdc:mga09592_635074_c1
511 nmdc:mga09592_786543_c1
512 nmdc:mga09592_9732_c2
513 nmdc:mga0qj67_136985_c1
514 nmdc:mga0qj67_30307_c1
515 nmdc:mga0qj67_328_c1
516 nmdc:mga0qj67_552209_c1
517 nmdc:mga06r32_1306_c1
518 nmdc:mga06r32_18068_c1
519 nmdc:mga06r32_188334_c1
520 nmdc:mga06r32_436676_c1
521 nmdc:mga06r32_44600_c1
522 nmdc:mga06r32_883559_c1
523 nmdc:mga08y16_490253_c1
524 nmdc:mga08y16_58346_c1
525 Ga0495595_0003817
526 Ga0495619_0073805
527 Ga0500620_140437
528 Ga0501084_0029202
529 Ga0501084_0030220
530 Ga0501084_0167926
531 Ga0501084_0910307
532 Ga0501082_0018180
533 Ga0530510_0014290
534 Ga0530510_0025385
535 Ga0530510_0039125
536 Ga0530510_0218260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

7

178

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.8941 1 186
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.8914 2 178
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.8896 2 180
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.8846 1 175
1ep0-assembly1.cif.gz_A high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum 0.8819 1 180
ID Description Score Start End Superfamily
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8855 7 179 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8846 1 175 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8819 1 180 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8776 3 180 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8757 7 179 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A662DVI7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9727 1 137 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2D8V6S0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9714 10 170 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A0C1R562-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.971 1 187 GO:0000271
GO:0005829
GO:0008830
AF-A0A538ASV8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9707 2 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7X9KLH7-F1-model_v4 dTDP-4-keto-6-deoxy-D-glucose epimerase 0.9698 1 191 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map