F374799

General Info

Members Datasets Scaffolds Average Seq Length
267 182 534 354

Family's Representative Sequence

Representative Sequence 3300025299|Ga0209256_1000592|Ga0209256_100059239
Length 408
Sequence MTGRVTPRLDAQDPHYNLPFHNMVVTTPRRDRDATTDNKVGEDAMTPNPLLGVVFHWLGGLASASFYVPYRGVRRWSWEIFWLTGGIFSWLLAPWLFAALQTKDLLGVMAQIPPRTAGLCVLFGVLWGFGGLTYGLTMRYLGLSLGMAVVLGLCTVFGTLIPPLVQGDIADKLLATTSGRIILLGLLVTLAGIVVVAWAGAKKDGDLSPEQKKAAVAEFDFRKGIAVAVFSGVMSACFAFGLSAGEPIKALTAAAGTGPLWTGLPTLCLVMFGGLITNGLWCAWLILKNRSAGQWLGAVSPAETADKPEVAALKRSPLLVNYLLCAVAGTAWYFQFFFYTMGESQMGRFGFSSWTLHMASIIIFGALWGFAFREWKDARPAVKAMVWTGVALLVGATVIIGYGNRLGS

Samples

Sample ID Description Type Environment
1 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
78 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
79 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
80 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
110 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
130 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
136 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
137 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
138 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
141 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
142 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
143 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
144 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
147 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
148 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
153 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
154 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
155 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
156 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
157 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
158 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
159 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
160 2643221584 Caulobacter sp. Root656 Isolate Unclassified
161 2643221640 Caulobacter sp. Root342 Isolate Unclassified
162 2643221642 Caulobacter sp. Root343 Isolate Unclassified
163 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
164 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
165 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
166 2818991435 Caulobacter henricii 536 Isolate Unclassified
167 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
168 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
169 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
170 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
171 2849560528 Caulobacter zeae 410 Isolate Unclassified
172 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
173 2851153111 Caulobacter radicis 736 Isolate Unclassified
174 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
175 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
176 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
177 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
178 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
179 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
180 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
181 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
182 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.27
Metatranscriptomes 0
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.85
Nodule 0
Rhizoplane 3.37
Rhizosphere 55.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209256_1000592 3300025299 Bacteria 50393
2 SwRhRL2b_contig_290893 2162886007 Bacteria 3591
3 JGI24739J22299_10000733 3300001989 Bacteria 11902
4 JGI24737J22298_10008810 3300001990 Bacteria 3368
5 JGI24735J21928_10002052 3300002067 Bacteria 7093
6 JGI24738J21930_10001097 3300002075 Bacteria 7650
7 JGI25165J46597_1000138 3300003214 Bacteria 121773
8 rootH1_10086896 3300003316 Bacteria 2015
9 Ga0055537_1001200 3300003773 Bacteria 10985
10 Ga0055536_1001392 3300003781 Bacteria 14629
11 Ga0055536_1005658 3300003781 Bacteria 6045
12 Ga0055528_1007152 3300003790 Bacteria 4977
13 Ga0055530_10014763 3300003791 Bacteria 2583
14 Ga0055531_10000947 3300003794 Bacteria 23329
15 Ga0055531_10027521 3300003794 Bacteria 1992
16 Ga0065704_10001326 3300005289 Bacteria 14211
17 Ga0070677_10015626 3300005333 Bacteria 2690
18 Ga0070669_100048262 3300005353 Bacteria 3107
19 Ga0070662_100004533 3300005457 Bacteria 8801
20 Ga0070679_100065430 3300005530 Bacteria 3624
21 Ga0068857_100067958 3300005577 Bacteria 3172
22 Ga0068854_100007205 3300005578 Bacteria 7100
23 Ga0068854_100272066 3300005578 Bacteria 1361
24 Ga0068856_100002722 3300005614 Bacteria 18116
25 Ga0068858_100000626 3300005842 Bacteria 36822
26 Ga0081539_10007796 3300005985 Bacteria 9582
27 Ga0075368_10001125 3300006042 Bacteria 8436
28 Ga0075363_100001587 3300006048 Bacteria 8738
29 Ga0075367_10000744 3300006178 Bacteria 12671
30 Ga0075369_10007527 3300006186 Bacteria 4152
31 Ga0075366_10015841 3300006195 Bacteria 4328
32 Ga0075370_10006824 3300006353 Bacteria 5772
33 Ga0075370_10072161 3300006353 Bacteria 1976
34 Ga0105240_10046730 3300009093 Bacteria 5483
35 Ga0105240_10232859 3300009093 Bacteria 2140
36 Ga0105245_10000596 3300009098 Bacteria 32680
37 Ga0105245_10001089 3300009098 Bacteria 24632
38 Ga0105243_10048017 3300009148 Bacteria 3364
39 Ga0105243_10128201 3300009148 Bacteria 2149
40 Ga0105248_10006646 3300009177 Bacteria 12683
41 Ga0105249_10005913 3300009553 Bacteria 10596
42 Ga0157373_10033509 3300013100 Bacteria 3695
43 Ga0157369_10006472 3300013105 Bacteria 13574
44 Ga0157374_10320399 3300013296 Bacteria 1536
45 Ga0157378_10218357 3300013297 Bacteria 1811
46 Ga0163162_10199171 3300013306 Bacteria 2131
47 Ga0157372_10001644 3300013307 Bacteria 24283
48 Ga0157372_10019482 3300013307 Bacteria 7315
49 Ga0157380_10118631 3300014326 Bacteria 2237
50 Ga0209147_100748 3300025229 Bacteria 16056
51 Ga0209148_1000208 3300025254 Bacteria 103781
52 Ga0209233_1000041 3300025261 Bacteria 515463
53 Ga0209233_1000182 3300025261 Bacteria 137671
54 Ga0209565_1000618 3300025263 Bacteria 23421
55 Ga0209673_1000722 3300025273 Bacteria 45860
56 Ga0209675_1005298 3300025291 Bacteria 5431
57 Ga0209676_1000169 3300025292 Bacteria 155600
58 Ga0209676_1000713 3300025292 Bacteria 45996
59 Ga0209564_1028936 3300025295 Bacteria 1756
60 Ga0209758_1001566 3300025297 Bacteria 26231
61 Ga0209050_1000737 3300025298 Bacteria 47468
62 Ga0209050_1002591 3300025298 Bacteria 14992
63 Ga0209256_1015774 3300025299 Bacteria 2621
64 Ga0209051_1001836 3300025303 Bacteria 16785
65 Ga0209257_1000282 3300025304 Bacteria 113789
66 Ga0209257_1001493 3300025304 Bacteria 27470
67 Ga0209257_1008735 3300025304 Bacteria 5641
68 Ga0209257_1018640 3300025304 Bacteria 2656
69 Ga0207647_10000375 3300025904 Bacteria 36351
70 Ga0207647_10001047 3300025904 Bacteria 21386
71 Ga0207695_10081937 3300025913 Bacteria 3264
72 Ga0207695_10145730 3300025913 Bacteria 2312
73 Ga0207652_10159157 3300025921 Bacteria 2024
74 Ga0207681_10015211 3300025923 Bacteria 4798
75 Ga0207687_10000547 3300025927 Bacteria 25260
76 Ga0207706_10002790 3300025933 Bacteria 16968
77 Ga0207706_10019218 3300025933 Bacteria 6143
78 Ga0207709_10185608 3300025935 Bacteria 1472
79 Ga0207711_10008674 3300025941 Bacteria 8505
80 Ga0207712_10010198 3300025961 Bacteria 5959
81 Ga0207640_10001209 3300025981 Bacteria 14089
82 Ga0207703_10000142 3300026035 Bacteria 84567
83 Ga0207639_10038647 3300026041 Bacteria 3551
84 Ga0207674_10027324 3300026116 Bacteria 6039
85 Ga0209813_10000077 3300027866 Bacteria 36660
86 Ga0307517_10010248 3300028786 Bacteria 13148
87 Ga0307515_10036466 3300028794 Bacteria 7952
88 Ga0307515_10046875 3300028794 Bacteria 6592
89 Ga0307408_100008127 3300031548 Bacteria 6933
90 Ga0307508_10000255 3300031616 Bacteria 64997
91 Ga0307410_10002590 3300031852 Bacteria 8781
92 Ga0307412_10021691 3300031911 Bacteria 3927
93 Ga0307409_100038474 3300031995 Bacteria 3539
94 Ga0395899_0003340 3300037312 Bacteria 12722
95 Ga0451853_2528565 3300041512 Bacteria 1150
96 Ga0439450_005996 3300042008 Bacteria 2167
97 Ga0439455_0000718 3300042012 Bacteria 4916
98 Ga0439455_0005980 3300042012 Bacteria 2501
99 Ga0439455_0011120 3300042012 Bacteria 1992
100 Ga0439446_0004716 3300042156 Bacteria 3466
101 Ga0439458_0000424 3300042157 Bacteria 10628
102 Ga0439458_0004101 3300042157 Bacteria 3362
103 Ga0495617_018575 3300046452 Bacteria 2351
104 Ga0495627_000260 3300046453 Bacteria 54170
105 Ga0495627_000295 3300046453 Bacteria 49392
106 Ga0495627_026188 3300046453 Bacteria 1883
107 Ga0495590_0004860 3300046457 Bacteria 5374
108 Ga0495638_0000073 3300046460 Bacteria 164378
109 Ga0495638_0000400 3300046460 Bacteria 53251
110 Ga0495638_0000507 3300046460 Bacteria 46001
111 Ga0495638_0000688 3300046460 Bacteria 36751
112 Ga0495638_0009932 3300046460 Bacteria 6639
113 Ga0495638_0055589 3300046460 Bacteria 2458
114 Ga0495638_0063270 3300046460 Bacteria 2281
115 Ga0495638_0063782 3300046460 Bacteria 2270
116 Ga0495650_0000069 3300046471 Bacteria 261124
117 Ga0495650_0001200 3300046471 Bacteria 27305
118 Ga0495584_0032751 3300046491 Bacteria 2630
119 Ga0495607_0022685 3300046501 Bacteria 3938
120 Ga0495583_0000023 3300046506 Bacteria 280019
121 Ga0495583_0000087 3300046506 Bacteria 164974
122 Ga0495606_0016300 3300046507 Bacteria 5673
123 Ga0495610_0000034 3300046512 Bacteria 201408
124 Ga0495610_0000102 3300046512 Bacteria 98985
125 Ga0495610_0015259 3300046512 Bacteria 4472
126 Ga0495616_0000054 3300046513 Bacteria 104326
127 Ga0495620_0031819 3300046515 Bacteria 2411
128 Ga0495632_0000013 3300046519 Bacteria 247879
129 Ga0495632_0000370 3300046519 Bacteria 42724
130 Ga0495632_0000595 3300046519 Bacteria 33599
131 Ga0495637_0000229 3300046520 Bacteria 43471
132 Ga0495637_0002836 3300046520 Bacteria 9400
133 Ga0495637_0010298 3300046520 Bacteria 4529
134 Ga0495637_0023732 3300046520 Bacteria 2781
135 Ga0495643_0000010 3300046522 Bacteria 341431
136 Ga0495648_0000049 3300046524 Bacteria 164366
137 Ga0495648_0001499 3300046524 Bacteria 22847
138 Ga0495648_0006463 3300046524 Bacteria 9563
139 Ga0495648_0035331 3300046524 Bacteria 3241
140 Ga0495663_0000004 3300046525 Bacteria 355166
141 Ga0495654_0000024 3300046530 Bacteria 238195
142 Ga0495654_0041104 3300046530 Bacteria 2301
143 Ga0495597_0019332 3300046542 Bacteria 3188
144 Ga0495622_0039895 3300046557 Bacteria 2186
145 Ga0495633_0000092 3300046558 Bacteria 121446
146 Ga0495633_0002661 3300046558 Bacteria 12438
147 Ga0495668_0000456 3300046616 Bacteria 52300
148 Ga0495668_0001804 3300046616 Bacteria 19521
149 Ga0495668_0005725 3300046616 Bacteria 8306
150 Ga0495668_0068846 3300046616 Bacteria 1946
151 Ga0495611_0058596 3300046648 Bacteria 1747
152 Ga0495625_0000043 3300046660 Bacteria 205715
153 Ga0495625_0000170 3300046660 Bacteria 102224
154 Ga0495625_0006914 3300046660 Bacteria 10011
155 Ga0495661_0057255 3300046665 Bacteria 2328
156 Ga0495670_0000007 3300046691 Bacteria 247088
157 Ga0495670_0000034 3300046691 Bacteria 80461
158 Ga0495671_0000014 3300046692 Bacteria 341431
159 Ga0495671_0000042 3300046692 Bacteria 165201
160 Ga0495660_0001451 3300046810 Bacteria 16207
161 Ga0495683_0036210 3300047323 Bacteria 2506
162 Ga0495673_0000111 3300047469 Bacteria 164974
163 Ga0495673_0000333 3300047469 Bacteria 60696
164 Ga0495673_0009536 3300047469 Bacteria 5370
165 Ga0495681_0000049 3300047470 Bacteria 109650
166 Ga0495681_0000104 3300047470 Bacteria 74261
167 Ga0495681_0001853 3300047470 Bacteria 15548
168 Ga0495686_0001248 3300047472 Bacteria 28936
169 Ga0495686_0001955 3300047472 Bacteria 20498
170 Ga0495686_0004056 3300047472 Bacteria 12228
171 Ga0495686_0006341 3300047472 Bacteria 9075
172 Ga0495686_0012703 3300047472 Bacteria 5882
173 Ga0495686_0024028 3300047472 Bacteria 4009
174 Ga0495686_0024734 3300047472 Bacteria 3942
175 Ga0496106_0005983 3300048909 Bacteria 8993
176 Ga0496107_0000068 3300048910 Bacteria 51683
177 Ga0496108_0007964 3300048911 Bacteria 8595
178 Ga0496110_0132650 3300048913 Bacteria 2250
179 Ga0496110_0361060 3300048913 Bacteria 1323
180 Ga0496111_0015746 3300048914 Bacteria 5200
181 Ga0496115_0001653 3300048918 Bacteria 16036
182 Ga0496115_0177995 3300048918 Bacteria 1759
183 Ga0496117_0009240 3300048920 Bacteria 9217
184 Ga0496118_0004463 3300048921 Bacteria 16596
185 Ga0496121_0000112 3300048924 Bacteria 183480
186 Ga0496121_0000734 3300048924 Bacteria 60436
187 Ga0496121_0000997 3300048924 Bacteria 50601
188 Ga0496121_0044825 3300048924 Bacteria 3809
189 Ga0496122_0001355 3300048925 Bacteria 39961
190 Ga0496122_0113411 3300048925 Bacteria 1771
191 Ga0496122_0149443 3300048925 Bacteria 1444
192 Ga0496123_0002426 3300048926 Bacteria 23191
193 Ga0496123_0051018 3300048926 Bacteria 2759
194 Ga0496124_0009107 3300048927 Bacteria 10264
195 Ga0496124_0014977 3300048927 Bacteria 7466
196 Ga0496124_0019667 3300048927 Bacteria 6273
197 Ga0496124_0022552 3300048927 Bacteria 5767
198 Ga0496124_0109384 3300048927 Bacteria 2227
199 Ga0496125_0025013 3300048928 Bacteria 5478
200 Ga0496125_0030675 3300048928 Bacteria 4806
201 Ga0496125_0058403 3300048928 Bacteria 3116
202 Ga0496125_0139134 3300048928 Bacteria 1691
203 Ga0496126_0047094 3300048929 Bacteria 3949
204 Ga0496126_0198316 3300048929 Bacteria 1696
205 Ga0495678_001042 3300049459 Bacteria 23497
206 Ga0501043_0068858 3300049579 Bacteria 2779
207 Ga0501238_000094 3300049671 Bacteria 14176
208 nmdc:mga03683_98842_c1 3300050489 Bacteria 1281
209 nmdc:mga06z11_90_c1 3300050494 Bacteria 38500
210 nmdc:mga04h51_299_c1 3300050495 Bacteria 12655
211 nmdc:mga08y16_363345_c1 3300050511 Bacteria 1486
212 nmdc:mga0sz30_1132_c1 3300050516 Bacteria 9563
213 Ga0500578_0000041 3300053086 Bacteria 129580
214 Ga0500578_0102629 3300053086 Bacteria 1809
215 Ga0500644_0000109 3300053088 Bacteria 52262
216 Ga0500641_0000631 3300053096 Bacteria 12737
217 Ga0500554_030384 3300053102 Bacteria 1587
218 Ga0500555_000042 3300053103 Bacteria 65300
219 Ga0500556_0001687 3300053104 Bacteria 8514
220 Ga0500562_000786 3300053108 Bacteria 7753
221 Ga0500562_012848 3300053108 Bacteria 2131
222 Ga0500594_0000437 3300053118 Bacteria 9204
223 Ga0500594_0001896 3300053118 Bacteria 4524
224 Ga0500595_022792 3300053119 Bacteria 2210
225 Ga0500608_001004 3300053122 Bacteria 10128
226 Ga0500658_0000198 3300053134 Bacteria 28628
227 Ga0500559_0002849 3300053136 Bacteria 8736
228 Ga0500559_0019967 3300053136 Bacteria 2832
229 Ga0500564_000122 3300053138 Bacteria 19631
230 Ga0500577_0006366 3300053142 Bacteria 3252
231 Ga0500616_0045490 3300053153 Bacteria 2338
232 Ga0500622_0011138 3300053156 Bacteria 4910
233 Ga0500624_000107 3300053157 Bacteria 39921
234 2512643253 2512564014 Bacteria 4639632
235 2585150168 2582581279 Bacteria 4980720
236 2585155611 2582581280 Bacteria 5994497
237 2585199377 2582581293 Bacteria 5907401
238 2587919839 2585428106 Bacteria 5179711
239 2600203257 2599185354 Bacteria 4398675
240 2643748405 2643221545 Bacteria 5083237
241 2643781927 2643221552 Bacteria 5708754
242 2643929589 2643221584 Bacteria 5511711
243 2644223534 2643221640 Bacteria 5258820
244 2644227942 2643221640 Bacteria 5258820
245 2644236377 2643221642 Bacteria 5357871
246 2644236712 2643221642 Bacteria 5357871
247 2644508206 2643221691 Bacteria 5093099
248 2753766783 2751185897 Bacteria 5322941
249 2792461922 2791355048 Bacteria 5832535
250 2819536928 2818991435 Bacteria 5433759
251 2819575827 2818991442 Bacteria 8318214
252 2819645179 2818991454 Bacteria 5563326
253 2821138380 2821136567 Bacteria 8080116
254 2843748783 2843744320 Bacteria 5659202
255 2849562147 2849560528 Bacteria 5393480
256 2849578849 2849573788 Bacteria 5421256
257 2851156499 2851153111 Bacteria 5542585
258 2851156585 2851153111 Bacteria 5542585
259 2857505913 2857504554 Bacteria 5369913
260 2884965351 2884960567 Bacteria 5437054
261 2898330254 2898329390 Bacteria 5168154
262 2904469176 2904467357 Bacteria 8057758
263 2919710362 2919709256 Bacteria 4318106
264 2928519094 2928515477 Bacteria 4448421
265 2928531980 2928531327 Bacteria 5101314
266 2929244048 2929239360 Bacteria 7745570
267 2946791272 2946787523 Bacteria 4366789
268 Ga0209256_1000592
269 SwRhRL2b_contig_290893
270 JGI24739J22299_10000733
271 JGI24737J22298_10008810
272 JGI24735J21928_10002052
273 JGI24738J21930_10001097
274 JGI25165J46597_1000138
275 rootH1_10086896
276 Ga0055537_1001200
277 Ga0055536_1001392
278 Ga0055536_1005658
279 Ga0055528_1007152
280 Ga0055530_10014763
281 Ga0055531_10000947
282 Ga0055531_10027521
283 Ga0065704_10001326
284 Ga0070677_10015626
285 Ga0070669_100048262
286 Ga0070662_100004533
287 Ga0070679_100065430
288 Ga0068857_100067958
289 Ga0068854_100007205
290 Ga0068854_100272066
291 Ga0068856_100002722
292 Ga0068858_100000626
293 Ga0081539_10007796
294 Ga0075368_10001125
295 Ga0075363_100001587
296 Ga0075367_10000744
297 Ga0075369_10007527
298 Ga0075366_10015841
299 Ga0075370_10006824
300 Ga0075370_10072161
301 Ga0105240_10046730
302 Ga0105240_10232859
303 Ga0105245_10000596
304 Ga0105245_10001089
305 Ga0105243_10048017
306 Ga0105243_10128201
307 Ga0105248_10006646
308 Ga0105249_10005913
309 Ga0157373_10033509
310 Ga0157369_10006472
311 Ga0157374_10320399
312 Ga0157378_10218357
313 Ga0163162_10199171
314 Ga0157372_10001644
315 Ga0157372_10019482
316 Ga0157380_10118631
317 Ga0209147_100748
318 Ga0209148_1000208
319 Ga0209233_1000041
320 Ga0209233_1000182
321 Ga0209565_1000618
322 Ga0209673_1000722
323 Ga0209675_1005298
324 Ga0209676_1000169
325 Ga0209676_1000713
326 Ga0209564_1028936
327 Ga0209758_1001566
328 Ga0209050_1000737
329 Ga0209050_1002591
330 Ga0209256_1015774
331 Ga0209051_1001836
332 Ga0209257_1000282
333 Ga0209257_1001493
334 Ga0209257_1008735
335 Ga0209257_1018640
336 Ga0207647_10000375
337 Ga0207647_10001047
338 Ga0207695_10081937
339 Ga0207695_10145730
340 Ga0207652_10159157
341 Ga0207681_10015211
342 Ga0207687_10000547
343 Ga0207706_10002790
344 Ga0207706_10019218
345 Ga0207709_10185608
346 Ga0207711_10008674
347 Ga0207712_10010198
348 Ga0207640_10001209
349 Ga0207703_10000142
350 Ga0207639_10038647
351 Ga0207674_10027324
352 Ga0209813_10000077
353 Ga0307517_10010248
354 Ga0307515_10036466
355 Ga0307515_10046875
356 Ga0307408_100008127
357 Ga0307508_10000255
358 Ga0307410_10002590
359 Ga0307412_10021691
360 Ga0307409_100038474
361 Ga0395899_0003340
362 Ga0451853_2528565
363 Ga0439450_005996
364 Ga0439455_0000718
365 Ga0439455_0005980
366 Ga0439455_0011120
367 Ga0439446_0004716
368 Ga0439458_0000424
369 Ga0439458_0004101
370 Ga0495617_018575
371 Ga0495627_000260
372 Ga0495627_000295
373 Ga0495627_026188
374 Ga0495590_0004860
375 Ga0495638_0000073
376 Ga0495638_0000400
377 Ga0495638_0000507
378 Ga0495638_0000688
379 Ga0495638_0009932
380 Ga0495638_0055589
381 Ga0495638_0063270
382 Ga0495638_0063782
383 Ga0495650_0000069
384 Ga0495650_0001200
385 Ga0495584_0032751
386 Ga0495607_0022685
387 Ga0495583_0000023
388 Ga0495583_0000087
389 Ga0495606_0016300
390 Ga0495610_0000034
391 Ga0495610_0000102
392 Ga0495610_0015259
393 Ga0495616_0000054
394 Ga0495620_0031819
395 Ga0495632_0000013
396 Ga0495632_0000370
397 Ga0495632_0000595
398 Ga0495637_0000229
399 Ga0495637_0002836
400 Ga0495637_0010298
401 Ga0495637_0023732
402 Ga0495643_0000010
403 Ga0495648_0000049
404 Ga0495648_0001499
405 Ga0495648_0006463
406 Ga0495648_0035331
407 Ga0495663_0000004
408 Ga0495654_0000024
409 Ga0495654_0041104
410 Ga0495597_0019332
411 Ga0495622_0039895
412 Ga0495633_0000092
413 Ga0495633_0002661
414 Ga0495668_0000456
415 Ga0495668_0001804
416 Ga0495668_0005725
417 Ga0495668_0068846
418 Ga0495611_0058596
419 Ga0495625_0000043
420 Ga0495625_0000170
421 Ga0495625_0006914
422 Ga0495661_0057255
423 Ga0495670_0000007
424 Ga0495670_0000034
425 Ga0495671_0000014
426 Ga0495671_0000042
427 Ga0495660_0001451
428 Ga0495683_0036210
429 Ga0495673_0000111
430 Ga0495673_0000333
431 Ga0495673_0009536
432 Ga0495681_0000049
433 Ga0495681_0000104
434 Ga0495681_0001853
435 Ga0495686_0001248
436 Ga0495686_0001955
437 Ga0495686_0004056
438 Ga0495686_0006341
439 Ga0495686_0012703
440 Ga0495686_0024028
441 Ga0495686_0024734
442 Ga0496106_0005983
443 Ga0496107_0000068
444 Ga0496108_0007964
445 Ga0496110_0132650
446 Ga0496110_0361060
447 Ga0496111_0015746
448 Ga0496115_0001653
449 Ga0496115_0177995
450 Ga0496117_0009240
451 Ga0496118_0004463
452 Ga0496121_0000112
453 Ga0496121_0000734
454 Ga0496121_0000997
455 Ga0496121_0044825
456 Ga0496122_0001355
457 Ga0496122_0113411
458 Ga0496122_0149443
459 Ga0496123_0002426
460 Ga0496123_0051018
461 Ga0496124_0009107
462 Ga0496124_0014977
463 Ga0496124_0019667
464 Ga0496124_0022552
465 Ga0496124_0109384
466 Ga0496125_0025013
467 Ga0496125_0030675
468 Ga0496125_0058403
469 Ga0496125_0139134
470 Ga0496126_0047094
471 Ga0496126_0198316
472 Ga0495678_001042
473 Ga0501043_0068858
474 Ga0501238_000094
475 nmdc:mga03683_98842_c1
476 nmdc:mga06z11_90_c1
477 nmdc:mga04h51_299_c1
478 nmdc:mga08y16_363345_c1
479 nmdc:mga0sz30_1132_c1
480 Ga0500578_0000041
481 Ga0500578_0102629
482 Ga0500644_0000109
483 Ga0500641_0000631
484 Ga0500554_030384
485 Ga0500555_000042
486 Ga0500556_0001687
487 Ga0500562_000786
488 Ga0500562_012848
489 Ga0500594_0000437
490 Ga0500594_0001896
491 Ga0500595_022792
492 Ga0500608_001004
493 Ga0500658_0000198
494 Ga0500559_0002849
495 Ga0500559_0019967
496 Ga0500564_000122
497 Ga0500577_0006366
498 Ga0500616_0045490
499 Ga0500622_0011138
500 Ga0500624_000107
501 2512643253
502 2585150168
503 2585155611
504 2585199377
505 2587919839
506 2600203257
507 2643748405
508 2643781927
509 2643929589
510 2644223534
511 2644227942
512 2644236377
513 2644236712
514 2644508206
515 2753766783
516 2792461922
517 2819536928
518 2819575827
519 2819645179
520 2821138380
521 2843748783
522 2849562147
523 2849578849
524 2851156499
525 2851156585
526 2857505913
527 2884965351
528 2898330254
529 2904469176
530 2919710362
531 2928519094
532 2928531980
533 2929244048
534 2946791272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06379

RhaT

L-rhamnose-proton symport protein (RhaT)

45

405

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.6742 4 346
7b0k-assembly1.cif.gz_A membrane protein structure 0.6674 4 346
5oge-assembly2.cif.gz_B crystal structure of a nucleotide sugar transporter 0.6669 3 346
6qsk-assembly2.cif.gz_G-2 crystal structure of a nucleotide sugar transporter with bound nucleotide monophosphate. 0.6646 1 346
5oge-assembly3.cif.gz_H-2 crystal structure of a nucleotide sugar transporter 0.6605 3 346
ID Description Score Start End Superfamily
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7289 7 354 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7247 7 354 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7144 1 349 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7035 1 349 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.5699 11 352 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7X7ZK03-F1-model_v4 L-rhamnose/proton symporter RhaT 0.9605 1 353 GO:0003755
GO:0005886
GO:0015153
GO:0015293
AF-A0A7V6HEX9-F1-model_v4 Rhamnose/proton symporter RhaT 0.9605 4 349 GO:0005886
GO:0015153
GO:0015293
AF-A0A7X7MRC4-F1-model_v4 L-rhamnose/proton symporter RhaT 0.9531 2 352 GO:0005886
GO:0015153
GO:0015293
AF-A0A7X7ZK03-F1-model_v4 L-rhamnose/proton symporter RhaT 0.95 1 353 GO:0003755
GO:0005886
GO:0015153
GO:0015293
AF-A0A0G3ED05-F1-model_v4 L-rhamnose-H(+) transport protein 0.9474 4 353 GO:0005886
GO:0015153
GO:0015293

Map