F374600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 147 | 267 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100145174|Ga0070706_1001451742 |
| Length | 369 |
| Sequence | VKSPALNKFAAWSAACGDILAHLRRSVPEVGLRHTKRLLLPVFVLATGLSCAPLQLIAQQSATPAVAKSKIIVDTDIGDDIDDAFALALAMRSPELEILGITTAWGDTELRARLVQRFLKENGAPDVLIAPGVPTKSTAVFSQARWAQDGPPFQKQVDAAEFLLQQVRKAPGEITLVAIGPLTNIGSAIDRDAAAFKKLKRVVLMGGSIRRGYGDLGYAPDRGPQPEYNIYSDVAAAQKLFASGVPIFMMPLDSTQLMLDEVKRNILFSAGTPMTNSLAALYYQWAERNRTPTPTLFDVMAVAYVIQPELCPAEPLRITVDAQGLTRSSPGTPNAAACLVSDSEKFFHFLLPRLMAPASVSISVHAAKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 113 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 117 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 119 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 120 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 121 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 142 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 143 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 2.62 |
| Rhizosphere | 96.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10354795 | 3300003323 | Unclassified | 1376 |
| 2 | Ga0065707_10117349 | 3300005295 | Bacteria | 2214 |
| 3 | Ga0070658_10026960 | 3300005327 | Bacteria | 4613 |
| 4 | Ga0070683_100034877 | 3300005329 | Bacteria | 4598 |
| 5 | Ga0070683_100062714 | 3300005329 | Bacteria | 3456 |
| 6 | Ga0068869_100002382 | 3300005334 | Bacteria | 11322 |
| 7 | Ga0070666_10029861 | 3300005335 | Bacteria | 3587 |
| 8 | Ga0068868_100009842 | 3300005338 | Bacteria | 6901 |
| 9 | Ga0068868_100013856 | 3300005338 | Bacteria | 5926 |
| 10 | Ga0068868_100142878 | 3300005338 | Bacteria | 1966 |
| 11 | Ga0070661_100014560 | 3300005344 | Bacteria | 5543 |
| 12 | Ga0070671_100000449 | 3300005355 | Bacteria | 28636 |
| 13 | Ga0070667_100080801 | 3300005367 | Bacteria | 2781 |
| 14 | Ga0070709_10000874 | 3300005434 | Bacteria | 16864 |
| 15 | Ga0070709_10011125 | 3300005434 | Bacteria | 5004 |
| 16 | Ga0070709_10086370 | 3300005434 | Bacteria | 2059 |
| 17 | Ga0070709_10138718 | 3300005434 | Bacteria | 1668 |
| 18 | Ga0070714_100033590 | 3300005435 | Bacteria | 4290 |
| 19 | Ga0070714_100074132 | 3300005435 | Bacteria | 2950 |
| 20 | Ga0070713_100000452 | 3300005436 | Bacteria | 26240 |
| 21 | Ga0070713_100019626 | 3300005436 | Bacteria | 5168 |
| 22 | Ga0070713_100109411 | 3300005436 | Bacteria | 2408 |
| 23 | Ga0070711_100014491 | 3300005439 | Bacteria | 4968 |
| 24 | Ga0070711_100088597 | 3300005439 | Bacteria | 2224 |
| 25 | Ga0070708_100002661 | 3300005445 | Bacteria | 13833 |
| 26 | Ga0070708_100034597 | 3300005445 | Bacteria | 4397 |
| 27 | Ga0070678_100096203 | 3300005456 | Unclassified | 2284 |
| 28 | Ga0070681_10007455 | 3300005458 | Bacteria | 10693 |
| 29 | Ga0070706_100034637 | 3300005467 | Bacteria | 4664 |
| 30 | Ga0070706_100087618 | 3300005467 | Unclassified | 2886 |
| 31 | Ga0070706_100145174 | 3300005467 | Bacteria | 2216 |
| 32 | Ga0070706_100200858 | 3300005467 | Bacteria | 1862 |
| 33 | Ga0070707_100022278 | 3300005468 | Bacteria | 5989 |
| 34 | Ga0070707_100038557 | 3300005468 | Bacteria | 4564 |
| 35 | Ga0070698_100134551 | 3300005471 | Bacteria | 2426 |
| 36 | Ga0070699_100333557 | 3300005518 | Bacteria | 1364 |
| 37 | Ga0070679_100089991 | 3300005530 | Bacteria | 3057 |
| 38 | Ga0070684_100077111 | 3300005535 | Bacteria | 2943 |
| 39 | Ga0070684_100113140 | 3300005535 | Bacteria | 2435 |
| 40 | Ga0070697_100006132 | 3300005536 | Bacteria | 9300 |
| 41 | Ga0070697_100019969 | 3300005536 | Bacteria | 5295 |
| 42 | Ga0068853_100078815 | 3300005539 | Bacteria | 2880 |
| 43 | Ga0068853_100079520 | 3300005539 | Bacteria | 2867 |
| 44 | Ga0070693_100015706 | 3300005547 | Bacteria | 3903 |
| 45 | Ga0070665_100002681 | 3300005548 | Bacteria | 19338 |
| 46 | Ga0070665_100422944 | 3300005548 | Unclassified | 1341 |
| 47 | Ga0070704_100072084 | 3300005549 | Bacteria | 2512 |
| 48 | Ga0068855_100001109 | 3300005563 | Bacteria | 33489 |
| 49 | Ga0068855_100017303 | 3300005563 | Bacteria | 8675 |
| 50 | Ga0068855_100176651 | 3300005563 | Bacteria | 2416 |
| 51 | Ga0068857_100015910 | 3300005577 | Bacteria | 6585 |
| 52 | Ga0068857_100034398 | 3300005577 | Bacteria | 4483 |
| 53 | Ga0068857_100276302 | 3300005577 | Bacteria | 1544 |
| 54 | Ga0068854_100098780 | 3300005578 | Bacteria | 2185 |
| 55 | Ga0068854_100130628 | 3300005578 | Bacteria | 1917 |
| 56 | Ga0068856_100022075 | 3300005614 | Bacteria | 6189 |
| 57 | Ga0068856_100051709 | 3300005614 | Bacteria | 4050 |
| 58 | Ga0068856_100070301 | 3300005614 | Bacteria | 3463 |
| 59 | Ga0068856_100076240 | 3300005614 | Bacteria | 3322 |
| 60 | Ga0068856_100082962 | 3300005614 | Bacteria | 3182 |
| 61 | Ga0068852_100000287 | 3300005616 | Bacteria | 33809 |
| 62 | Ga0068852_100128713 | 3300005616 | Bacteria | 2329 |
| 63 | Ga0068852_100170244 | 3300005616 | Bacteria | 2041 |
| 64 | Ga0068859_100054364 | 3300005617 | Bacteria | 4027 |
| 65 | Ga0068864_100010793 | 3300005618 | Bacteria | 7549 |
| 66 | Ga0068866_10081670 | 3300005718 | Bacteria | 1737 |
| 67 | Ga0068866_10171925 | 3300005718 | Unclassified | 1273 |
| 68 | Ga0068863_100016054 | 3300005841 | Bacteria | 7181 |
| 69 | Ga0068863_100033343 | 3300005841 | Bacteria | 4905 |
| 70 | Ga0068858_100003731 | 3300005842 | Bacteria | 15073 |
| 71 | Ga0068860_100020554 | 3300005843 | Bacteria | 6396 |
| 72 | Ga0068860_100074064 | 3300005843 | Unclassified | 3237 |
| 73 | Ga0068860_100156574 | 3300005843 | Unclassified | 2196 |
| 74 | Ga0068862_100143270 | 3300005844 | Bacteria | 2122 |
| 75 | Ga0081455_10102574 | 3300005937 | Bacteria | 2293 |
| 76 | Ga0070717_10035469 | 3300006028 | Unclassified | 4038 |
| 77 | Ga0070717_10043705 | 3300006028 | Bacteria | 3657 |
| 78 | Ga0070716_100000547 | 3300006173 | Bacteria | 15776 |
| 79 | Ga0070716_100010001 | 3300006173 | Bacteria | 4743 |
| 80 | Ga0070716_100015693 | 3300006173 | Unclassified | 3897 |
| 81 | Ga0070716_100035756 | 3300006173 | Bacteria | 2733 |
| 82 | Ga0070716_100198343 | 3300006173 | Unclassified | 1332 |
| 83 | Ga0070712_100000238 | 3300006175 | Bacteria | 30830 |
| 84 | Ga0070712_100041657 | 3300006175 | Bacteria | 3154 |
| 85 | Ga0097621_100001165 | 3300006237 | Bacteria | 18212 |
| 86 | Ga0097621_100028952 | 3300006237 | Bacteria | 4371 |
| 87 | Ga0097621_100213669 | 3300006237 | Bacteria | 1678 |
| 88 | Ga0068871_100024984 | 3300006358 | Bacteria | 4641 |
| 89 | Ga0068871_100045691 | 3300006358 | Bacteria | 3525 |
| 90 | Ga0075433_10195091 | 3300006852 | Bacteria | 1801 |
| 91 | Ga0075434_100003427 | 3300006871 | Bacteria | 14182 |
| 92 | Ga0075434_100005849 | 3300006871 | Bacteria | 11232 |
| 93 | Ga0075436_100117973 | 3300006914 | Unclassified | 1855 |
| 94 | Ga0097620_100054364 | 3300006931 | Bacteria | 4027 |
| 95 | Ga0075435_100059350 | 3300007076 | Unclassified | 3101 |
| 96 | Ga0075435_100095461 | 3300007076 | Unclassified | 2459 |
| 97 | Ga0105240_10000928 | 3300009093 | Bacteria | 52175 |
| 98 | Ga0105240_10001982 | 3300009093 | Bacteria | 33815 |
| 99 | Ga0105240_10019112 | 3300009093 | Bacteria | 9162 |
| 100 | Ga0105240_10027102 | 3300009093 | Bacteria | 7509 |
| 101 | Ga0105240_10030057 | 3300009093 | Bacteria | 7066 |
| 102 | Ga0105240_10037915 | 3300009093 | Bacteria | 6189 |
| 103 | Ga0105240_10086059 | 3300009093 | Bacteria | 3850 |
| 104 | Ga0105240_10551750 | 3300009093 | Bacteria | 1275 |
| 105 | Ga0105245_10002633 | 3300009098 | Bacteria | 16149 |
| 106 | Ga0105245_10006593 | 3300009098 | Bacteria | 10191 |
| 107 | Ga0105247_10051784 | 3300009101 | Bacteria | 2530 |
| 108 | Ga0105247_10061952 | 3300009101 | Bacteria | 2320 |
| 109 | Ga0105241_10000748 | 3300009174 | Bacteria | 24713 |
| 110 | Ga0105241_10070209 | 3300009174 | Bacteria | 2717 |
| 111 | Ga0105241_10082483 | 3300009174 | Bacteria | 2520 |
| 112 | Ga0105241_10357143 | 3300009174 | Unclassified | 1270 |
| 113 | Ga0105242_10147627 | 3300009176 | Bacteria | 2047 |
| 114 | Ga0105248_10002627 | 3300009177 | Bacteria | 19981 |
| 115 | Ga0105248_10009624 | 3300009177 | Bacteria | 10641 |
| 116 | Ga0105248_10042394 | 3300009177 | Bacteria | 5103 |
| 117 | Ga0105248_10139924 | 3300009177 | Unclassified | 2730 |
| 118 | Ga0105237_10159785 | 3300009545 | Bacteria | 2252 |
| 119 | Ga0105237_10336661 | 3300009545 | Bacteria | 1513 |
| 120 | Ga0105238_10001997 | 3300009551 | Bacteria | 20559 |
| 121 | Ga0105238_10026335 | 3300009551 | Bacteria | 5927 |
| 122 | Ga0105238_10074897 | 3300009551 | Bacteria | 3377 |
| 123 | Ga0105238_10080245 | 3300009551 | Bacteria | 3252 |
| 124 | Ga0105249_10261210 | 3300009553 | Bacteria | 1721 |
| 125 | Ga0105239_10031502 | 3300010375 | Bacteria | 5831 |
| 126 | Ga0105239_10039597 | 3300010375 | Bacteria | 5163 |
| 127 | Ga0105239_10109217 | 3300010375 | Bacteria | 3065 |
| 128 | Ga0105246_10042910 | 3300011119 | Bacteria | 3065 |
| 129 | Ga0157370_10001105 | 3300013104 | Bacteria | 33807 |
| 130 | Ga0157369_10001102 | 3300013105 | Bacteria | 33815 |
| 131 | Ga0157369_10024918 | 3300013105 | Bacteria | 6647 |
| 132 | Ga0157369_10056700 | 3300013105 | Bacteria | 4227 |
| 133 | Ga0157374_10033618 | 3300013296 | Bacteria | 4680 |
| 134 | Ga0157374_10191038 | 3300013296 | Bacteria | 2003 |
| 135 | Ga0157374_10441070 | 3300013296 | Bacteria | 1302 |
| 136 | Ga0157378_10000646 | 3300013297 | Bacteria | 32777 |
| 137 | Ga0157378_10007009 | 3300013297 | Bacteria | 9834 |
| 138 | Ga0157378_10018013 | 3300013297 | Bacteria | 6200 |
| 139 | Ga0157378_10049673 | 3300013297 | Bacteria | 3732 |
| 140 | Ga0157378_10066622 | 3300013297 | Bacteria | 3226 |
| 141 | Ga0163162_10088058 | 3300013306 | Bacteria | 3184 |
| 142 | Ga0157372_10000816 | 3300013307 | Bacteria | 33749 |
| 143 | Ga0157372_10019965 | 3300013307 | Bacteria | 7223 |
| 144 | Ga0157372_10376314 | 3300013307 | Bacteria | 1655 |
| 145 | Ga0157375_10055531 | 3300013308 | Bacteria | 3906 |
| 146 | Ga0157375_10388082 | 3300013308 | Unclassified | 1563 |
| 147 | Ga0157375_10517726 | 3300013308 | Unclassified | 1356 |
| 148 | Ga0163163_10012296 | 3300014325 | Bacteria | 7796 |
| 149 | Ga0157379_10007227 | 3300014968 | Bacteria | 9607 |
| 150 | Ga0157379_10252308 | 3300014968 | Bacteria | 1602 |
| 151 | Ga0157376_10000004 | 3300014969 | Bacteria | 508493 |
| 152 | Ga0157376_10002058 | 3300014969 | Bacteria | 13498 |
| 153 | Ga0157376_10157518 | 3300014969 | Bacteria | 2055 |
| 154 | Ga0207680_10028179 | 3300025903 | Bacteria | 3138 |
| 155 | Ga0207699_10004454 | 3300025906 | Bacteria | 6700 |
| 156 | Ga0207699_10008836 | 3300025906 | Bacteria | 4990 |
| 157 | Ga0207699_10094577 | 3300025906 | Bacteria | 1882 |
| 158 | Ga0207705_10025697 | 3300025909 | Bacteria | 4201 |
| 159 | Ga0207705_10095829 | 3300025909 | Bacteria | 2178 |
| 160 | Ga0207684_10005750 | 3300025910 | Bacteria | 11388 |
| 161 | Ga0207654_10000206 | 3300025911 | Bacteria | 36317 |
| 162 | Ga0207654_10000839 | 3300025911 | Bacteria | 16937 |
| 163 | Ga0207654_10286747 | 3300025911 | Unclassified | 1115 |
| 164 | Ga0207707_10193885 | 3300025912 | Bacteria | 1772 |
| 165 | Ga0207695_10000384 | 3300025913 | Bacteria | 100121 |
| 166 | Ga0207695_10001801 | 3300025913 | Bacteria | 33823 |
| 167 | Ga0207695_10002863 | 3300025913 | Bacteria | 25073 |
| 168 | Ga0207695_10013112 | 3300025913 | Bacteria | 9894 |
| 169 | Ga0207695_10025110 | 3300025913 | Bacteria | 6683 |
| 170 | Ga0207695_10034855 | 3300025913 | Bacteria | 5467 |
| 171 | Ga0207671_10031193 | 3300025914 | Bacteria | 3972 |
| 172 | Ga0207693_10000182 | 3300025915 | Bacteria | 57166 |
| 173 | Ga0207693_10053254 | 3300025915 | Unclassified | 3175 |
| 174 | Ga0207693_10099638 | 3300025915 | Bacteria | 2278 |
| 175 | Ga0207663_10053008 | 3300025916 | Bacteria | 2532 |
| 176 | Ga0207663_10130323 | 3300025916 | Bacteria | 1737 |
| 177 | Ga0207652_10576179 | 3300025921 | Unclassified | 1010 |
| 178 | Ga0207646_10000274 | 3300025922 | Bacteria | 70391 |
| 179 | Ga0207646_10031852 | 3300025922 | Bacteria | 4772 |
| 180 | Ga0207646_10290588 | 3300025922 | Bacteria | 1477 |
| 181 | Ga0207694_10000497 | 3300025924 | Bacteria | 35591 |
| 182 | Ga0207694_10001153 | 3300025924 | Bacteria | 22947 |
| 183 | Ga0207650_10006233 | 3300025925 | Bacteria | 8127 |
| 184 | Ga0207700_10010892 | 3300025928 | Bacteria | 5771 |
| 185 | Ga0207700_10013507 | 3300025928 | Bacteria | 5317 |
| 186 | Ga0207700_10087686 | 3300025928 | Bacteria | 2448 |
| 187 | Ga0207700_10189150 | 3300025928 | Unclassified | 1729 |
| 188 | Ga0207664_10028776 | 3300025929 | Bacteria | 4226 |
| 189 | Ga0207644_10009217 | 3300025931 | Bacteria | 6475 |
| 190 | Ga0207686_10017364 | 3300025934 | Bacteria | 4054 |
| 191 | Ga0207665_10000038 | 3300025939 | Bacteria | 85922 |
| 192 | Ga0207665_10004647 | 3300025939 | Bacteria | 9120 |
| 193 | Ga0207665_10055855 | 3300025939 | Unclassified | 2665 |
| 194 | Ga0207665_10125666 | 3300025939 | Bacteria | 1816 |
| 195 | Ga0207665_10160657 | 3300025939 | Bacteria | 1616 |
| 196 | Ga0207665_10191973 | 3300025939 | Unclassified | 1484 |
| 197 | Ga0207711_10005595 | 3300025941 | Bacteria | 10621 |
| 198 | Ga0207711_10439022 | 3300025941 | Bacteria | 1215 |
| 199 | Ga0207689_10001472 | 3300025942 | Bacteria | 22548 |
| 200 | Ga0207667_10001336 | 3300025949 | Bacteria | 30925 |
| 201 | Ga0207667_10068135 | 3300025949 | Bacteria | 3706 |
| 202 | Ga0207667_10458442 | 3300025949 | Unclassified | 1295 |
| 203 | Ga0207712_10304388 | 3300025961 | Unclassified | 1309 |
| 204 | Ga0207640_10198204 | 3300025981 | Bacteria | 1519 |
| 205 | Ga0207658_10000185 | 3300025986 | Bacteria | 66636 |
| 206 | Ga0207677_10002966 | 3300026023 | Bacteria | 8960 |
| 207 | Ga0207677_10006201 | 3300026023 | Bacteria | 6535 |
| 208 | Ga0207703_10004873 | 3300026035 | Bacteria | 10915 |
| 209 | Ga0207639_10048820 | 3300026041 | Bacteria | 3206 |
| 210 | Ga0207678_10113877 | 3300026067 | Bacteria | 2308 |
| 211 | Ga0207702_10043509 | 3300026078 | Bacteria | 3770 |
| 212 | Ga0207702_10146325 | 3300026078 | Bacteria | 2144 |
| 213 | Ga0207641_10026017 | 3300026088 | Bacteria | 4827 |
| 214 | Ga0207676_10009071 | 3300026095 | Bacteria | 7083 |
| 215 | Ga0207674_10017420 | 3300026116 | Bacteria | 7839 |
| 216 | Ga0207674_10023438 | 3300026116 | Bacteria | 6612 |
| 217 | Ga0207674_10087995 | 3300026116 | Bacteria | 3099 |
| 218 | Ga0207683_10118401 | 3300026121 | Bacteria | 2376 |
| 219 | Ga0207698_10000239 | 3300026142 | Bacteria | 34266 |
| 220 | Ga0209588_1038685 | 3300027671 | Bacteria | 1537 |
| 221 | Ga0268266_10000383 | 3300028379 | Bacteria | 67390 |
| 222 | Ga0268264_10010288 | 3300028381 | Bacteria | 7743 |
| 223 | Ga0268264_10138279 | 3300028381 | Bacteria | 2169 |
| 224 | Ga0265338_10005092 | 3300028800 | Bacteria | 17346 |
| 225 | Ga0265338_10007533 | 3300028800 | Bacteria | 13464 |
| 226 | Ga0265325_10064921 | 3300031241 | Bacteria | 1845 |
| 227 | Ga0265340_10136134 | 3300031247 | Bacteria | 1125 |
| 228 | Ga0265342_10058652 | 3300031712 | Bacteria | 2275 |
| 229 | Ga0373934_0026824 | 3300035086 | Bacteria | 2236 |
| 230 | Ga0373924_0042490 | 3300035410 | Bacteria | 1865 |
| 231 | Ga0373931_0057333 | 3300035691 | Bacteria | 2089 |
| 232 | Ga0373927_0096277 | 3300035695 | Bacteria | 1924 |
| 233 | Ga0466963_0006194 | 3300044694 | Bacteria | 7065 |
| 234 | Ga0466967_0007962 | 3300045976 | Bacteria | 7711 |
| 235 | Ga0495641_0028981 | 3300046461 | Unclassified | 2673 |
| 236 | Ga0495641_0086000 | 3300046461 | Unclassified | 1407 |
| 237 | Ga0495580_0000180 | 3300046472 | Bacteria | 47295 |
| 238 | Ga0495580_0065890 | 3300046472 | Unclassified | 2536 |
| 239 | Ga0495582_0000348 | 3300046473 | Bacteria | 25338 |
| 240 | Ga0495582_0118483 | 3300046473 | Bacteria | 1490 |
| 241 | Ga0495639_0057343 | 3300046475 | Bacteria | 1779 |
| 242 | Ga0495630_0091221 | 3300046517 | Bacteria | 2302 |
| 243 | Ga0495666_0034326 | 3300046526 | Unclassified | 2476 |
| 244 | Ga0495640_0093273 | 3300046533 | Unclassified | 1984 |
| 245 | Ga0495661_0094370 | 3300046665 | Bacteria | 1696 |
| 246 | Ga0495647_0029160 | 3300046681 | Unclassified | 2039 |
| 247 | Ga0495658_0129504 | 3300046683 | Unclassified | 1534 |
| 248 | Ga0495613_0109790 | 3300046689 | Unclassified | 1988 |
| 249 | Ga0495674_0033940 | 3300047319 | Unclassified | 4617 |
| 250 | Ga0495674_0223443 | 3300047319 | Unclassified | 1556 |
| 251 | Ga0495676_0104406 | 3300047321 | Unclassified | 2091 |
| 252 | Ga0495680_0036733 | 3300047322 | Unclassified | 3930 |
| 253 | Ga0495684_0056736 | 3300047471 | Unclassified | 2985 |
| 254 | Ga0495602_0273824 | 3300048088 | Unclassified | 1246 |
| 255 | Ga0496101_0111828 | 3300048904 | Bacteria | 2057 |
| 256 | Ga0496102_0009469 | 3300048905 | Bacteria | 8373 |
| 257 | Ga0496104_0441688 | 3300048907 | Bacteria | 1213 |
| 258 | Ga0496112_0186351 | 3300048915 | Bacteria | 2038 |
| 259 | Ga0496114_0007894 | 3300048917 | Bacteria | 8421 |
| 260 | Ga0496115_0013399 | 3300048918 | Bacteria | 6201 |
| 261 | Ga0496115_0085223 | 3300048918 | Bacteria | 2577 |
| 262 | nmdc:mga0n895_125989_c1 | 3300050512 | Bacteria | 2585 |
| 263 | nmdc:mga0rr50_129264_c1 | 3300050513 | Unclassified | 2020 |
| 264 | nmdc:mga0rr50_49231_c1 | 3300050513 | Unclassified | 3119 |
| 265 | nmdc:mga08x19_1281_c1 | 3300050514 | Bacteria | 15604 |
| 266 | nmdc:mga0a205_247465_c1 | 3300050515 | Bacteria | 1663 |
| 267 | Ga0500661_000213 | 3300055283 | Bacteria | 10346 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100019969 | Ga0070697_1000199694 | 284 |
| 2 | 3300009177 | Ga0105248_10042394 | Ga0105248_100423944 | 284 |
| 3 | 3300009553 | Ga0105249_10261210 | Ga0105249_102612102 | 284 |
| 4 | 3300005843 | Ga0068860_100020554 | Ga0068860_1000205544 | 286 |
| 5 | 3300025961 | Ga0207712_10304388 | Ga0207712_103043881 | 286 |
| 6 | 3300005435 | Ga0070714_100033590 | Ga0070714_1000335903 | 288 |
| 7 | 3300025929 | Ga0207664_10028776 | Ga0207664_100287763 | 288 |
| 8 | 3300013296 | Ga0157374_10441070 | Ga0157374_104410701 | 289 |
| 9 | 3300025924 | Ga0207694_10001153 | Ga0207694_100011537 | 289 |
| 10 | 3300046461 | Ga0495641_0028981 | Ga0495641_0028981_258_1265 | 289 |
| 11 | 3300046472 | Ga0495580_0000180 | Ga0495580_0000180_22810_23817 | 289 |
| 12 | 3300046473 | Ga0495582_0000348 | Ga0495582_0000348_13109_14116 | 289 |
| 13 | 3300013297 | Ga0157378_10000646 | Ga0157378_100006468 | 291 |
| 14 | 3300048905 | Ga0496102_0009469 | Ga0496102_0009469_4437_5420 | 291 |
| 15 | 3300048915 | Ga0496112_0186351 | Ga0496112_0186351_379_1362 | 291 |
| 16 | 3300035410 | Ga0373924_0042490 | Ga0373924_0042490_182_1066 | 292 |
| 17 | 3300035695 | Ga0373927_0096277 | Ga0373927_0096277_962_1858 | 292 |
| 18 | 3300005549 | Ga0070704_100072084 | Ga0070704_1000720842 | 293 |
| 19 | 3300005456 | Ga0070678_100096203 | Ga0070678_1000962033 | 296 |
| 20 | 3300005548 | Ga0070665_100422944 | Ga0070665_1004229442 | 296 |
| 21 | 3300005578 | Ga0068854_100130628 | Ga0068854_1001306282 | 296 |
| 22 | 3300005718 | Ga0068866_10171925 | Ga0068866_101719252 | 296 |
| 23 | 3300005843 | Ga0068860_100074064 | Ga0068860_1000740643 | 296 |
| 24 | 3300006237 | Ga0097621_100001165 | Ga0097621_10000116513 | 296 |
| 25 | 3300006358 | Ga0068871_100024984 | Ga0068871_1000249844 | 296 |
| 26 | 3300025903 | Ga0207680_10028179 | Ga0207680_100281793 | 296 |
| 27 | 3300025911 | Ga0207654_10286747 | Ga0207654_102867471 | 296 |
| 28 | 3300025981 | Ga0207640_10198204 | Ga0207640_101982042 | 296 |
| 29 | 3300026023 | Ga0207677_10006201 | Ga0207677_100062012 | 296 |
| 30 | 3300026121 | Ga0207683_10118401 | Ga0207683_101184012 | 296 |
| 31 | 3300028381 | Ga0268264_10138279 | Ga0268264_101382791 | 296 |
| 32 | 3300047319 | Ga0495674_0223443 | Ga0495674_0223443_226_1230 | 296 |
| 33 | 3300048918 | Ga0496115_0085223 | Ga0496115_0085223_1667_2563 | 296 |
| 34 | 3300007076 | Ga0075435_100059350 | Ga0075435_1000593503 | 300 |
| 35 | 3300050513 | nmdc:mga0rr50_49231_c1 | nmdc:mga0rr50_49231_c1_168_1175 | 300 |
| 36 | 3300031247 | Ga0265340_10136134 | Ga0265340_101361341 | 302 |
| 37 | 3300035086 | Ga0373934_0026824 | Ga0373934_0026824_1259_2173 | 302 |
| 38 | 3300005458 | Ga0070681_10007455 | Ga0070681_1000745513 | 303 |
| 39 | 3300005530 | Ga0070679_100089991 | Ga0070679_1000899912 | 303 |
| 40 | 3300005614 | Ga0068856_100070301 | Ga0068856_1000703011 | 303 |
| 41 | 3300006028 | Ga0070717_10043705 | Ga0070717_100437052 | 303 |
| 42 | 3300006173 | Ga0070716_100000547 | Ga0070716_1000005472 | 303 |
| 43 | 3300006173 | Ga0070716_100015693 | Ga0070716_1000156934 | 303 |
| 44 | 3300009093 | Ga0105240_10086059 | Ga0105240_100860593 | 303 |
| 45 | 3300009174 | Ga0105241_10357143 | Ga0105241_103571431 | 303 |
| 46 | 3300025912 | Ga0207707_10193885 | Ga0207707_101938852 | 303 |
| 47 | 3300025913 | Ga0207695_10034855 | Ga0207695_100348553 | 303 |
| 48 | 3300025915 | Ga0207693_10053254 | Ga0207693_100532544 | 303 |
| 49 | 3300025921 | Ga0207652_10576179 | Ga0207652_105761791 | 303 |
| 50 | 3300025939 | Ga0207665_10000038 | Ga0207665_100000384 | 303 |
| 51 | 3300025939 | Ga0207665_10191973 | Ga0207665_101919732 | 303 |
| 52 | 3300025949 | Ga0207667_10458442 | Ga0207667_104584421 | 303 |
| 53 | 3300046517 | Ga0495630_0091221 | Ga0495630_0091221_1215_2138 | 303 |
| 54 | 3300005434 | Ga0070709_10086370 | Ga0070709_100863702 | 306 |
| 55 | 3300006028 | Ga0070717_10035469 | Ga0070717_100354691 | 307 |
| 56 | 3300005434 | Ga0070709_10000874 | Ga0070709_1000087414 | 308 |
| 57 | 3300005436 | Ga0070713_100000452 | Ga0070713_10000045215 | 308 |
| 58 | 3300005439 | Ga0070711_100088597 | Ga0070711_1000885972 | 308 |
| 59 | 3300006173 | Ga0070716_100035756 | Ga0070716_1000357562 | 308 |
| 60 | 3300006175 | Ga0070712_100000238 | Ga0070712_10000023815 | 308 |
| 61 | 3300025906 | Ga0207699_10004454 | Ga0207699_100044542 | 308 |
| 62 | 3300025915 | Ga0207693_10000182 | Ga0207693_1000018213 | 308 |
| 63 | 3300025916 | Ga0207663_10130323 | Ga0207663_101303231 | 308 |
| 64 | 3300025939 | Ga0207665_10160657 | Ga0207665_101606572 | 308 |
| 65 | 3300031241 | Ga0265325_10064921 | Ga0265325_100649212 | 309 |
| 66 | 3300005436 | Ga0070713_100109411 | Ga0070713_1001094113 | 310 |
| 67 | 3300009545 | Ga0105237_10159785 | Ga0105237_101597852 | 310 |
| 68 | 3300031712 | Ga0265342_10058652 | Ga0265342_100586522 | 310 |
| 69 | 3300005445 | Ga0070708_100034597 | Ga0070708_1000345971 | 311 |
| 70 | 3300025928 | Ga0207700_10013507 | Ga0207700_100135072 | 311 |
| 71 | 3300046665 | Ga0495661_0094370 | Ga0495661_0094370_545_1513 | 311 |
| 72 | 3300055283 | Ga0500661_000213 | Ga0500661_000213_3169_4134 | 311 |
| 73 | 3300005335 | Ga0070666_10029861 | Ga0070666_100298613 | 312 |
| 74 | 3300005338 | Ga0068868_100142878 | Ga0068868_1001428782 | 312 |
| 75 | 3300005547 | Ga0070693_100015706 | Ga0070693_1000157063 | 312 |
| 76 | 3300009098 | Ga0105245_10002633 | Ga0105245_100026334 | 312 |
| 77 | 3300009176 | Ga0105242_10147627 | Ga0105242_101476272 | 312 |
| 78 | 3300010375 | Ga0105239_10039597 | Ga0105239_100395972 | 312 |
| 79 | 3300013297 | Ga0157378_10018013 | Ga0157378_100180133 | 312 |
| 80 | 3300013308 | Ga0157375_10517726 | Ga0157375_105177262 | 312 |
| 81 | 3300048907 | Ga0496104_0441688 | Ga0496104_0441688_155_1156 | 313 |
| 82 | 3300014969 | Ga0157376_10000004 | Ga0157376_10000004327 | 314 |
| 83 | 3300028800 | Ga0265338_10007533 | Ga0265338_100075332 | 314 |
| 84 | 3300005329 | Ga0070683_100062714 | Ga0070683_1000627142 | 315 |
| 85 | 3300006852 | Ga0075433_10195091 | Ga0075433_101950912 | 315 |
| 86 | 3300006871 | Ga0075434_100003427 | Ga0075434_1000034272 | 315 |
| 87 | 3300026116 | Ga0207674_10017420 | Ga0207674_100174202 | 315 |
| 88 | 3300027671 | Ga0209588_1038685 | Ga0209588_10386852 | 315 |
| 89 | 3300050512 | nmdc:mga0n895_125989_c1 | nmdc:mga0n895_125989_c1_1043_2029 | 315 |
| 90 | 3300050515 | nmdc:mga0a205_247465_c1 | nmdc:mga0a205_247465_c1_82_1068 | 315 |
| 91 | 3300005434 | Ga0070709_10138718 | Ga0070709_101387182 | 317 |
| 92 | 3300005435 | Ga0070714_100074132 | Ga0070714_1000741323 | 317 |
| 93 | 3300005439 | Ga0070711_100014491 | Ga0070711_1000144914 | 317 |
| 94 | 3300025906 | Ga0207699_10094577 | Ga0207699_100945772 | 317 |
| 95 | 3300025916 | Ga0207663_10053008 | Ga0207663_100530082 | 317 |
| 96 | 3300028800 | Ga0265338_10005092 | Ga0265338_1000509210 | 318 |
| 97 | 3300005467 | Ga0070706_100034637 | Ga0070706_1000346372 | 319 |
| 98 | 3300005468 | Ga0070707_100022278 | Ga0070707_1000222784 | 319 |
| 99 | 3300006175 | Ga0070712_100041657 | Ga0070712_1000416574 | 319 |
| 100 | 3300025910 | Ga0207684_10005750 | Ga0207684_100057508 | 319 |
| 101 | 3300025915 | Ga0207693_10099638 | Ga0207693_100996381 | 319 |
| 102 | 3300005295 | Ga0065707_10117349 | Ga0065707_101173492 | 320 |
| 103 | 3300005548 | Ga0070665_100002681 | Ga0070665_10000268111 | 320 |
| 104 | 3300005718 | Ga0068866_10081670 | Ga0068866_100816702 | 320 |
| 105 | 3300005937 | Ga0081455_10102574 | Ga0081455_101025741 | 320 |
| 106 | 3300006173 | Ga0070716_100198343 | Ga0070716_1001983432 | 320 |
| 107 | 3300006914 | Ga0075436_100117973 | Ga0075436_1001179731 | 320 |
| 108 | 3300013297 | Ga0157378_10007009 | Ga0157378_100070094 | 320 |
| 109 | 3300013308 | Ga0157375_10055531 | Ga0157375_100555315 | 320 |
| 110 | 3300025928 | Ga0207700_10087686 | Ga0207700_100876863 | 320 |
| 111 | 3300025934 | Ga0207686_10017364 | Ga0207686_100173642 | 320 |
| 112 | 3300025939 | Ga0207665_10125666 | Ga0207665_101256663 | 320 |
| 113 | 3300028379 | Ga0268266_10000383 | Ga0268266_1000038336 | 320 |
| 114 | 3300035691 | Ga0373931_0057333 | Ga0373931_0057333_944_1927 | 320 |
| 115 | 3300050514 | nmdc:mga08x19_1281_c1 | nmdc:mga08x19_1281_c1_13106_14101 | 320 |
| 116 | 3300005434 | Ga0070709_10011125 | Ga0070709_100111255 | 321 |
| 117 | 3300006173 | Ga0070716_100010001 | Ga0070716_1000100013 | 321 |
| 118 | 3300025906 | Ga0207699_10008836 | Ga0207699_100088364 | 321 |
| 119 | 3300025928 | Ga0207700_10010892 | Ga0207700_100108925 | 321 |
| 120 | 3300025939 | Ga0207665_10004647 | Ga0207665_100046479 | 321 |
| 121 | 3300005445 | Ga0070708_100002661 | Ga0070708_10000266110 | 322 |
| 122 | 3300005467 | Ga0070706_100087618 | Ga0070706_1000876182 | 322 |
| 123 | 3300005467 | Ga0070706_100145174 | Ga0070706_1001451742 | 322 |
| 124 | 3300005467 | Ga0070706_100200858 | Ga0070706_1002008583 | 322 |
| 125 | 3300005468 | Ga0070707_100038557 | Ga0070707_1000385573 | 322 |
| 126 | 3300005841 | Ga0068863_100016054 | Ga0068863_1000160543 | 322 |
| 127 | 3300005843 | Ga0068860_100156574 | Ga0068860_1001565743 | 322 |
| 128 | 3300006237 | Ga0097621_100213669 | Ga0097621_1002136692 | 322 |
| 129 | 3300006871 | Ga0075434_100005849 | Ga0075434_1000058495 | 322 |
| 130 | 3300007076 | Ga0075435_100095461 | Ga0075435_1000954614 | 322 |
| 131 | 3300009177 | Ga0105248_10139924 | Ga0105248_101399242 | 322 |
| 132 | 3300013308 | Ga0157375_10388082 | Ga0157375_103880822 | 322 |
| 133 | 3300014969 | Ga0157376_10002058 | Ga0157376_100020586 | 322 |
| 134 | 3300025922 | Ga0207646_10000274 | Ga0207646_1000027429 | 322 |
| 135 | 3300025922 | Ga0207646_10031852 | Ga0207646_100318524 | 322 |
| 136 | 3300025939 | Ga0207665_10055855 | Ga0207665_100558552 | 322 |
| 137 | 3300046461 | Ga0495641_0086000 | Ga0495641_0086000_132_1190 | 322 |
| 138 | 3300046472 | Ga0495580_0065890 | Ga0495580_0065890_1145_2203 | 322 |
| 139 | 3300046473 | Ga0495582_0118483 | Ga0495582_0118483_412_1470 | 322 |
| 140 | 3300046475 | Ga0495639_0057343 | Ga0495639_0057343_539_1597 | 322 |
| 141 | 3300046526 | Ga0495666_0034326 | Ga0495666_0034326_218_1276 | 322 |
| 142 | 3300046533 | Ga0495640_0093273 | Ga0495640_0093273_825_1883 | 322 |
| 143 | 3300046681 | Ga0495647_0029160 | Ga0495647_0029160_770_1828 | 322 |
| 144 | 3300046683 | Ga0495658_0129504 | Ga0495658_0129504_412_1470 | 322 |
| 145 | 3300046689 | Ga0495613_0109790 | Ga0495613_0109790_622_1680 | 322 |
| 146 | 3300047319 | Ga0495674_0033940 | Ga0495674_0033940_2365_3423 | 322 |
| 147 | 3300047321 | Ga0495676_0104406 | Ga0495676_0104406_603_1661 | 322 |
| 148 | 3300047322 | Ga0495680_0036733 | Ga0495680_0036733_280_1338 | 322 |
| 149 | 3300047471 | Ga0495684_0056736 | Ga0495684_0056736_622_1680 | 322 |
| 150 | 3300048904 | Ga0496101_0111828 | Ga0496101_0111828_449_1504 | 322 |
| 151 | 3300048918 | Ga0496115_0013399 | Ga0496115_0013399_4880_5935 | 322 |
| 152 | 3300050513 | nmdc:mga0rr50_129264_c1 | nmdc:mga0rr50_129264_c1_388_1377 | 322 |
| 153 | 3300005471 | Ga0070698_100134551 | Ga0070698_1001345512 | 323 |
| 154 | 3300005518 | Ga0070699_100333557 | Ga0070699_1003335571 | 323 |
| 155 | 3300005536 | Ga0070697_100006132 | Ga0070697_1000061326 | 323 |
| 156 | 3300025922 | Ga0207646_10290588 | Ga0207646_102905881 | 323 |
| 157 | 3300048917 | Ga0496114_0007894 | Ga0496114_0007894_1176_2183 | 323 |
| 158 | 3300044694 | Ga0466963_0006194 | Ga0466963_0006194_5153_6136 | 326 |
| 159 | 3300045976 | Ga0466967_0007962 | Ga0466967_0007962_6550_7533 | 326 |
| 160 | 3300003323 | rootH1_10354795 | rootH1_103547951 | 327 |
| 161 | 3300005327 | Ga0070658_10026960 | Ga0070658_100269604 | 327 |
| 162 | 3300005329 | Ga0070683_100034877 | Ga0070683_1000348773 | 327 |
| 163 | 3300005334 | Ga0068869_100002382 | Ga0068869_1000023826 | 327 |
| 164 | 3300005338 | Ga0068868_100009842 | Ga0068868_1000098422 | 327 |
| 165 | 3300005338 | Ga0068868_100013856 | Ga0068868_1000138562 | 327 |
| 166 | 3300005344 | Ga0070661_100014560 | Ga0070661_1000145602 | 327 |
| 167 | 3300005355 | Ga0070671_100000449 | Ga0070671_1000004495 | 327 |
| 168 | 3300005367 | Ga0070667_100080801 | Ga0070667_1000808012 | 327 |
| 169 | 3300005436 | Ga0070713_100019626 | Ga0070713_1000196265 | 327 |
| 170 | 3300005535 | Ga0070684_100077111 | Ga0070684_1000771112 | 327 |
| 171 | 3300005535 | Ga0070684_100113140 | Ga0070684_1001131402 | 327 |
| 172 | 3300005539 | Ga0068853_100078815 | Ga0068853_1000788153 | 327 |
| 173 | 3300005539 | Ga0068853_100079520 | Ga0068853_1000795201 | 327 |
| 174 | 3300005563 | Ga0068855_100001109 | Ga0068855_10000110926 | 327 |
| 175 | 3300005563 | Ga0068855_100017303 | Ga0068855_1000173032 | 327 |
| 176 | 3300005563 | Ga0068855_100176651 | Ga0068855_1001766512 | 327 |
| 177 | 3300005577 | Ga0068857_100015910 | Ga0068857_1000159105 | 327 |
| 178 | 3300005577 | Ga0068857_100034398 | Ga0068857_1000343982 | 327 |
| 179 | 3300005577 | Ga0068857_100276302 | Ga0068857_1002763022 | 327 |
| 180 | 3300005578 | Ga0068854_100098780 | Ga0068854_1000987802 | 327 |
| 181 | 3300005614 | Ga0068856_100022075 | Ga0068856_1000220754 | 327 |
| 182 | 3300005614 | Ga0068856_100051709 | Ga0068856_1000517092 | 327 |
| 183 | 3300005614 | Ga0068856_100076240 | Ga0068856_1000762402 | 327 |
| 184 | 3300005614 | Ga0068856_100082962 | Ga0068856_1000829622 | 327 |
| 185 | 3300005616 | Ga0068852_100000287 | Ga0068852_1000002876 | 327 |
| 186 | 3300005616 | Ga0068852_100128713 | Ga0068852_1001287132 | 327 |
| 187 | 3300005616 | Ga0068852_100170244 | Ga0068852_1001702442 | 327 |
| 188 | 3300005617 | Ga0068859_100054364 | Ga0068859_1000543642 | 327 |
| 189 | 3300005618 | Ga0068864_100010793 | Ga0068864_1000107932 | 327 |
| 190 | 3300005841 | Ga0068863_100033343 | Ga0068863_1000333435 | 327 |
| 191 | 3300005842 | Ga0068858_100003731 | Ga0068858_1000037316 | 327 |
| 192 | 3300005844 | Ga0068862_100143270 | Ga0068862_1001432702 | 327 |
| 193 | 3300006237 | Ga0097621_100028952 | Ga0097621_1000289524 | 327 |
| 194 | 3300006358 | Ga0068871_100045691 | Ga0068871_1000456912 | 327 |
| 195 | 3300006931 | Ga0097620_100054364 | Ga0097620_1000543642 | 327 |
| 196 | 3300009093 | Ga0105240_10000928 | Ga0105240_1000092836 | 327 |
| 197 | 3300009093 | Ga0105240_10001982 | Ga0105240_1000198225 | 327 |
| 198 | 3300009093 | Ga0105240_10019112 | Ga0105240_100191122 | 327 |
| 199 | 3300009093 | Ga0105240_10027102 | Ga0105240_100271023 | 327 |
| 200 | 3300009093 | Ga0105240_10030057 | Ga0105240_100300572 | 327 |
| 201 | 3300009093 | Ga0105240_10037915 | Ga0105240_100379156 | 327 |
| 202 | 3300009093 | Ga0105240_10551750 | Ga0105240_105517501 | 327 |
| 203 | 3300009098 | Ga0105245_10006593 | Ga0105245_100065936 | 327 |
| 204 | 3300009101 | Ga0105247_10051784 | Ga0105247_100517842 | 327 |
| 205 | 3300009101 | Ga0105247_10061952 | Ga0105247_100619521 | 327 |
| 206 | 3300009174 | Ga0105241_10000748 | Ga0105241_100007486 | 327 |
| 207 | 3300009174 | Ga0105241_10070209 | Ga0105241_100702092 | 327 |
| 208 | 3300009174 | Ga0105241_10082483 | Ga0105241_100824832 | 327 |
| 209 | 3300009177 | Ga0105248_10002627 | Ga0105248_1000262725 | 327 |
| 210 | 3300009177 | Ga0105248_10009624 | Ga0105248_100096244 | 327 |
| 211 | 3300009545 | Ga0105237_10336661 | Ga0105237_103366611 | 327 |
| 212 | 3300009551 | Ga0105238_10001997 | Ga0105238_100019976 | 327 |
| 213 | 3300009551 | Ga0105238_10026335 | Ga0105238_100263352 | 327 |
| 214 | 3300009551 | Ga0105238_10074897 | Ga0105238_100748974 | 327 |
| 215 | 3300009551 | Ga0105238_10080245 | Ga0105238_100802452 | 327 |
| 216 | 3300010375 | Ga0105239_10031502 | Ga0105239_100315022 | 327 |
| 217 | 3300010375 | Ga0105239_10109217 | Ga0105239_101092172 | 327 |
| 218 | 3300011119 | Ga0105246_10042910 | Ga0105246_100429102 | 327 |
| 219 | 3300013104 | Ga0157370_10001105 | Ga0157370_1000110525 | 327 |
| 220 | 3300013105 | Ga0157369_10001102 | Ga0157369_1000110225 | 327 |
| 221 | 3300013105 | Ga0157369_10024918 | Ga0157369_100249187 | 327 |
| 222 | 3300013105 | Ga0157369_10056700 | Ga0157369_100567002 | 327 |
| 223 | 3300013296 | Ga0157374_10033618 | Ga0157374_100336182 | 327 |
| 224 | 3300013296 | Ga0157374_10191038 | Ga0157374_101910382 | 327 |
| 225 | 3300013297 | Ga0157378_10049673 | Ga0157378_100496732 | 327 |
| 226 | 3300013297 | Ga0157378_10066622 | Ga0157378_100666223 | 327 |
| 227 | 3300013306 | Ga0163162_10088058 | Ga0163162_100880584 | 327 |
| 228 | 3300013307 | Ga0157372_10000816 | Ga0157372_1000081625 | 327 |
| 229 | 3300013307 | Ga0157372_10019965 | Ga0157372_100199657 | 327 |
| 230 | 3300013307 | Ga0157372_10376314 | Ga0157372_103763141 | 327 |
| 231 | 3300014325 | Ga0163163_10012296 | Ga0163163_100122962 | 327 |
| 232 | 3300014968 | Ga0157379_10007227 | Ga0157379_100072273 | 327 |
| 233 | 3300014968 | Ga0157379_10252308 | Ga0157379_102523081 | 327 |
| 234 | 3300014969 | Ga0157376_10157518 | Ga0157376_101575182 | 327 |
| 235 | 3300025909 | Ga0207705_10025697 | Ga0207705_100256973 | 327 |
| 236 | 3300025909 | Ga0207705_10095829 | Ga0207705_100958292 | 327 |
| 237 | 3300025911 | Ga0207654_10000206 | Ga0207654_100002066 | 327 |
| 238 | 3300025911 | Ga0207654_10000839 | Ga0207654_1000083914 | 327 |
| 239 | 3300025913 | Ga0207695_10000384 | Ga0207695_1000038468 | 327 |
| 240 | 3300025913 | Ga0207695_10001801 | Ga0207695_100018016 | 327 |
| 241 | 3300025913 | Ga0207695_10002863 | Ga0207695_100028635 | 327 |
| 242 | 3300025913 | Ga0207695_10013112 | Ga0207695_100131124 | 327 |
| 243 | 3300025913 | Ga0207695_10025110 | Ga0207695_100251107 | 327 |
| 244 | 3300025914 | Ga0207671_10031193 | Ga0207671_100311932 | 327 |
| 245 | 3300025924 | Ga0207694_10000497 | Ga0207694_1000049724 | 327 |
| 246 | 3300025925 | Ga0207650_10006233 | Ga0207650_100062332 | 327 |
| 247 | 3300025928 | Ga0207700_10189150 | Ga0207700_101891502 | 327 |
| 248 | 3300025931 | Ga0207644_10009217 | Ga0207644_100092172 | 327 |
| 249 | 3300025941 | Ga0207711_10005595 | Ga0207711_100055955 | 327 |
| 250 | 3300025941 | Ga0207711_10439022 | Ga0207711_104390221 | 327 |
| 251 | 3300025942 | Ga0207689_10001472 | Ga0207689_1000147217 | 327 |
| 252 | 3300025949 | Ga0207667_10001336 | Ga0207667_1000133622 | 327 |
| 253 | 3300025949 | Ga0207667_10068135 | Ga0207667_100681354 | 327 |
| 254 | 3300025986 | Ga0207658_10000185 | Ga0207658_100001857 | 327 |
| 255 | 3300026023 | Ga0207677_10002966 | Ga0207677_100029663 | 327 |
| 256 | 3300026035 | Ga0207703_10004873 | Ga0207703_100048736 | 327 |
| 257 | 3300026041 | Ga0207639_10048820 | Ga0207639_100488202 | 327 |
| 258 | 3300026067 | Ga0207678_10113877 | Ga0207678_101138772 | 327 |
| 259 | 3300026078 | Ga0207702_10043509 | Ga0207702_100435093 | 327 |
| 260 | 3300026078 | Ga0207702_10146325 | Ga0207702_101463252 | 327 |
| 261 | 3300026088 | Ga0207641_10026017 | Ga0207641_100260172 | 327 |
| 262 | 3300026095 | Ga0207676_10009071 | Ga0207676_100090715 | 327 |
| 263 | 3300026116 | Ga0207674_10023438 | Ga0207674_100234382 | 327 |
| 264 | 3300026116 | Ga0207674_10087995 | Ga0207674_100879952 | 327 |
| 265 | 3300026142 | Ga0207698_10000239 | Ga0207698_100002396 | 327 |
| 266 | 3300028381 | Ga0268264_10010288 | Ga0268264_100102883 | 327 |
| 267 | 3300048088 | Ga0495602_0273824 | Ga0495602_0273824_88_1074 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zk5-assembly1.cif.gz_B | plant nucleoside hydrolase - zmnrh3 enzyme in complex with forodesine | 0.8526 | 38 | 327 |
| 6ba1-assembly1.cif.gz_E | purine-preferring ribonucleoside hydrolase from gardnerella vaginalis | 0.8392 | 38 | 325 |
| 4kpn-assembly1.cif.gz_B | plant nucleoside hydrolase - ppnrh1 enzyme | 0.8347 | 37 | 327 |
| 8ctm-assembly1.cif.gz_C | crystal structure of the nucleoside hydrolase from leishmania donovani. | 0.8346 | 37 | 325 |
| 6zk1-assembly1.cif.gz_B | plant nucleoside hydrolase - zmnrh2b enzyme | 0.8338 | 37 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6FCA6_2_364_3.90.245.10 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.8429 | 27 | 327 | 3.90.245.10 |
| af_Q9P6J4_1_308_3.90.245.10 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.8402 | 39 | 326 | 3.90.245.10 |
| 6ba1D00 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.839 | 38 | 325 | 3.90.245.10 |
| af_O50418_2_304_3.90.245.10 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.8365 | 39 | 325 | 3.90.245.10 |
| 4kpoB00 | Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like | 0.8326 | 37 | 327 | 3.90.245.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836ZQ98-F1-model_v4 | Nucleoside hydrolase | 0.9739 | 41 | 171 |
GO:0005829
GO:0006152 GO:0008477 |
| AF-Q8PNC9-F1-model_v4 | deleted | 0.9719 | 37 | 327 |
|
| AF-A0A2V8WL26-F1-model_v4 | Nucleoside hydrolase | 0.9694 | 37 | 327 |
GO:0005829
GO:0006152 GO:0008477 |
| AF-A0A2V9W1C3-F1-model_v4 | Nucleoside hydrolase | 0.9693 | 211 | 327 |
GO:0016799
|
| AF-A0A534HJM1-F1-model_v4 | Nucleoside hydrolase | 0.967 | 84 | 324 |
GO:0005829
GO:0006152 GO:0008477 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar