F374600

General Info

Members Datasets Scaffolds Average Seq Length
267 147 267 325

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100145174|Ga0070706_1001451742
Length 369
Sequence VKSPALNKFAAWSAACGDILAHLRRSVPEVGLRHTKRLLLPVFVLATGLSCAPLQLIAQQSATPAVAKSKIIVDTDIGDDIDDAFALALAMRSPELEILGITTAWGDTELRARLVQRFLKENGAPDVLIAPGVPTKSTAVFSQARWAQDGPPFQKQVDAAEFLLQQVRKAPGEITLVAIGPLTNIGSAIDRDAAAFKKLKRVVLMGGSIRRGYGDLGYAPDRGPQPEYNIYSDVAAAQKLFASGVPIFMMPLDSTQLMLDEVKRNILFSAGTPMTNSLAALYYQWAERNRTPTPTLFDVMAVAYVIQPELCPAEPLRITVDAQGLTRSSPGTPNAAACLVSDSEKFFHFLLPRLMAPASVSISVHAAKP

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 2.62
Rhizosphere 96.63
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10354795 3300003323 Unclassified 1376
2 Ga0065707_10117349 3300005295 Bacteria 2214
3 Ga0070658_10026960 3300005327 Bacteria 4613
4 Ga0070683_100034877 3300005329 Bacteria 4598
5 Ga0070683_100062714 3300005329 Bacteria 3456
6 Ga0068869_100002382 3300005334 Bacteria 11322
7 Ga0070666_10029861 3300005335 Bacteria 3587
8 Ga0068868_100009842 3300005338 Bacteria 6901
9 Ga0068868_100013856 3300005338 Bacteria 5926
10 Ga0068868_100142878 3300005338 Bacteria 1966
11 Ga0070661_100014560 3300005344 Bacteria 5543
12 Ga0070671_100000449 3300005355 Bacteria 28636
13 Ga0070667_100080801 3300005367 Bacteria 2781
14 Ga0070709_10000874 3300005434 Bacteria 16864
15 Ga0070709_10011125 3300005434 Bacteria 5004
16 Ga0070709_10086370 3300005434 Bacteria 2059
17 Ga0070709_10138718 3300005434 Bacteria 1668
18 Ga0070714_100033590 3300005435 Bacteria 4290
19 Ga0070714_100074132 3300005435 Bacteria 2950
20 Ga0070713_100000452 3300005436 Bacteria 26240
21 Ga0070713_100019626 3300005436 Bacteria 5168
22 Ga0070713_100109411 3300005436 Bacteria 2408
23 Ga0070711_100014491 3300005439 Bacteria 4968
24 Ga0070711_100088597 3300005439 Bacteria 2224
25 Ga0070708_100002661 3300005445 Bacteria 13833
26 Ga0070708_100034597 3300005445 Bacteria 4397
27 Ga0070678_100096203 3300005456 Unclassified 2284
28 Ga0070681_10007455 3300005458 Bacteria 10693
29 Ga0070706_100034637 3300005467 Bacteria 4664
30 Ga0070706_100087618 3300005467 Unclassified 2886
31 Ga0070706_100145174 3300005467 Bacteria 2216
32 Ga0070706_100200858 3300005467 Bacteria 1862
33 Ga0070707_100022278 3300005468 Bacteria 5989
34 Ga0070707_100038557 3300005468 Bacteria 4564
35 Ga0070698_100134551 3300005471 Bacteria 2426
36 Ga0070699_100333557 3300005518 Bacteria 1364
37 Ga0070679_100089991 3300005530 Bacteria 3057
38 Ga0070684_100077111 3300005535 Bacteria 2943
39 Ga0070684_100113140 3300005535 Bacteria 2435
40 Ga0070697_100006132 3300005536 Bacteria 9300
41 Ga0070697_100019969 3300005536 Bacteria 5295
42 Ga0068853_100078815 3300005539 Bacteria 2880
43 Ga0068853_100079520 3300005539 Bacteria 2867
44 Ga0070693_100015706 3300005547 Bacteria 3903
45 Ga0070665_100002681 3300005548 Bacteria 19338
46 Ga0070665_100422944 3300005548 Unclassified 1341
47 Ga0070704_100072084 3300005549 Bacteria 2512
48 Ga0068855_100001109 3300005563 Bacteria 33489
49 Ga0068855_100017303 3300005563 Bacteria 8675
50 Ga0068855_100176651 3300005563 Bacteria 2416
51 Ga0068857_100015910 3300005577 Bacteria 6585
52 Ga0068857_100034398 3300005577 Bacteria 4483
53 Ga0068857_100276302 3300005577 Bacteria 1544
54 Ga0068854_100098780 3300005578 Bacteria 2185
55 Ga0068854_100130628 3300005578 Bacteria 1917
56 Ga0068856_100022075 3300005614 Bacteria 6189
57 Ga0068856_100051709 3300005614 Bacteria 4050
58 Ga0068856_100070301 3300005614 Bacteria 3463
59 Ga0068856_100076240 3300005614 Bacteria 3322
60 Ga0068856_100082962 3300005614 Bacteria 3182
61 Ga0068852_100000287 3300005616 Bacteria 33809
62 Ga0068852_100128713 3300005616 Bacteria 2329
63 Ga0068852_100170244 3300005616 Bacteria 2041
64 Ga0068859_100054364 3300005617 Bacteria 4027
65 Ga0068864_100010793 3300005618 Bacteria 7549
66 Ga0068866_10081670 3300005718 Bacteria 1737
67 Ga0068866_10171925 3300005718 Unclassified 1273
68 Ga0068863_100016054 3300005841 Bacteria 7181
69 Ga0068863_100033343 3300005841 Bacteria 4905
70 Ga0068858_100003731 3300005842 Bacteria 15073
71 Ga0068860_100020554 3300005843 Bacteria 6396
72 Ga0068860_100074064 3300005843 Unclassified 3237
73 Ga0068860_100156574 3300005843 Unclassified 2196
74 Ga0068862_100143270 3300005844 Bacteria 2122
75 Ga0081455_10102574 3300005937 Bacteria 2293
76 Ga0070717_10035469 3300006028 Unclassified 4038
77 Ga0070717_10043705 3300006028 Bacteria 3657
78 Ga0070716_100000547 3300006173 Bacteria 15776
79 Ga0070716_100010001 3300006173 Bacteria 4743
80 Ga0070716_100015693 3300006173 Unclassified 3897
81 Ga0070716_100035756 3300006173 Bacteria 2733
82 Ga0070716_100198343 3300006173 Unclassified 1332
83 Ga0070712_100000238 3300006175 Bacteria 30830
84 Ga0070712_100041657 3300006175 Bacteria 3154
85 Ga0097621_100001165 3300006237 Bacteria 18212
86 Ga0097621_100028952 3300006237 Bacteria 4371
87 Ga0097621_100213669 3300006237 Bacteria 1678
88 Ga0068871_100024984 3300006358 Bacteria 4641
89 Ga0068871_100045691 3300006358 Bacteria 3525
90 Ga0075433_10195091 3300006852 Bacteria 1801
91 Ga0075434_100003427 3300006871 Bacteria 14182
92 Ga0075434_100005849 3300006871 Bacteria 11232
93 Ga0075436_100117973 3300006914 Unclassified 1855
94 Ga0097620_100054364 3300006931 Bacteria 4027
95 Ga0075435_100059350 3300007076 Unclassified 3101
96 Ga0075435_100095461 3300007076 Unclassified 2459
97 Ga0105240_10000928 3300009093 Bacteria 52175
98 Ga0105240_10001982 3300009093 Bacteria 33815
99 Ga0105240_10019112 3300009093 Bacteria 9162
100 Ga0105240_10027102 3300009093 Bacteria 7509
101 Ga0105240_10030057 3300009093 Bacteria 7066
102 Ga0105240_10037915 3300009093 Bacteria 6189
103 Ga0105240_10086059 3300009093 Bacteria 3850
104 Ga0105240_10551750 3300009093 Bacteria 1275
105 Ga0105245_10002633 3300009098 Bacteria 16149
106 Ga0105245_10006593 3300009098 Bacteria 10191
107 Ga0105247_10051784 3300009101 Bacteria 2530
108 Ga0105247_10061952 3300009101 Bacteria 2320
109 Ga0105241_10000748 3300009174 Bacteria 24713
110 Ga0105241_10070209 3300009174 Bacteria 2717
111 Ga0105241_10082483 3300009174 Bacteria 2520
112 Ga0105241_10357143 3300009174 Unclassified 1270
113 Ga0105242_10147627 3300009176 Bacteria 2047
114 Ga0105248_10002627 3300009177 Bacteria 19981
115 Ga0105248_10009624 3300009177 Bacteria 10641
116 Ga0105248_10042394 3300009177 Bacteria 5103
117 Ga0105248_10139924 3300009177 Unclassified 2730
118 Ga0105237_10159785 3300009545 Bacteria 2252
119 Ga0105237_10336661 3300009545 Bacteria 1513
120 Ga0105238_10001997 3300009551 Bacteria 20559
121 Ga0105238_10026335 3300009551 Bacteria 5927
122 Ga0105238_10074897 3300009551 Bacteria 3377
123 Ga0105238_10080245 3300009551 Bacteria 3252
124 Ga0105249_10261210 3300009553 Bacteria 1721
125 Ga0105239_10031502 3300010375 Bacteria 5831
126 Ga0105239_10039597 3300010375 Bacteria 5163
127 Ga0105239_10109217 3300010375 Bacteria 3065
128 Ga0105246_10042910 3300011119 Bacteria 3065
129 Ga0157370_10001105 3300013104 Bacteria 33807
130 Ga0157369_10001102 3300013105 Bacteria 33815
131 Ga0157369_10024918 3300013105 Bacteria 6647
132 Ga0157369_10056700 3300013105 Bacteria 4227
133 Ga0157374_10033618 3300013296 Bacteria 4680
134 Ga0157374_10191038 3300013296 Bacteria 2003
135 Ga0157374_10441070 3300013296 Bacteria 1302
136 Ga0157378_10000646 3300013297 Bacteria 32777
137 Ga0157378_10007009 3300013297 Bacteria 9834
138 Ga0157378_10018013 3300013297 Bacteria 6200
139 Ga0157378_10049673 3300013297 Bacteria 3732
140 Ga0157378_10066622 3300013297 Bacteria 3226
141 Ga0163162_10088058 3300013306 Bacteria 3184
142 Ga0157372_10000816 3300013307 Bacteria 33749
143 Ga0157372_10019965 3300013307 Bacteria 7223
144 Ga0157372_10376314 3300013307 Bacteria 1655
145 Ga0157375_10055531 3300013308 Bacteria 3906
146 Ga0157375_10388082 3300013308 Unclassified 1563
147 Ga0157375_10517726 3300013308 Unclassified 1356
148 Ga0163163_10012296 3300014325 Bacteria 7796
149 Ga0157379_10007227 3300014968 Bacteria 9607
150 Ga0157379_10252308 3300014968 Bacteria 1602
151 Ga0157376_10000004 3300014969 Bacteria 508493
152 Ga0157376_10002058 3300014969 Bacteria 13498
153 Ga0157376_10157518 3300014969 Bacteria 2055
154 Ga0207680_10028179 3300025903 Bacteria 3138
155 Ga0207699_10004454 3300025906 Bacteria 6700
156 Ga0207699_10008836 3300025906 Bacteria 4990
157 Ga0207699_10094577 3300025906 Bacteria 1882
158 Ga0207705_10025697 3300025909 Bacteria 4201
159 Ga0207705_10095829 3300025909 Bacteria 2178
160 Ga0207684_10005750 3300025910 Bacteria 11388
161 Ga0207654_10000206 3300025911 Bacteria 36317
162 Ga0207654_10000839 3300025911 Bacteria 16937
163 Ga0207654_10286747 3300025911 Unclassified 1115
164 Ga0207707_10193885 3300025912 Bacteria 1772
165 Ga0207695_10000384 3300025913 Bacteria 100121
166 Ga0207695_10001801 3300025913 Bacteria 33823
167 Ga0207695_10002863 3300025913 Bacteria 25073
168 Ga0207695_10013112 3300025913 Bacteria 9894
169 Ga0207695_10025110 3300025913 Bacteria 6683
170 Ga0207695_10034855 3300025913 Bacteria 5467
171 Ga0207671_10031193 3300025914 Bacteria 3972
172 Ga0207693_10000182 3300025915 Bacteria 57166
173 Ga0207693_10053254 3300025915 Unclassified 3175
174 Ga0207693_10099638 3300025915 Bacteria 2278
175 Ga0207663_10053008 3300025916 Bacteria 2532
176 Ga0207663_10130323 3300025916 Bacteria 1737
177 Ga0207652_10576179 3300025921 Unclassified 1010
178 Ga0207646_10000274 3300025922 Bacteria 70391
179 Ga0207646_10031852 3300025922 Bacteria 4772
180 Ga0207646_10290588 3300025922 Bacteria 1477
181 Ga0207694_10000497 3300025924 Bacteria 35591
182 Ga0207694_10001153 3300025924 Bacteria 22947
183 Ga0207650_10006233 3300025925 Bacteria 8127
184 Ga0207700_10010892 3300025928 Bacteria 5771
185 Ga0207700_10013507 3300025928 Bacteria 5317
186 Ga0207700_10087686 3300025928 Bacteria 2448
187 Ga0207700_10189150 3300025928 Unclassified 1729
188 Ga0207664_10028776 3300025929 Bacteria 4226
189 Ga0207644_10009217 3300025931 Bacteria 6475
190 Ga0207686_10017364 3300025934 Bacteria 4054
191 Ga0207665_10000038 3300025939 Bacteria 85922
192 Ga0207665_10004647 3300025939 Bacteria 9120
193 Ga0207665_10055855 3300025939 Unclassified 2665
194 Ga0207665_10125666 3300025939 Bacteria 1816
195 Ga0207665_10160657 3300025939 Bacteria 1616
196 Ga0207665_10191973 3300025939 Unclassified 1484
197 Ga0207711_10005595 3300025941 Bacteria 10621
198 Ga0207711_10439022 3300025941 Bacteria 1215
199 Ga0207689_10001472 3300025942 Bacteria 22548
200 Ga0207667_10001336 3300025949 Bacteria 30925
201 Ga0207667_10068135 3300025949 Bacteria 3706
202 Ga0207667_10458442 3300025949 Unclassified 1295
203 Ga0207712_10304388 3300025961 Unclassified 1309
204 Ga0207640_10198204 3300025981 Bacteria 1519
205 Ga0207658_10000185 3300025986 Bacteria 66636
206 Ga0207677_10002966 3300026023 Bacteria 8960
207 Ga0207677_10006201 3300026023 Bacteria 6535
208 Ga0207703_10004873 3300026035 Bacteria 10915
209 Ga0207639_10048820 3300026041 Bacteria 3206
210 Ga0207678_10113877 3300026067 Bacteria 2308
211 Ga0207702_10043509 3300026078 Bacteria 3770
212 Ga0207702_10146325 3300026078 Bacteria 2144
213 Ga0207641_10026017 3300026088 Bacteria 4827
214 Ga0207676_10009071 3300026095 Bacteria 7083
215 Ga0207674_10017420 3300026116 Bacteria 7839
216 Ga0207674_10023438 3300026116 Bacteria 6612
217 Ga0207674_10087995 3300026116 Bacteria 3099
218 Ga0207683_10118401 3300026121 Bacteria 2376
219 Ga0207698_10000239 3300026142 Bacteria 34266
220 Ga0209588_1038685 3300027671 Bacteria 1537
221 Ga0268266_10000383 3300028379 Bacteria 67390
222 Ga0268264_10010288 3300028381 Bacteria 7743
223 Ga0268264_10138279 3300028381 Bacteria 2169
224 Ga0265338_10005092 3300028800 Bacteria 17346
225 Ga0265338_10007533 3300028800 Bacteria 13464
226 Ga0265325_10064921 3300031241 Bacteria 1845
227 Ga0265340_10136134 3300031247 Bacteria 1125
228 Ga0265342_10058652 3300031712 Bacteria 2275
229 Ga0373934_0026824 3300035086 Bacteria 2236
230 Ga0373924_0042490 3300035410 Bacteria 1865
231 Ga0373931_0057333 3300035691 Bacteria 2089
232 Ga0373927_0096277 3300035695 Bacteria 1924
233 Ga0466963_0006194 3300044694 Bacteria 7065
234 Ga0466967_0007962 3300045976 Bacteria 7711
235 Ga0495641_0028981 3300046461 Unclassified 2673
236 Ga0495641_0086000 3300046461 Unclassified 1407
237 Ga0495580_0000180 3300046472 Bacteria 47295
238 Ga0495580_0065890 3300046472 Unclassified 2536
239 Ga0495582_0000348 3300046473 Bacteria 25338
240 Ga0495582_0118483 3300046473 Bacteria 1490
241 Ga0495639_0057343 3300046475 Bacteria 1779
242 Ga0495630_0091221 3300046517 Bacteria 2302
243 Ga0495666_0034326 3300046526 Unclassified 2476
244 Ga0495640_0093273 3300046533 Unclassified 1984
245 Ga0495661_0094370 3300046665 Bacteria 1696
246 Ga0495647_0029160 3300046681 Unclassified 2039
247 Ga0495658_0129504 3300046683 Unclassified 1534
248 Ga0495613_0109790 3300046689 Unclassified 1988
249 Ga0495674_0033940 3300047319 Unclassified 4617
250 Ga0495674_0223443 3300047319 Unclassified 1556
251 Ga0495676_0104406 3300047321 Unclassified 2091
252 Ga0495680_0036733 3300047322 Unclassified 3930
253 Ga0495684_0056736 3300047471 Unclassified 2985
254 Ga0495602_0273824 3300048088 Unclassified 1246
255 Ga0496101_0111828 3300048904 Bacteria 2057
256 Ga0496102_0009469 3300048905 Bacteria 8373
257 Ga0496104_0441688 3300048907 Bacteria 1213
258 Ga0496112_0186351 3300048915 Bacteria 2038
259 Ga0496114_0007894 3300048917 Bacteria 8421
260 Ga0496115_0013399 3300048918 Bacteria 6201
261 Ga0496115_0085223 3300048918 Bacteria 2577
262 nmdc:mga0n895_125989_c1 3300050512 Bacteria 2585
263 nmdc:mga0rr50_129264_c1 3300050513 Unclassified 2020
264 nmdc:mga0rr50_49231_c1 3300050513 Unclassified 3119
265 nmdc:mga08x19_1281_c1 3300050514 Bacteria 15604
266 nmdc:mga0a205_247465_c1 3300050515 Bacteria 1663
267 Ga0500661_000213 3300055283 Bacteria 10346

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100019969 Ga0070697_1000199694 284
2 3300009177 Ga0105248_10042394 Ga0105248_100423944 284
3 3300009553 Ga0105249_10261210 Ga0105249_102612102 284
4 3300005843 Ga0068860_100020554 Ga0068860_1000205544 286
5 3300025961 Ga0207712_10304388 Ga0207712_103043881 286
6 3300005435 Ga0070714_100033590 Ga0070714_1000335903 288
7 3300025929 Ga0207664_10028776 Ga0207664_100287763 288
8 3300013296 Ga0157374_10441070 Ga0157374_104410701 289
9 3300025924 Ga0207694_10001153 Ga0207694_100011537 289
10 3300046461 Ga0495641_0028981 Ga0495641_0028981_258_1265 289
11 3300046472 Ga0495580_0000180 Ga0495580_0000180_22810_23817 289
12 3300046473 Ga0495582_0000348 Ga0495582_0000348_13109_14116 289
13 3300013297 Ga0157378_10000646 Ga0157378_100006468 291
14 3300048905 Ga0496102_0009469 Ga0496102_0009469_4437_5420 291
15 3300048915 Ga0496112_0186351 Ga0496112_0186351_379_1362 291
16 3300035410 Ga0373924_0042490 Ga0373924_0042490_182_1066 292
17 3300035695 Ga0373927_0096277 Ga0373927_0096277_962_1858 292
18 3300005549 Ga0070704_100072084 Ga0070704_1000720842 293
19 3300005456 Ga0070678_100096203 Ga0070678_1000962033 296
20 3300005548 Ga0070665_100422944 Ga0070665_1004229442 296
21 3300005578 Ga0068854_100130628 Ga0068854_1001306282 296
22 3300005718 Ga0068866_10171925 Ga0068866_101719252 296
23 3300005843 Ga0068860_100074064 Ga0068860_1000740643 296
24 3300006237 Ga0097621_100001165 Ga0097621_10000116513 296
25 3300006358 Ga0068871_100024984 Ga0068871_1000249844 296
26 3300025903 Ga0207680_10028179 Ga0207680_100281793 296
27 3300025911 Ga0207654_10286747 Ga0207654_102867471 296
28 3300025981 Ga0207640_10198204 Ga0207640_101982042 296
29 3300026023 Ga0207677_10006201 Ga0207677_100062012 296
30 3300026121 Ga0207683_10118401 Ga0207683_101184012 296
31 3300028381 Ga0268264_10138279 Ga0268264_101382791 296
32 3300047319 Ga0495674_0223443 Ga0495674_0223443_226_1230 296
33 3300048918 Ga0496115_0085223 Ga0496115_0085223_1667_2563 296
34 3300007076 Ga0075435_100059350 Ga0075435_1000593503 300
35 3300050513 nmdc:mga0rr50_49231_c1 nmdc:mga0rr50_49231_c1_168_1175 300
36 3300031247 Ga0265340_10136134 Ga0265340_101361341 302
37 3300035086 Ga0373934_0026824 Ga0373934_0026824_1259_2173 302
38 3300005458 Ga0070681_10007455 Ga0070681_1000745513 303
39 3300005530 Ga0070679_100089991 Ga0070679_1000899912 303
40 3300005614 Ga0068856_100070301 Ga0068856_1000703011 303
41 3300006028 Ga0070717_10043705 Ga0070717_100437052 303
42 3300006173 Ga0070716_100000547 Ga0070716_1000005472 303
43 3300006173 Ga0070716_100015693 Ga0070716_1000156934 303
44 3300009093 Ga0105240_10086059 Ga0105240_100860593 303
45 3300009174 Ga0105241_10357143 Ga0105241_103571431 303
46 3300025912 Ga0207707_10193885 Ga0207707_101938852 303
47 3300025913 Ga0207695_10034855 Ga0207695_100348553 303
48 3300025915 Ga0207693_10053254 Ga0207693_100532544 303
49 3300025921 Ga0207652_10576179 Ga0207652_105761791 303
50 3300025939 Ga0207665_10000038 Ga0207665_100000384 303
51 3300025939 Ga0207665_10191973 Ga0207665_101919732 303
52 3300025949 Ga0207667_10458442 Ga0207667_104584421 303
53 3300046517 Ga0495630_0091221 Ga0495630_0091221_1215_2138 303
54 3300005434 Ga0070709_10086370 Ga0070709_100863702 306
55 3300006028 Ga0070717_10035469 Ga0070717_100354691 307
56 3300005434 Ga0070709_10000874 Ga0070709_1000087414 308
57 3300005436 Ga0070713_100000452 Ga0070713_10000045215 308
58 3300005439 Ga0070711_100088597 Ga0070711_1000885972 308
59 3300006173 Ga0070716_100035756 Ga0070716_1000357562 308
60 3300006175 Ga0070712_100000238 Ga0070712_10000023815 308
61 3300025906 Ga0207699_10004454 Ga0207699_100044542 308
62 3300025915 Ga0207693_10000182 Ga0207693_1000018213 308
63 3300025916 Ga0207663_10130323 Ga0207663_101303231 308
64 3300025939 Ga0207665_10160657 Ga0207665_101606572 308
65 3300031241 Ga0265325_10064921 Ga0265325_100649212 309
66 3300005436 Ga0070713_100109411 Ga0070713_1001094113 310
67 3300009545 Ga0105237_10159785 Ga0105237_101597852 310
68 3300031712 Ga0265342_10058652 Ga0265342_100586522 310
69 3300005445 Ga0070708_100034597 Ga0070708_1000345971 311
70 3300025928 Ga0207700_10013507 Ga0207700_100135072 311
71 3300046665 Ga0495661_0094370 Ga0495661_0094370_545_1513 311
72 3300055283 Ga0500661_000213 Ga0500661_000213_3169_4134 311
73 3300005335 Ga0070666_10029861 Ga0070666_100298613 312
74 3300005338 Ga0068868_100142878 Ga0068868_1001428782 312
75 3300005547 Ga0070693_100015706 Ga0070693_1000157063 312
76 3300009098 Ga0105245_10002633 Ga0105245_100026334 312
77 3300009176 Ga0105242_10147627 Ga0105242_101476272 312
78 3300010375 Ga0105239_10039597 Ga0105239_100395972 312
79 3300013297 Ga0157378_10018013 Ga0157378_100180133 312
80 3300013308 Ga0157375_10517726 Ga0157375_105177262 312
81 3300048907 Ga0496104_0441688 Ga0496104_0441688_155_1156 313
82 3300014969 Ga0157376_10000004 Ga0157376_10000004327 314
83 3300028800 Ga0265338_10007533 Ga0265338_100075332 314
84 3300005329 Ga0070683_100062714 Ga0070683_1000627142 315
85 3300006852 Ga0075433_10195091 Ga0075433_101950912 315
86 3300006871 Ga0075434_100003427 Ga0075434_1000034272 315
87 3300026116 Ga0207674_10017420 Ga0207674_100174202 315
88 3300027671 Ga0209588_1038685 Ga0209588_10386852 315
89 3300050512 nmdc:mga0n895_125989_c1 nmdc:mga0n895_125989_c1_1043_2029 315
90 3300050515 nmdc:mga0a205_247465_c1 nmdc:mga0a205_247465_c1_82_1068 315
91 3300005434 Ga0070709_10138718 Ga0070709_101387182 317
92 3300005435 Ga0070714_100074132 Ga0070714_1000741323 317
93 3300005439 Ga0070711_100014491 Ga0070711_1000144914 317
94 3300025906 Ga0207699_10094577 Ga0207699_100945772 317
95 3300025916 Ga0207663_10053008 Ga0207663_100530082 317
96 3300028800 Ga0265338_10005092 Ga0265338_1000509210 318
97 3300005467 Ga0070706_100034637 Ga0070706_1000346372 319
98 3300005468 Ga0070707_100022278 Ga0070707_1000222784 319
99 3300006175 Ga0070712_100041657 Ga0070712_1000416574 319
100 3300025910 Ga0207684_10005750 Ga0207684_100057508 319
101 3300025915 Ga0207693_10099638 Ga0207693_100996381 319
102 3300005295 Ga0065707_10117349 Ga0065707_101173492 320
103 3300005548 Ga0070665_100002681 Ga0070665_10000268111 320
104 3300005718 Ga0068866_10081670 Ga0068866_100816702 320
105 3300005937 Ga0081455_10102574 Ga0081455_101025741 320
106 3300006173 Ga0070716_100198343 Ga0070716_1001983432 320
107 3300006914 Ga0075436_100117973 Ga0075436_1001179731 320
108 3300013297 Ga0157378_10007009 Ga0157378_100070094 320
109 3300013308 Ga0157375_10055531 Ga0157375_100555315 320
110 3300025928 Ga0207700_10087686 Ga0207700_100876863 320
111 3300025934 Ga0207686_10017364 Ga0207686_100173642 320
112 3300025939 Ga0207665_10125666 Ga0207665_101256663 320
113 3300028379 Ga0268266_10000383 Ga0268266_1000038336 320
114 3300035691 Ga0373931_0057333 Ga0373931_0057333_944_1927 320
115 3300050514 nmdc:mga08x19_1281_c1 nmdc:mga08x19_1281_c1_13106_14101 320
116 3300005434 Ga0070709_10011125 Ga0070709_100111255 321
117 3300006173 Ga0070716_100010001 Ga0070716_1000100013 321
118 3300025906 Ga0207699_10008836 Ga0207699_100088364 321
119 3300025928 Ga0207700_10010892 Ga0207700_100108925 321
120 3300025939 Ga0207665_10004647 Ga0207665_100046479 321
121 3300005445 Ga0070708_100002661 Ga0070708_10000266110 322
122 3300005467 Ga0070706_100087618 Ga0070706_1000876182 322
123 3300005467 Ga0070706_100145174 Ga0070706_1001451742 322
124 3300005467 Ga0070706_100200858 Ga0070706_1002008583 322
125 3300005468 Ga0070707_100038557 Ga0070707_1000385573 322
126 3300005841 Ga0068863_100016054 Ga0068863_1000160543 322
127 3300005843 Ga0068860_100156574 Ga0068860_1001565743 322
128 3300006237 Ga0097621_100213669 Ga0097621_1002136692 322
129 3300006871 Ga0075434_100005849 Ga0075434_1000058495 322
130 3300007076 Ga0075435_100095461 Ga0075435_1000954614 322
131 3300009177 Ga0105248_10139924 Ga0105248_101399242 322
132 3300013308 Ga0157375_10388082 Ga0157375_103880822 322
133 3300014969 Ga0157376_10002058 Ga0157376_100020586 322
134 3300025922 Ga0207646_10000274 Ga0207646_1000027429 322
135 3300025922 Ga0207646_10031852 Ga0207646_100318524 322
136 3300025939 Ga0207665_10055855 Ga0207665_100558552 322
137 3300046461 Ga0495641_0086000 Ga0495641_0086000_132_1190 322
138 3300046472 Ga0495580_0065890 Ga0495580_0065890_1145_2203 322
139 3300046473 Ga0495582_0118483 Ga0495582_0118483_412_1470 322
140 3300046475 Ga0495639_0057343 Ga0495639_0057343_539_1597 322
141 3300046526 Ga0495666_0034326 Ga0495666_0034326_218_1276 322
142 3300046533 Ga0495640_0093273 Ga0495640_0093273_825_1883 322
143 3300046681 Ga0495647_0029160 Ga0495647_0029160_770_1828 322
144 3300046683 Ga0495658_0129504 Ga0495658_0129504_412_1470 322
145 3300046689 Ga0495613_0109790 Ga0495613_0109790_622_1680 322
146 3300047319 Ga0495674_0033940 Ga0495674_0033940_2365_3423 322
147 3300047321 Ga0495676_0104406 Ga0495676_0104406_603_1661 322
148 3300047322 Ga0495680_0036733 Ga0495680_0036733_280_1338 322
149 3300047471 Ga0495684_0056736 Ga0495684_0056736_622_1680 322
150 3300048904 Ga0496101_0111828 Ga0496101_0111828_449_1504 322
151 3300048918 Ga0496115_0013399 Ga0496115_0013399_4880_5935 322
152 3300050513 nmdc:mga0rr50_129264_c1 nmdc:mga0rr50_129264_c1_388_1377 322
153 3300005471 Ga0070698_100134551 Ga0070698_1001345512 323
154 3300005518 Ga0070699_100333557 Ga0070699_1003335571 323
155 3300005536 Ga0070697_100006132 Ga0070697_1000061326 323
156 3300025922 Ga0207646_10290588 Ga0207646_102905881 323
157 3300048917 Ga0496114_0007894 Ga0496114_0007894_1176_2183 323
158 3300044694 Ga0466963_0006194 Ga0466963_0006194_5153_6136 326
159 3300045976 Ga0466967_0007962 Ga0466967_0007962_6550_7533 326
160 3300003323 rootH1_10354795 rootH1_103547951 327
161 3300005327 Ga0070658_10026960 Ga0070658_100269604 327
162 3300005329 Ga0070683_100034877 Ga0070683_1000348773 327
163 3300005334 Ga0068869_100002382 Ga0068869_1000023826 327
164 3300005338 Ga0068868_100009842 Ga0068868_1000098422 327
165 3300005338 Ga0068868_100013856 Ga0068868_1000138562 327
166 3300005344 Ga0070661_100014560 Ga0070661_1000145602 327
167 3300005355 Ga0070671_100000449 Ga0070671_1000004495 327
168 3300005367 Ga0070667_100080801 Ga0070667_1000808012 327
169 3300005436 Ga0070713_100019626 Ga0070713_1000196265 327
170 3300005535 Ga0070684_100077111 Ga0070684_1000771112 327
171 3300005535 Ga0070684_100113140 Ga0070684_1001131402 327
172 3300005539 Ga0068853_100078815 Ga0068853_1000788153 327
173 3300005539 Ga0068853_100079520 Ga0068853_1000795201 327
174 3300005563 Ga0068855_100001109 Ga0068855_10000110926 327
175 3300005563 Ga0068855_100017303 Ga0068855_1000173032 327
176 3300005563 Ga0068855_100176651 Ga0068855_1001766512 327
177 3300005577 Ga0068857_100015910 Ga0068857_1000159105 327
178 3300005577 Ga0068857_100034398 Ga0068857_1000343982 327
179 3300005577 Ga0068857_100276302 Ga0068857_1002763022 327
180 3300005578 Ga0068854_100098780 Ga0068854_1000987802 327
181 3300005614 Ga0068856_100022075 Ga0068856_1000220754 327
182 3300005614 Ga0068856_100051709 Ga0068856_1000517092 327
183 3300005614 Ga0068856_100076240 Ga0068856_1000762402 327
184 3300005614 Ga0068856_100082962 Ga0068856_1000829622 327
185 3300005616 Ga0068852_100000287 Ga0068852_1000002876 327
186 3300005616 Ga0068852_100128713 Ga0068852_1001287132 327
187 3300005616 Ga0068852_100170244 Ga0068852_1001702442 327
188 3300005617 Ga0068859_100054364 Ga0068859_1000543642 327
189 3300005618 Ga0068864_100010793 Ga0068864_1000107932 327
190 3300005841 Ga0068863_100033343 Ga0068863_1000333435 327
191 3300005842 Ga0068858_100003731 Ga0068858_1000037316 327
192 3300005844 Ga0068862_100143270 Ga0068862_1001432702 327
193 3300006237 Ga0097621_100028952 Ga0097621_1000289524 327
194 3300006358 Ga0068871_100045691 Ga0068871_1000456912 327
195 3300006931 Ga0097620_100054364 Ga0097620_1000543642 327
196 3300009093 Ga0105240_10000928 Ga0105240_1000092836 327
197 3300009093 Ga0105240_10001982 Ga0105240_1000198225 327
198 3300009093 Ga0105240_10019112 Ga0105240_100191122 327
199 3300009093 Ga0105240_10027102 Ga0105240_100271023 327
200 3300009093 Ga0105240_10030057 Ga0105240_100300572 327
201 3300009093 Ga0105240_10037915 Ga0105240_100379156 327
202 3300009093 Ga0105240_10551750 Ga0105240_105517501 327
203 3300009098 Ga0105245_10006593 Ga0105245_100065936 327
204 3300009101 Ga0105247_10051784 Ga0105247_100517842 327
205 3300009101 Ga0105247_10061952 Ga0105247_100619521 327
206 3300009174 Ga0105241_10000748 Ga0105241_100007486 327
207 3300009174 Ga0105241_10070209 Ga0105241_100702092 327
208 3300009174 Ga0105241_10082483 Ga0105241_100824832 327
209 3300009177 Ga0105248_10002627 Ga0105248_1000262725 327
210 3300009177 Ga0105248_10009624 Ga0105248_100096244 327
211 3300009545 Ga0105237_10336661 Ga0105237_103366611 327
212 3300009551 Ga0105238_10001997 Ga0105238_100019976 327
213 3300009551 Ga0105238_10026335 Ga0105238_100263352 327
214 3300009551 Ga0105238_10074897 Ga0105238_100748974 327
215 3300009551 Ga0105238_10080245 Ga0105238_100802452 327
216 3300010375 Ga0105239_10031502 Ga0105239_100315022 327
217 3300010375 Ga0105239_10109217 Ga0105239_101092172 327
218 3300011119 Ga0105246_10042910 Ga0105246_100429102 327
219 3300013104 Ga0157370_10001105 Ga0157370_1000110525 327
220 3300013105 Ga0157369_10001102 Ga0157369_1000110225 327
221 3300013105 Ga0157369_10024918 Ga0157369_100249187 327
222 3300013105 Ga0157369_10056700 Ga0157369_100567002 327
223 3300013296 Ga0157374_10033618 Ga0157374_100336182 327
224 3300013296 Ga0157374_10191038 Ga0157374_101910382 327
225 3300013297 Ga0157378_10049673 Ga0157378_100496732 327
226 3300013297 Ga0157378_10066622 Ga0157378_100666223 327
227 3300013306 Ga0163162_10088058 Ga0163162_100880584 327
228 3300013307 Ga0157372_10000816 Ga0157372_1000081625 327
229 3300013307 Ga0157372_10019965 Ga0157372_100199657 327
230 3300013307 Ga0157372_10376314 Ga0157372_103763141 327
231 3300014325 Ga0163163_10012296 Ga0163163_100122962 327
232 3300014968 Ga0157379_10007227 Ga0157379_100072273 327
233 3300014968 Ga0157379_10252308 Ga0157379_102523081 327
234 3300014969 Ga0157376_10157518 Ga0157376_101575182 327
235 3300025909 Ga0207705_10025697 Ga0207705_100256973 327
236 3300025909 Ga0207705_10095829 Ga0207705_100958292 327
237 3300025911 Ga0207654_10000206 Ga0207654_100002066 327
238 3300025911 Ga0207654_10000839 Ga0207654_1000083914 327
239 3300025913 Ga0207695_10000384 Ga0207695_1000038468 327
240 3300025913 Ga0207695_10001801 Ga0207695_100018016 327
241 3300025913 Ga0207695_10002863 Ga0207695_100028635 327
242 3300025913 Ga0207695_10013112 Ga0207695_100131124 327
243 3300025913 Ga0207695_10025110 Ga0207695_100251107 327
244 3300025914 Ga0207671_10031193 Ga0207671_100311932 327
245 3300025924 Ga0207694_10000497 Ga0207694_1000049724 327
246 3300025925 Ga0207650_10006233 Ga0207650_100062332 327
247 3300025928 Ga0207700_10189150 Ga0207700_101891502 327
248 3300025931 Ga0207644_10009217 Ga0207644_100092172 327
249 3300025941 Ga0207711_10005595 Ga0207711_100055955 327
250 3300025941 Ga0207711_10439022 Ga0207711_104390221 327
251 3300025942 Ga0207689_10001472 Ga0207689_1000147217 327
252 3300025949 Ga0207667_10001336 Ga0207667_1000133622 327
253 3300025949 Ga0207667_10068135 Ga0207667_100681354 327
254 3300025986 Ga0207658_10000185 Ga0207658_100001857 327
255 3300026023 Ga0207677_10002966 Ga0207677_100029663 327
256 3300026035 Ga0207703_10004873 Ga0207703_100048736 327
257 3300026041 Ga0207639_10048820 Ga0207639_100488202 327
258 3300026067 Ga0207678_10113877 Ga0207678_101138772 327
259 3300026078 Ga0207702_10043509 Ga0207702_100435093 327
260 3300026078 Ga0207702_10146325 Ga0207702_101463252 327
261 3300026088 Ga0207641_10026017 Ga0207641_100260172 327
262 3300026095 Ga0207676_10009071 Ga0207676_100090715 327
263 3300026116 Ga0207674_10023438 Ga0207674_100234382 327
264 3300026116 Ga0207674_10087995 Ga0207674_100879952 327
265 3300026142 Ga0207698_10000239 Ga0207698_100002396 327
266 3300028381 Ga0268264_10010288 Ga0268264_100102883 327
267 3300048088 Ga0495602_0273824 Ga0495602_0273824_88_1074 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01156

IU_nuc_hydro

Inosine-uridine preferring nucleoside hydrolase

71

348

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zk5-assembly1.cif.gz_B plant nucleoside hydrolase - zmnrh3 enzyme in complex with forodesine 0.8526 38 327
6ba1-assembly1.cif.gz_E purine-preferring ribonucleoside hydrolase from gardnerella vaginalis 0.8392 38 325
4kpn-assembly1.cif.gz_B plant nucleoside hydrolase - ppnrh1 enzyme 0.8347 37 327
8ctm-assembly1.cif.gz_C crystal structure of the nucleoside hydrolase from leishmania donovani. 0.8346 37 325
6zk1-assembly1.cif.gz_B plant nucleoside hydrolase - zmnrh2b enzyme 0.8338 37 327
ID Description Score Start End Superfamily
af_A0A1D6FCA6_2_364_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.8429 27 327 3.90.245.10
af_Q9P6J4_1_308_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.8402 39 326 3.90.245.10
6ba1D00 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.839 38 325 3.90.245.10
af_O50418_2_304_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.8365 39 325 3.90.245.10
4kpoB00 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.8326 37 327 3.90.245.10
ID Description Score Start End GO Terms
AF-A0A836ZQ98-F1-model_v4 Nucleoside hydrolase 0.9739 41 171 GO:0005829
GO:0006152
GO:0008477
AF-Q8PNC9-F1-model_v4 deleted 0.9719 37 327
AF-A0A2V8WL26-F1-model_v4 Nucleoside hydrolase 0.9694 37 327 GO:0005829
GO:0006152
GO:0008477
AF-A0A2V9W1C3-F1-model_v4 Nucleoside hydrolase 0.9693 211 327 GO:0016799
AF-A0A534HJM1-F1-model_v4 Nucleoside hydrolase 0.967 84 324 GO:0005829
GO:0006152
GO:0008477

Feature Viewer

pLDDT pTM Quality
91.19 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map