F374423
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 266 | 197 | 235 | 279 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2728368998|2728753140 |
| Length | 260 |
| Sequence | RLTQISDTHLARRLKILTDNFHRVSEHIDATRPDLVLNSGDVSFDGPTSRDDLVFAKELHAALPVDCRYLPGNHDIGDNPTEVAVAPAQLPTDETCKAFTSVLGEDRWRFEAAGWCLIGLNSLIMNTGLDSEAEQFDWLXXXXXXXPLYLDAPDDAEREATSFRYVPQPARRRLIEMFGKVDLRLVGSGHVHQRRDYTFGRVRQIWAPSVGFYIRDEKQELIGIKETGLVEYRFQPDSFEVRHVRAKGQVDIELDTLYGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 11 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 12 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 13 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 14 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 15 | 2904699407 | |||
| 16 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 17 | 2906610324 | |||
| 18 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 19 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 20 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 21 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 22 | 2922425934 | |||
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 121 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 122 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 127 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 128 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 129 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 130 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 160 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 161 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 167 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 168 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 169 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 170 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 171 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 172 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 179 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 180 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 181 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 182 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 183 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 184 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 185 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 187 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 188 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 189 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 190 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 191 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 192 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 193 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 194 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 195 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 196 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 197 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.35 |
| Metatranscriptomes | 0 |
| Isolates | 10.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.52 |
| Nodule | 7.89 |
| Rhizoplane | 8.65 |
| Rhizosphere | 63.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10111207 | 3300005327 | Bacteria | 2270 |
| 2 | Ga0070658_10397411 | 3300005327 | Bacteria | 1184 |
| 3 | Ga0070690_100069856 | 3300005330 | Bacteria | 2280 |
| 4 | Ga0070690_100358054 | 3300005330 | Bacteria | 1061 |
| 5 | Ga0070680_100113782 | 3300005336 | Bacteria | 2254 |
| 6 | Ga0070682_100345737 | 3300005337 | Bacteria | 1107 |
| 7 | Ga0068868_100125212 | 3300005338 | Bacteria | 2099 |
| 8 | Ga0070660_100091681 | 3300005339 | Bacteria | 2397 |
| 9 | Ga0070689_100188044 | 3300005340 | Bacteria | 1680 |
| 10 | Ga0070661_100102218 | 3300005344 | Bacteria | 2133 |
| 11 | Ga0070661_100119487 | 3300005344 | Bacteria | 1973 |
| 12 | Ga0070668_100056768 | 3300005347 | Bacteria | 3024 |
| 13 | Ga0070668_100137196 | 3300005347 | Bacteria | 1968 |
| 14 | Ga0070668_100551318 | 3300005347 | Bacteria | 1003 |
| 15 | Ga0070675_100646417 | 3300005354 | Bacteria | 961 |
| 16 | Ga0070671_100353722 | 3300005355 | Bacteria | 1254 |
| 17 | Ga0070673_100537349 | 3300005364 | Bacteria | 1061 |
| 18 | Ga0070709_10068786 | 3300005434 | Bacteria | 2278 |
| 19 | Ga0070713_100029886 | 3300005436 | Bacteria | 4321 |
| 20 | Ga0070710_10030098 | 3300005437 | Bacteria | 2919 |
| 21 | Ga0070711_100011425 | 3300005439 | Bacteria | 5514 |
| 22 | Ga0070711_100020708 | 3300005439 | Bacteria | 4242 |
| 23 | Ga0070663_100007906 | 3300005455 | Bacteria | 6510 |
| 24 | Ga0070663_100321174 | 3300005455 | Bacteria | 1245 |
| 25 | Ga0070678_100430039 | 3300005456 | Bacteria | 1153 |
| 26 | Ga0070698_100193567 | 3300005471 | Bacteria | 1970 |
| 27 | Ga0070679_100204640 | 3300005530 | Bacteria | 1938 |
| 28 | Ga0070684_100012560 | 3300005535 | Bacteria | 6794 |
| 29 | Ga0070672_100054147 | 3300005543 | Bacteria | 3140 |
| 30 | Ga0068855_100025881 | 3300005563 | Bacteria | 7017 |
| 31 | Ga0068857_100018326 | 3300005577 | Bacteria | 6142 |
| 32 | Ga0068852_100399425 | 3300005616 | Bacteria | 1352 |
| 33 | Ga0068851_10048118 | 3300005834 | Bacteria | 2161 |
| 34 | Ga0068858_100356787 | 3300005842 | Bacteria | 1401 |
| 35 | Ga0068858_100598022 | 3300005842 | Bacteria | 1070 |
| 36 | Ga0068860_100001708 | 3300005843 | Bacteria | 23464 |
| 37 | Ga0068862_100067147 | 3300005844 | Bacteria | 3091 |
| 38 | Ga0068862_100153328 | 3300005844 | Bacteria | 2052 |
| 39 | Ga0081540_1002625 | 3300005983 | Bacteria | 14612 |
| 40 | Ga0081540_1003015 | 3300005983 | Bacteria | 13484 |
| 41 | Ga0081540_1032544 | 3300005983 | Bacteria | 2845 |
| 42 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 43 | Ga0075365_10045911 | 3300006038 | Bacteria | 2868 |
| 44 | Ga0070712_100015756 | 3300006175 | Bacteria | 4875 |
| 45 | Ga0075366_10168250 | 3300006195 | Bacteria | 1330 |
| 46 | Ga0097621_100054849 | 3300006237 | Bacteria | 3253 |
| 47 | Ga0075428_100196288 | 3300006844 | Bacteria | 2183 |
| 48 | Ga0075428_100261922 | 3300006844 | Bacteria | 1861 |
| 49 | Ga0105240_10047264 | 3300009093 | Bacteria | 5446 |
| 50 | Ga0105240_10144402 | 3300009093 | Bacteria | 2841 |
| 51 | Ga0111539_10082000 | 3300009094 | Bacteria | 3793 |
| 52 | Ga0111539_10223896 | 3300009094 | Bacteria | 2191 |
| 53 | Ga0105247_10028425 | 3300009101 | Bacteria | 3384 |
| 54 | Ga0105247_10093656 | 3300009101 | Bacteria | 1910 |
| 55 | Ga0114129_10225103 | 3300009147 | Bacteria | 2529 |
| 56 | Ga0105243_10030150 | 3300009148 | Bacteria | 4175 |
| 57 | Ga0105242_10679121 | 3300009176 | Bacteria | 1005 |
| 58 | Ga0105248_10092410 | 3300009177 | Bacteria | 3408 |
| 59 | Ga0105248_10318124 | 3300009177 | Bacteria | 1753 |
| 60 | Ga0105237_10034867 | 3300009545 | Bacteria | 5092 |
| 61 | Ga0105237_10069242 | 3300009545 | Bacteria | 3524 |
| 62 | Ga0105238_10008599 | 3300009551 | Bacteria | 10215 |
| 63 | Ga0105239_10049791 | 3300010375 | Bacteria | 4594 |
| 64 | Ga0105239_10074047 | 3300010375 | Bacteria | 3744 |
| 65 | Ga0105239_10218364 | 3300010375 | Bacteria | 2138 |
| 66 | Ga0105239_10646375 | 3300010375 | Bacteria | 1208 |
| 67 | Ga0105246_10186742 | 3300011119 | Bacteria | 1601 |
| 68 | Ga0157370_10063105 | 3300013104 | Bacteria | 3511 |
| 69 | Ga0157370_10090012 | 3300013104 | Bacteria | 2881 |
| 70 | Ga0157369_10216938 | 3300013105 | Bacteria | 2004 |
| 71 | Ga0157378_10031310 | 3300013297 | Bacteria | 4700 |
| 72 | Ga0157378_10096838 | 3300013297 | Bacteria | 2689 |
| 73 | Ga0163162_10026594 | 3300013306 | Bacteria | 5721 |
| 74 | Ga0163162_10171935 | 3300013306 | Bacteria | 2291 |
| 75 | Ga0163162_10468423 | 3300013306 | Bacteria | 1391 |
| 76 | Ga0157375_10021748 | 3300013308 | Bacteria | 5889 |
| 77 | Ga0157375_10085215 | 3300013308 | Bacteria | 3210 |
| 78 | Ga0157375_10430490 | 3300013308 | Bacteria | 1485 |
| 79 | Ga0157375_10517469 | 3300013308 | Bacteria | 1357 |
| 80 | Ga0157380_10088377 | 3300014326 | Bacteria | 2550 |
| 81 | Ga0157380_10142592 | 3300014326 | Bacteria | 2060 |
| 82 | Ga0157380_10405493 | 3300014326 | Bacteria | 1295 |
| 83 | Ga0157379_10043457 | 3300014968 | Bacteria | 4012 |
| 84 | Ga0163161_10018470 | 3300017792 | Bacteria | 4887 |
| 85 | Ga0209233_1000804 | 3300025261 | Bacteria | 14031 |
| 86 | Ga0207697_10011142 | 3300025315 | Bacteria | 3811 |
| 87 | Ga0207692_10078743 | 3300025898 | Bacteria | 1757 |
| 88 | Ga0207642_10193536 | 3300025899 | Bacteria | 1118 |
| 89 | Ga0207688_10052137 | 3300025901 | Bacteria | 2292 |
| 90 | Ga0207705_10056050 | 3300025909 | Bacteria | 2841 |
| 91 | Ga0207705_10180391 | 3300025909 | Bacteria | 1593 |
| 92 | Ga0207654_10219737 | 3300025911 | Bacteria | 1260 |
| 93 | Ga0207707_10010823 | 3300025912 | Bacteria | 7928 |
| 94 | Ga0207695_10077486 | 3300025913 | Bacteria | 3376 |
| 95 | Ga0207671_10074833 | 3300025914 | Bacteria | 2532 |
| 96 | Ga0207671_10110718 | 3300025914 | Bacteria | 2089 |
| 97 | Ga0207693_10024695 | 3300025915 | Bacteria | 4766 |
| 98 | Ga0207693_10125453 | 3300025915 | Bacteria | 2018 |
| 99 | Ga0207663_10014747 | 3300025916 | Bacteria | 4291 |
| 100 | Ga0207660_10007099 | 3300025917 | Bacteria | 7254 |
| 101 | Ga0207657_10003269 | 3300025919 | Bacteria | 17345 |
| 102 | Ga0207649_10216170 | 3300025920 | Bacteria | 1363 |
| 103 | Ga0207652_10021470 | 3300025921 | Bacteria | 5329 |
| 104 | Ga0207694_10304130 | 3300025924 | Bacteria | 1313 |
| 105 | Ga0207700_10247989 | 3300025928 | Bacteria | 1520 |
| 106 | Ga0207706_10053284 | 3300025933 | Bacteria | 3572 |
| 107 | Ga0207706_10401129 | 3300025933 | Bacteria | 1189 |
| 108 | Ga0207686_10307330 | 3300025934 | Bacteria | 1180 |
| 109 | Ga0207709_10027240 | 3300025935 | Bacteria | 3290 |
| 110 | Ga0207670_10249849 | 3300025936 | Bacteria | 1370 |
| 111 | Ga0207669_10218293 | 3300025937 | Bacteria | 1397 |
| 112 | Ga0207691_10346343 | 3300025940 | Bacteria | 1271 |
| 113 | Ga0207711_10264236 | 3300025941 | Bacteria | 1582 |
| 114 | Ga0207711_10351843 | 3300025941 | Bacteria | 1364 |
| 115 | Ga0207689_10006892 | 3300025942 | Bacteria | 9991 |
| 116 | Ga0207661_10038591 | 3300025944 | Bacteria | 3745 |
| 117 | Ga0207679_10162572 | 3300025945 | Bacteria | 1829 |
| 118 | Ga0207667_10010367 | 3300025949 | Bacteria | 10892 |
| 119 | Ga0207667_10034067 | 3300025949 | Bacteria | 5471 |
| 120 | Ga0207651_10709207 | 3300025960 | Bacteria | 887 |
| 121 | Ga0207668_10040273 | 3300025972 | Bacteria | 3151 |
| 122 | Ga0207703_10271754 | 3300026035 | Bacteria | 1536 |
| 123 | Ga0207639_10107607 | 3300026041 | Bacteria | 2265 |
| 124 | Ga0207639_10202350 | 3300026041 | Bacteria | 1704 |
| 125 | Ga0207678_10181460 | 3300026067 | Bacteria | 1797 |
| 126 | Ga0207708_10167522 | 3300026075 | Bacteria | 1738 |
| 127 | Ga0207641_10534164 | 3300026088 | Bacteria | 1142 |
| 128 | Ga0207648_10035793 | 3300026089 | Bacteria | 4374 |
| 129 | Ga0207676_10388617 | 3300026095 | Bacteria | 1301 |
| 130 | Ga0207674_10033144 | 3300026116 | Bacteria | 5409 |
| 131 | Ga0207675_100074428 | 3300026118 | Bacteria | 3178 |
| 132 | Ga0207675_100091758 | 3300026118 | Bacteria | 2856 |
| 133 | Ga0207683_10015556 | 3300026121 | Bacteria | 6478 |
| 134 | Ga0207683_10200833 | 3300026121 | Bacteria | 1812 |
| 135 | Ga0207698_10081464 | 3300026142 | Bacteria | 2613 |
| 136 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 137 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 138 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 139 | Ga0268266_10270286 | 3300028379 | Bacteria | 1578 |
| 140 | Ga0268265_10047167 | 3300028380 | Bacteria | 3226 |
| 141 | Ga0268264_10000149 | 3300028381 | Bacteria | 163972 |
| 142 | Ga0307517_10000249 | 3300028786 | Bacteria | 91911 |
| 143 | Ga0307511_10049232 | 3300030521 | Bacteria | 3415 |
| 144 | Ga0307509_10004311 | 3300031507 | Bacteria | 20669 |
| 145 | Ga0307516_10011365 | 3300031730 | Bacteria | 9683 |
| 146 | Ga0307516_10038469 | 3300031730 | Bacteria | 4774 |
| 147 | Ga0307516_10176895 | 3300031730 | Bacteria | 1870 |
| 148 | Ga0307516_10473910 | 3300031730 | Bacteria | 907 |
| 149 | Ga0307410_10409771 | 3300031852 | Bacteria | 1097 |
| 150 | Ga0307416_100259723 | 3300032002 | Bacteria | 1697 |
| 151 | Ga0307416_100384618 | 3300032002 | Bacteria | 1435 |
| 152 | Ga0373935_0461959 | 3300035692 | Bacteria | 918 |
| 153 | Ga0373947_0018382 | 3300035725 | Bacteria | 4023 |
| 154 | Ga0373925_0051730 | 3300037068 | Bacteria | 3067 |
| 155 | Ga0395905_0057682 | 3300037471 | Bacteria | 3632 |
| 156 | Ga0466969_0162092 | 3300044656 | Bacteria | 1027 |
| 157 | Ga0466966_0067153 | 3300044684 | Bacteria | 2253 |
| 158 | Ga0466963_0158820 | 3300044694 | Bacteria | 1573 |
| 159 | Ga0466968_0174348 | 3300044735 | Bacteria | 998 |
| 160 | Ga0466957_0095722 | 3300044842 | Bacteria | 1865 |
| 161 | Ga0466957_0099130 | 3300044842 | Bacteria | 1834 |
| 162 | Ga0466967_0360497 | 3300045976 | Bacteria | 1408 |
| 163 | Ga0495617_062725 | 3300046452 | Bacteria | 1228 |
| 164 | Ga0495638_0106794 | 3300046460 | Bacteria | 1668 |
| 165 | Ga0495639_0042044 | 3300046475 | Bacteria | 2060 |
| 166 | Ga0495585_0104757 | 3300046492 | Bacteria | 1509 |
| 167 | Ga0495606_0121570 | 3300046507 | Bacteria | 1563 |
| 168 | Ga0495631_0064944 | 3300046518 | Bacteria | 1580 |
| 169 | Ga0495598_0042959 | 3300046537 | Bacteria | 1329 |
| 170 | Ga0495622_0039840 | 3300046557 | Bacteria | 2188 |
| 171 | Ga0495668_0134371 | 3300046616 | Bacteria | 1354 |
| 172 | Ga0495668_0138740 | 3300046616 | Bacteria | 1331 |
| 173 | Ga0495588_0000648 | 3300046674 | Bacteria | 16194 |
| 174 | Ga0495624_0051293 | 3300046690 | Bacteria | 2612 |
| 175 | Ga0495649_0168043 | 3300046694 | Bacteria | 1149 |
| 176 | Ga0495680_0289724 | 3300047322 | Bacteria | 1152 |
| 177 | Ga0496100_0051360 | 3300048903 | Bacteria | 2676 |
| 178 | Ga0496101_0060093 | 3300048904 | Bacteria | 2757 |
| 179 | Ga0496101_0082405 | 3300048904 | Bacteria | 2381 |
| 180 | Ga0496101_0107507 | 3300048904 | Bacteria | 2096 |
| 181 | Ga0496101_0388969 | 3300048904 | Bacteria | 1098 |
| 182 | Ga0496102_0002765 | 3300048905 | Bacteria | 14959 |
| 183 | Ga0496102_0101997 | 3300048905 | Bacteria | 2667 |
| 184 | Ga0496102_0153003 | 3300048905 | Bacteria | 2168 |
| 185 | Ga0496102_0337085 | 3300048905 | Bacteria | 1420 |
| 186 | Ga0496103_0105790 | 3300048906 | Bacteria | 1784 |
| 187 | Ga0496106_0004983 | 3300048909 | Bacteria | 9830 |
| 188 | Ga0496106_0007734 | 3300048909 | Bacteria | 7955 |
| 189 | Ga0496106_0056978 | 3300048909 | Bacteria | 2955 |
| 190 | Ga0496106_0121005 | 3300048909 | Bacteria | 2046 |
| 191 | Ga0496107_0234320 | 3300048910 | Bacteria | 1366 |
| 192 | Ga0496108_0080958 | 3300048911 | Bacteria | 2752 |
| 193 | Ga0496111_0015337 | 3300048914 | Bacteria | 5257 |
| 194 | Ga0496111_0041601 | 3300048914 | Bacteria | 3298 |
| 195 | Ga0496112_0255012 | 3300048915 | Bacteria | 1704 |
| 196 | Ga0496113_0014818 | 3300048916 | Bacteria | 5334 |
| 197 | Ga0496114_0025525 | 3300048917 | Bacteria | 4830 |
| 198 | Ga0496115_0023965 | 3300048918 | Bacteria | 4739 |
| 199 | Ga0496117_0221941 | 3300048920 | Bacteria | 1051 |
| 200 | Ga0496118_0111921 | 3300048921 | Bacteria | 1809 |
| 201 | Ga0496118_0223871 | 3300048921 | Bacteria | 1092 |
| 202 | Ga0496121_0001749 | 3300048924 | Bacteria | 35439 |
| 203 | Ga0496121_0004375 | 3300048924 | Bacteria | 19087 |
| 204 | Ga0496121_0040256 | 3300048924 | Bacteria | 4103 |
| 205 | Ga0496121_0049291 | 3300048924 | Bacteria | 3572 |
| 206 | Ga0496121_0151899 | 3300048924 | Bacteria | 1703 |
| 207 | Ga0496121_0203524 | 3300048924 | Bacteria | 1409 |
| 208 | Ga0496121_0271943 | 3300048924 | Bacteria | 1164 |
| 209 | Ga0496124_0010603 | 3300048927 | Bacteria | 9314 |
| 210 | Ga0496126_0034295 | 3300048929 | Bacteria | 4767 |
| 211 | Ga0496126_0046444 | 3300048929 | Bacteria | 3983 |
| 212 | Ga0496126_0509239 | 3300048929 | Bacteria | 961 |
| 213 | Ga0501041_0207096 | 3300049577 | Bacteria | 1230 |
| 214 | nmdc:mga0yw44_45023_c1 | 3300050492 | Bacteria | 2643 |
| 215 | nmdc:mga0yw44_6835_c1 | 3300050492 | Bacteria | 5549 |
| 216 | nmdc:mga05p37_31066_c1 | 3300050507 | Bacteria | 6522 |
| 217 | nmdc:mga08y16_560575_c1 | 3300050511 | Bacteria | 1155 |
| 218 | nmdc:mga0rr50_717302_c1 | 3300050513 | Bacteria | 853 |
| 219 | Ga0495601_0071297 | 3300053077 | Bacteria | 2219 |
| 220 | Ga0495601_0352954 | 3300053077 | Bacteria | 956 |
| 221 | Ga0500651_0025793 | 3300053093 | Bacteria | 3690 |
| 222 | Ga0500651_0032643 | 3300053093 | Bacteria | 3282 |
| 223 | Ga0500595_000306 | 3300053119 | Bacteria | 32239 |
| 224 | Ga0500595_001964 | 3300053119 | Bacteria | 10563 |
| 225 | Ga0500595_023409 | 3300053119 | Bacteria | 2171 |
| 226 | Ga0500642_0090060 | 3300053130 | Bacteria | 1417 |
| 227 | Ga0500658_0112327 | 3300053134 | Bacteria | 1200 |
| 228 | Ga0500568_0082665 | 3300053139 | Bacteria | 1218 |
| 229 | Ga0500634_0053635 | 3300053161 | Bacteria | 2162 |
| 230 | Ga0500638_001569 | 3300053162 | Bacteria | 7318 |
| 231 | Ga0500636_0089566 | 3300053177 | Bacteria | 1763 |
| 232 | Ga0500636_0164553 | 3300053177 | Bacteria | 1206 |
| 233 | Ga0500657_040589 | 3300053728 | Bacteria | 2164 |
| 234 | Ga0500552_004432 | 3300053733 | Bacteria | 1479 |
| 235 | Ga0500661_001009 | 3300055283 | Bacteria | 5287 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046616 | Ga0495668_0134371 | Ga0495668_0134371_10_780 | 256 |
| 2 | 3300050513 | nmdc:mga0rr50_717302_c1 | nmdc:mga0rr50_717302_c1_17_787 | 256 |
| 3 | iso_pu_bacteria | 2728368998 | 2728753140 | 260 |
| 4 | 3300048924 | Ga0496121_0151899 | Ga0496121_0151899_540_1373 | 262 |
| 5 | 3300048929 | Ga0496126_0509239 | Ga0496126_0509239_89_922 | 262 |
| 6 | 3300048920 | Ga0496117_0221941 | Ga0496117_0221941_15_830 | 271 |
| 7 | iso_pu_bacteria | 2513237098 | 2513674456 | 272 |
| 8 | iso_pu_bacteria | 2513237104 | 2513722598 | 272 |
| 9 | iso_pu_bacteria | 2513237137 | 2513855621 | 272 |
| 10 | iso_pu_bacteria | 2513237145 | 2513919984 | 272 |
| 11 | iso_pu_bacteria | 2517572143 | 2517892161 | 272 |
| 12 | iso_pu_bacteria | 2524023228 | 2524534259 | 272 |
| 13 | iso_pu_bacteria | 2667528175 | 2671120585 | 272 |
| 14 | iso_pu_bacteria | 2721755755 | 2723844824 | 272 |
| 15 | iso_pu_bacteria | 2791355197 | 2793068762 | 272 |
| 16 | iso_pu_bacteria | 2844315083 | 2844319280 | 272 |
| 17 | iso_pu_bacteria | 2874604998 | 2874605459 | 272 |
| 18 | iso_pu_bacteria | 2903727486 | 2903731120 | 272 |
| 19 | iso_pu_bacteria | 2903768456 | 2903771785 | 272 |
| 20 | iso_pu_bacteria | 2904699407 | 2904702302 | 272 |
| 21 | iso_pu_bacteria | 2906602504 | 2906607371 | 272 |
| 22 | iso_pu_bacteria | 2906610324 | 2906617287 | 272 |
| 23 | iso_pu_bacteria | 2906635258 | 2906643317 | 272 |
| 24 | iso_pu_bacteria | 2906660503 | 2906662553 | 272 |
| 25 | iso_pu_bacteria | 2922361189 | 2922365591 | 272 |
| 26 | iso_pu_bacteria | 2922386360 | 2922391207 | 272 |
| 27 | iso_pu_bacteria | 2922425934 | 2922430537 | 272 |
| 28 | iso_pu_bacteria | 8006926726 | 8006931342 | 272 |
| 29 | iso_pu_bacteria | 8006933436 | 8006940434 | 272 |
| 30 | iso_pu_bacteria | 8006964411 | 8006967074 | 272 |
| 31 | iso_pu_bacteria | 8006973647 | 8006980123 | 272 |
| 32 | iso_pu_bacteria | 8006984368 | 8006988033 | 272 |
| 33 | iso_pu_bacteria | 8006994254 | 8006995759 | 272 |
| 34 | iso_pu_bacteria | 8019555841 | 8019556338 | 272 |
| 35 | iso_pu_bacteria | 8019565922 | 8019568974 | 272 |
| 36 | iso_pu_bacteria | 8056967851 | 8056968252 | 272 |
| 37 | 3300005843 | Ga0068860_100001708 | Ga0068860_10000170812 | 273 |
| 38 | 3300009545 | Ga0105237_10034867 | Ga0105237_100348674 | 273 |
| 39 | 3300025914 | Ga0207671_10110718 | Ga0207671_101107181 | 273 |
| 40 | 3300028381 | Ga0268264_10000149 | Ga0268264_1000014914 | 273 |
| 41 | 3300048921 | Ga0496118_0223871 | Ga0496118_0223871_45_881 | 273 |
| 42 | 3300048924 | Ga0496121_0004375 | Ga0496121_0004375_10858_11694 | 273 |
| 43 | 3300048929 | Ga0496126_0046444 | Ga0496126_0046444_314_1153 | 274 |
| 44 | 3300005330 | Ga0070690_100358054 | Ga0070690_1003580542 | 275 |
| 45 | 3300005985 | Ga0081539_10000140 | Ga0081539_1000014070 | 275 |
| 46 | 3300009176 | Ga0105242_10679121 | Ga0105242_106791211 | 275 |
| 47 | 3300009177 | Ga0105248_10092410 | Ga0105248_100924103 | 275 |
| 48 | 3300010375 | Ga0105239_10646375 | Ga0105239_106463751 | 275 |
| 49 | 3300025899 | Ga0207642_10193536 | Ga0207642_101935361 | 275 |
| 50 | 3300025911 | Ga0207654_10219737 | Ga0207654_102197372 | 275 |
| 51 | 3300025915 | Ga0207693_10125453 | Ga0207693_101254533 | 275 |
| 52 | 3300025934 | Ga0207686_10307330 | Ga0207686_103073302 | 275 |
| 53 | 3300025941 | Ga0207711_10351843 | Ga0207711_103518432 | 275 |
| 54 | 3300026035 | Ga0207703_10271754 | Ga0207703_102717543 | 275 |
| 55 | 3300031730 | Ga0307516_10011365 | Ga0307516_1001136512 | 275 |
| 56 | 3300035692 | Ga0373935_0461959 | Ga0373935_0461959_58_885 | 275 |
| 57 | 3300037068 | Ga0373925_0051730 | Ga0373925_0051730_102_929 | 275 |
| 58 | 3300046690 | Ga0495624_0051293 | Ga0495624_0051293_1525_2352 | 275 |
| 59 | 3300048904 | Ga0496101_0082405 | Ga0496101_0082405_598_1425 | 275 |
| 60 | 3300048909 | Ga0496106_0121005 | Ga0496106_0121005_351_1178 | 275 |
| 61 | 3300048911 | Ga0496108_0080958 | Ga0496108_0080958_1652_2479 | 275 |
| 62 | 3300048914 | Ga0496111_0041601 | Ga0496111_0041601_1840_2667 | 275 |
| 63 | 3300048915 | Ga0496112_0255012 | Ga0496112_0255012_632_1459 | 275 |
| 64 | 3300048924 | Ga0496121_0040256 | Ga0496121_0040256_557_1408 | 275 |
| 65 | 3300053077 | Ga0495601_0071297 | Ga0495601_0071297_1297_2124 | 275 |
| 66 | 3300053077 | Ga0495601_0352954 | Ga0495601_0352954_30_857 | 275 |
| 67 | 3300005327 | Ga0070658_10111207 | Ga0070658_101112072 | 276 |
| 68 | 3300005327 | Ga0070658_10397411 | Ga0070658_103974112 | 276 |
| 69 | 3300005330 | Ga0070690_100069856 | Ga0070690_1000698561 | 276 |
| 70 | 3300005336 | Ga0070680_100113782 | Ga0070680_1001137821 | 276 |
| 71 | 3300005337 | Ga0070682_100345737 | Ga0070682_1003457371 | 276 |
| 72 | 3300005338 | Ga0068868_100125212 | Ga0068868_1001252122 | 276 |
| 73 | 3300005339 | Ga0070660_100091681 | Ga0070660_1000916813 | 276 |
| 74 | 3300005340 | Ga0070689_100188044 | Ga0070689_1001880441 | 276 |
| 75 | 3300005344 | Ga0070661_100102218 | Ga0070661_1001022184 | 276 |
| 76 | 3300005344 | Ga0070661_100119487 | Ga0070661_1001194872 | 276 |
| 77 | 3300005347 | Ga0070668_100056768 | Ga0070668_1000567683 | 276 |
| 78 | 3300005347 | Ga0070668_100137196 | Ga0070668_1001371962 | 276 |
| 79 | 3300005347 | Ga0070668_100551318 | Ga0070668_1005513181 | 276 |
| 80 | 3300005354 | Ga0070675_100646417 | Ga0070675_1006464171 | 276 |
| 81 | 3300005355 | Ga0070671_100353722 | Ga0070671_1003537222 | 276 |
| 82 | 3300005364 | Ga0070673_100537349 | Ga0070673_1005373491 | 276 |
| 83 | 3300005434 | Ga0070709_10068786 | Ga0070709_100687861 | 276 |
| 84 | 3300005436 | Ga0070713_100029886 | Ga0070713_1000298861 | 276 |
| 85 | 3300005437 | Ga0070710_10030098 | Ga0070710_100300982 | 276 |
| 86 | 3300005439 | Ga0070711_100011425 | Ga0070711_1000114254 | 276 |
| 87 | 3300005439 | Ga0070711_100020708 | Ga0070711_1000207082 | 276 |
| 88 | 3300005455 | Ga0070663_100007906 | Ga0070663_1000079065 | 276 |
| 89 | 3300005455 | Ga0070663_100321174 | Ga0070663_1003211742 | 276 |
| 90 | 3300005456 | Ga0070678_100430039 | Ga0070678_1004300391 | 276 |
| 91 | 3300005471 | Ga0070698_100193567 | Ga0070698_1001935673 | 276 |
| 92 | 3300005530 | Ga0070679_100204640 | Ga0070679_1002046403 | 276 |
| 93 | 3300005535 | Ga0070684_100012560 | Ga0070684_1000125606 | 276 |
| 94 | 3300005543 | Ga0070672_100054147 | Ga0070672_1000541472 | 276 |
| 95 | 3300005563 | Ga0068855_100025881 | Ga0068855_1000258813 | 276 |
| 96 | 3300005577 | Ga0068857_100018326 | Ga0068857_1000183264 | 276 |
| 97 | 3300005616 | Ga0068852_100399425 | Ga0068852_1003994252 | 276 |
| 98 | 3300005834 | Ga0068851_10048118 | Ga0068851_100481181 | 276 |
| 99 | 3300005842 | Ga0068858_100356787 | Ga0068858_1003567871 | 276 |
| 100 | 3300005842 | Ga0068858_100598022 | Ga0068858_1005980222 | 276 |
| 101 | 3300005844 | Ga0068862_100067147 | Ga0068862_1000671473 | 276 |
| 102 | 3300005844 | Ga0068862_100153328 | Ga0068862_1001533284 | 276 |
| 103 | 3300005983 | Ga0081540_1002625 | Ga0081540_10026255 | 276 |
| 104 | 3300005983 | Ga0081540_1003015 | Ga0081540_100301512 | 276 |
| 105 | 3300005983 | Ga0081540_1032544 | Ga0081540_10325441 | 276 |
| 106 | 3300006038 | Ga0075365_10045911 | Ga0075365_100459112 | 276 |
| 107 | 3300006175 | Ga0070712_100015756 | Ga0070712_1000157565 | 276 |
| 108 | 3300006195 | Ga0075366_10168250 | Ga0075366_101682501 | 276 |
| 109 | 3300006237 | Ga0097621_100054849 | Ga0097621_1000548492 | 276 |
| 110 | 3300006844 | Ga0075428_100196288 | Ga0075428_1001962882 | 276 |
| 111 | 3300006844 | Ga0075428_100261922 | Ga0075428_1002619222 | 276 |
| 112 | 3300009093 | Ga0105240_10047264 | Ga0105240_100472645 | 276 |
| 113 | 3300009093 | Ga0105240_10144402 | Ga0105240_101444022 | 276 |
| 114 | 3300009094 | Ga0111539_10082000 | Ga0111539_100820003 | 276 |
| 115 | 3300009094 | Ga0111539_10223896 | Ga0111539_102238962 | 276 |
| 116 | 3300009101 | Ga0105247_10028425 | Ga0105247_100284253 | 276 |
| 117 | 3300009101 | Ga0105247_10093656 | Ga0105247_100936562 | 276 |
| 118 | 3300009147 | Ga0114129_10225103 | Ga0114129_102251032 | 276 |
| 119 | 3300009148 | Ga0105243_10030150 | Ga0105243_100301504 | 276 |
| 120 | 3300009177 | Ga0105248_10318124 | Ga0105248_103181242 | 276 |
| 121 | 3300009545 | Ga0105237_10069242 | Ga0105237_100692425 | 276 |
| 122 | 3300009551 | Ga0105238_10008599 | Ga0105238_100085994 | 276 |
| 123 | 3300010375 | Ga0105239_10049791 | Ga0105239_100497911 | 276 |
| 124 | 3300010375 | Ga0105239_10074047 | Ga0105239_100740474 | 276 |
| 125 | 3300010375 | Ga0105239_10218364 | Ga0105239_102183641 | 276 |
| 126 | 3300011119 | Ga0105246_10186742 | Ga0105246_101867422 | 276 |
| 127 | 3300013104 | Ga0157370_10063105 | Ga0157370_100631052 | 276 |
| 128 | 3300013104 | Ga0157370_10090012 | Ga0157370_100900124 | 276 |
| 129 | 3300013105 | Ga0157369_10216938 | Ga0157369_102169381 | 276 |
| 130 | 3300013297 | Ga0157378_10031310 | Ga0157378_100313104 | 276 |
| 131 | 3300013297 | Ga0157378_10096838 | Ga0157378_100968382 | 276 |
| 132 | 3300013306 | Ga0163162_10026594 | Ga0163162_100265942 | 276 |
| 133 | 3300013306 | Ga0163162_10171935 | Ga0163162_101719353 | 276 |
| 134 | 3300013306 | Ga0163162_10468423 | Ga0163162_104684232 | 276 |
| 135 | 3300013308 | Ga0157375_10021748 | Ga0157375_100217482 | 276 |
| 136 | 3300013308 | Ga0157375_10085215 | Ga0157375_100852153 | 276 |
| 137 | 3300013308 | Ga0157375_10430490 | Ga0157375_104304901 | 276 |
| 138 | 3300013308 | Ga0157375_10517469 | Ga0157375_105174691 | 276 |
| 139 | 3300014326 | Ga0157380_10088377 | Ga0157380_100883773 | 276 |
| 140 | 3300014326 | Ga0157380_10142592 | Ga0157380_101425923 | 276 |
| 141 | 3300014326 | Ga0157380_10405493 | Ga0157380_104054932 | 276 |
| 142 | 3300014968 | Ga0157379_10043457 | Ga0157379_100434572 | 276 |
| 143 | 3300017792 | Ga0163161_10018470 | Ga0163161_100184704 | 276 |
| 144 | 3300025261 | Ga0209233_1000804 | Ga0209233_10008045 | 276 |
| 145 | 3300025315 | Ga0207697_10011142 | Ga0207697_100111424 | 276 |
| 146 | 3300025898 | Ga0207692_10078743 | Ga0207692_100787433 | 276 |
| 147 | 3300025901 | Ga0207688_10052137 | Ga0207688_100521373 | 276 |
| 148 | 3300025909 | Ga0207705_10056050 | Ga0207705_100560503 | 276 |
| 149 | 3300025909 | Ga0207705_10180391 | Ga0207705_101803911 | 276 |
| 150 | 3300025912 | Ga0207707_10010823 | Ga0207707_100108237 | 276 |
| 151 | 3300025913 | Ga0207695_10077486 | Ga0207695_100774862 | 276 |
| 152 | 3300025914 | Ga0207671_10074833 | Ga0207671_100748332 | 276 |
| 153 | 3300025915 | Ga0207693_10024695 | Ga0207693_100246955 | 276 |
| 154 | 3300025916 | Ga0207663_10014747 | Ga0207663_100147472 | 276 |
| 155 | 3300025917 | Ga0207660_10007099 | Ga0207660_100070996 | 276 |
| 156 | 3300025919 | Ga0207657_10003269 | Ga0207657_1000326914 | 276 |
| 157 | 3300025920 | Ga0207649_10216170 | Ga0207649_102161701 | 276 |
| 158 | 3300025921 | Ga0207652_10021470 | Ga0207652_100214703 | 276 |
| 159 | 3300025924 | Ga0207694_10304130 | Ga0207694_103041302 | 276 |
| 160 | 3300025928 | Ga0207700_10247989 | Ga0207700_102479891 | 276 |
| 161 | 3300025933 | Ga0207706_10053284 | Ga0207706_100532843 | 276 |
| 162 | 3300025933 | Ga0207706_10401129 | Ga0207706_104011292 | 276 |
| 163 | 3300025935 | Ga0207709_10027240 | Ga0207709_100272402 | 276 |
| 164 | 3300025936 | Ga0207670_10249849 | Ga0207670_102498491 | 276 |
| 165 | 3300025937 | Ga0207669_10218293 | Ga0207669_102182932 | 276 |
| 166 | 3300025940 | Ga0207691_10346343 | Ga0207691_103463432 | 276 |
| 167 | 3300025941 | Ga0207711_10264236 | Ga0207711_102642362 | 276 |
| 168 | 3300025942 | Ga0207689_10006892 | Ga0207689_100068928 | 276 |
| 169 | 3300025944 | Ga0207661_10038591 | Ga0207661_100385914 | 276 |
| 170 | 3300025945 | Ga0207679_10162572 | Ga0207679_101625722 | 276 |
| 171 | 3300025949 | Ga0207667_10010367 | Ga0207667_100103672 | 276 |
| 172 | 3300025949 | Ga0207667_10034067 | Ga0207667_100340675 | 276 |
| 173 | 3300025960 | Ga0207651_10709207 | Ga0207651_107092071 | 276 |
| 174 | 3300025972 | Ga0207668_10040273 | Ga0207668_100402734 | 276 |
| 175 | 3300026041 | Ga0207639_10107607 | Ga0207639_101076072 | 276 |
| 176 | 3300026041 | Ga0207639_10202350 | Ga0207639_102023502 | 276 |
| 177 | 3300026067 | Ga0207678_10181460 | Ga0207678_101814602 | 276 |
| 178 | 3300026075 | Ga0207708_10167522 | Ga0207708_101675222 | 276 |
| 179 | 3300026088 | Ga0207641_10534164 | Ga0207641_105341641 | 276 |
| 180 | 3300026089 | Ga0207648_10035793 | Ga0207648_100357932 | 276 |
| 181 | 3300026095 | Ga0207676_10388617 | Ga0207676_103886171 | 276 |
| 182 | 3300026116 | Ga0207674_10033144 | Ga0207674_100331442 | 276 |
| 183 | 3300026118 | Ga0207675_100074428 | Ga0207675_1000744283 | 276 |
| 184 | 3300026118 | Ga0207675_100091758 | Ga0207675_1000917583 | 276 |
| 185 | 3300026121 | Ga0207683_10015556 | Ga0207683_100155562 | 276 |
| 186 | 3300026121 | Ga0207683_10200833 | Ga0207683_102008332 | 276 |
| 187 | 3300026142 | Ga0207698_10081464 | Ga0207698_100814643 | 276 |
| 188 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001149 | 276 |
| 189 | 3300027361 | Ga0209489_100001 | Ga0209489_100001149 | 276 |
| 190 | 3300027363 | Ga0209700_100001 | Ga0209700_100001149 | 276 |
| 191 | 3300028379 | Ga0268266_10270286 | Ga0268266_102702862 | 276 |
| 192 | 3300028380 | Ga0268265_10047167 | Ga0268265_100471672 | 276 |
| 193 | 3300028786 | Ga0307517_10000249 | Ga0307517_1000024938 | 276 |
| 194 | 3300030521 | Ga0307511_10049232 | Ga0307511_100492323 | 276 |
| 195 | 3300031507 | Ga0307509_10004311 | Ga0307509_1000431119 | 276 |
| 196 | 3300031730 | Ga0307516_10038469 | Ga0307516_100384694 | 276 |
| 197 | 3300031730 | Ga0307516_10176895 | Ga0307516_101768951 | 276 |
| 198 | 3300031730 | Ga0307516_10473910 | Ga0307516_104739101 | 276 |
| 199 | 3300031852 | Ga0307410_10409771 | Ga0307410_104097711 | 276 |
| 200 | 3300032002 | Ga0307416_100259723 | Ga0307416_1002597232 | 276 |
| 201 | 3300032002 | Ga0307416_100384618 | Ga0307416_1003846182 | 276 |
| 202 | 3300035725 | Ga0373947_0018382 | Ga0373947_0018382_2133_3068 | 276 |
| 203 | 3300037471 | Ga0395905_0057682 | Ga0395905_0057682_1433_2272 | 276 |
| 204 | 3300044656 | Ga0466969_0162092 | Ga0466969_0162092_82_915 | 276 |
| 205 | 3300044684 | Ga0466966_0067153 | Ga0466966_0067153_566_1399 | 276 |
| 206 | 3300044694 | Ga0466963_0158820 | Ga0466963_0158820_720_1562 | 276 |
| 207 | 3300044735 | Ga0466968_0174348 | Ga0466968_0174348_132_965 | 276 |
| 208 | 3300044842 | Ga0466957_0095722 | Ga0466957_0095722_255_1088 | 276 |
| 209 | 3300044842 | Ga0466957_0099130 | Ga0466957_0099130_579_1421 | 276 |
| 210 | 3300045976 | Ga0466967_0360497 | Ga0466967_0360497_426_1268 | 276 |
| 211 | 3300046452 | Ga0495617_062725 | Ga0495617_062725_199_1032 | 276 |
| 212 | 3300046460 | Ga0495638_0106794 | Ga0495638_0106794_237_1070 | 276 |
| 213 | 3300046475 | Ga0495639_0042044 | Ga0495639_0042044_110_949 | 276 |
| 214 | 3300046492 | Ga0495585_0104757 | Ga0495585_0104757_291_1130 | 276 |
| 215 | 3300046507 | Ga0495606_0121570 | Ga0495606_0121570_586_1416 | 276 |
| 216 | 3300046518 | Ga0495631_0064944 | Ga0495631_0064944_305_1144 | 276 |
| 217 | 3300046537 | Ga0495598_0042959 | Ga0495598_0042959_361_1194 | 276 |
| 218 | 3300046557 | Ga0495622_0039840 | Ga0495622_0039840_1026_1865 | 276 |
| 219 | 3300046616 | Ga0495668_0138740 | Ga0495668_0138740_204_1037 | 276 |
| 220 | 3300046674 | Ga0495588_0000648 | Ga0495588_0000648_1893_2732 | 276 |
| 221 | 3300046694 | Ga0495649_0168043 | Ga0495649_0168043_239_1072 | 276 |
| 222 | 3300047322 | Ga0495680_0289724 | Ga0495680_0289724_117_965 | 276 |
| 223 | 3300048903 | Ga0496100_0051360 | Ga0496100_0051360_293_1132 | 276 |
| 224 | 3300048904 | Ga0496101_0060093 | Ga0496101_0060093_659_1498 | 276 |
| 225 | 3300048904 | Ga0496101_0107507 | Ga0496101_0107507_927_1760 | 276 |
| 226 | 3300048904 | Ga0496101_0388969 | Ga0496101_0388969_252_1085 | 276 |
| 227 | 3300048905 | Ga0496102_0002765 | Ga0496102_0002765_14032_14871 | 276 |
| 228 | 3300048905 | Ga0496102_0101997 | Ga0496102_0101997_1353_2192 | 276 |
| 229 | 3300048905 | Ga0496102_0153003 | Ga0496102_0153003_72_905 | 276 |
| 230 | 3300048905 | Ga0496102_0337085 | Ga0496102_0337085_324_1157 | 276 |
| 231 | 3300048906 | Ga0496103_0105790 | Ga0496103_0105790_293_1132 | 276 |
| 232 | 3300048909 | Ga0496106_0004983 | Ga0496106_0004983_8745_9584 | 276 |
| 233 | 3300048909 | Ga0496106_0007734 | Ga0496106_0007734_451_1386 | 276 |
| 234 | 3300048909 | Ga0496106_0056978 | Ga0496106_0056978_981_1814 | 276 |
| 235 | 3300048910 | Ga0496107_0234320 | Ga0496107_0234320_76_915 | 276 |
| 236 | 3300048914 | Ga0496111_0015337 | Ga0496111_0015337_1080_1919 | 276 |
| 237 | 3300048916 | Ga0496113_0014818 | Ga0496113_0014818_4023_4862 | 276 |
| 238 | 3300048917 | Ga0496114_0025525 | Ga0496114_0025525_576_1415 | 276 |
| 239 | 3300048918 | Ga0496115_0023965 | Ga0496115_0023965_3255_4094 | 276 |
| 240 | 3300048921 | Ga0496118_0111921 | Ga0496118_0111921_548_1378 | 276 |
| 241 | 3300048924 | Ga0496121_0001749 | Ga0496121_0001749_26526_27461 | 276 |
| 242 | 3300048924 | Ga0496121_0049291 | Ga0496121_0049291_1351_2190 | 276 |
| 243 | 3300048924 | Ga0496121_0203524 | Ga0496121_0203524_322_1158 | 276 |
| 244 | 3300048924 | Ga0496121_0271943 | Ga0496121_0271943_319_1149 | 276 |
| 245 | 3300048927 | Ga0496124_0010603 | Ga0496124_0010603_4779_5714 | 276 |
| 246 | 3300048929 | Ga0496126_0034295 | Ga0496126_0034295_1139_2074 | 276 |
| 247 | 3300049577 | Ga0501041_0207096 | Ga0501041_0207096_264_1097 | 276 |
| 248 | 3300050492 | nmdc:mga0yw44_45023_c1 | nmdc:mga0yw44_45023_c1_1611_2450 | 276 |
| 249 | 3300050492 | nmdc:mga0yw44_6835_c1 | nmdc:mga0yw44_6835_c1_1337_2170 | 276 |
| 250 | 3300050507 | nmdc:mga05p37_31066_c1 | nmdc:mga05p37_31066_c1_4162_5001 | 276 |
| 251 | 3300050511 | nmdc:mga08y16_560575_c1 | nmdc:mga08y16_560575_c1_142_981 | 276 |
| 252 | 3300053093 | Ga0500651_0025793 | Ga0500651_0025793_652_1503 | 276 |
| 253 | 3300053093 | Ga0500651_0032643 | Ga0500651_0032643_74_907 | 276 |
| 254 | 3300053119 | Ga0500595_000306 | Ga0500595_000306_11310_12140 | 276 |
| 255 | 3300053119 | Ga0500595_001964 | Ga0500595_001964_3459_4304 | 276 |
| 256 | 3300053119 | Ga0500595_023409 | Ga0500595_023409_84_917 | 276 |
| 257 | 3300053130 | Ga0500642_0090060 | Ga0500642_0090060_553_1386 | 276 |
| 258 | 3300053134 | Ga0500658_0112327 | Ga0500658_0112327_70_903 | 276 |
| 259 | 3300053139 | Ga0500568_0082665 | Ga0500568_0082665_115_975 | 276 |
| 260 | 3300053161 | Ga0500634_0053635 | Ga0500634_0053635_1188_2027 | 276 |
| 261 | 3300053162 | Ga0500638_001569 | Ga0500638_001569_3778_4608 | 276 |
| 262 | 3300053177 | Ga0500636_0089566 | Ga0500636_0089566_603_1538 | 276 |
| 263 | 3300053177 | Ga0500636_0164553 | Ga0500636_0164553_326_1156 | 276 |
| 264 | 3300053728 | Ga0500657_040589 | Ga0500657_040589_465_1400 | 276 |
| 265 | 3300053733 | Ga0500552_004432 | Ga0500552_004432_379_1314 | 276 |
| 266 | 3300055283 | Ga0500661_001009 | Ga0500661_001009_3912_4742 | 276 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hyo-assembly1.cif.gz_A-2 | crystal structure of rv0805 n97a mutant | 0.7597 | 4 | 260 |
| 2dxl-assembly1.cif.gz_A | glycerophosphodiesterase from enterobacter aerogenes | 0.7469 | 5 | 258 |
| 3d03-assembly1.cif.gz_A | 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes | 0.7459 | 5 | 258 |
| 2hyo-assembly1.cif.gz_A-2 | crystal structure of rv0805 n97a mutant | 0.7446 | 4 | 260 |
| 2hy1-assembly1.cif.gz_A-2 | crystal structure of rv0805 | 0.737 | 4 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IM55_21_293_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8325 | 4 | 265 | 3.60.21.10 |
| af_Q8IM55_21_293_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7985 | 4 | 265 | 3.60.21.10 |
| af_Q66H71_55_308_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7846 | 23 | 273 | 3.60.21.10 |
| af_A0A1D8PMT0_76_326_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7642 | 6 | 227 | 3.60.21.10 |
| af_Q66H71_55_308_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7467 | 23 | 273 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C9VRR1-F1-model_v4 | Metallophosphoesterase | 0.9942 | 80 | 270 |
GO:0005737
|
| AF-A0A4Q8QI69-F1-model_v4 | Phosphohydrolase | 0.9934 | 1 | 162 |
GO:0005737
GO:0016787 |
| AF-A0A2T2QL24-F1-model_v4 | deleted | 0.9933 | 1 | 273 |
|
| AF-A0A4Q8QI69-F1-model_v4 | Phosphohydrolase | 0.9873 | 1 | 162 |
GO:0005737
GO:0016787 |
| AF-A0A2T2QL24-F1-model_v4 | deleted | 0.9862 | 1 | 273 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar