F374423

General Info

Members Datasets Scaffolds Average Seq Length
266 197 235 279

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2728368998|2728753140
Length 260
Sequence RLTQISDTHLARRLKILTDNFHRVSEHIDATRPDLVLNSGDVSFDGPTSRDDLVFAKELHAALPVDCRYLPGNHDIGDNPTEVAVAPAQLPTDETCKAFTSVLGEDRWRFEAAGWCLIGLNSLIMNTGLDSEAEQFDWLXXXXXXXPLYLDAPDDAEREATSFRYVPQPARRRLIEMFGKVDLRLVGSGHVHQRRDYTFGRVRQIWAPSVGFYIRDEKQELIGIKETGLVEYRFQPDSFEVRHVRAKGQVDIELDTLYGK

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
11 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
14 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
15 2904699407
16 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
17 2906610324
18 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
19 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
20 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
21 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
22 2922425934
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
121 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
122 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
180 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
184 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
187 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
188 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
189 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
190 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
191 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
192 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
193 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
194 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
195 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
196 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
197 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.35
Metatranscriptomes 0
Isolates 10.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 7.89
Rhizoplane 8.65
Rhizosphere 63.53
Stem 0
Stem Tuber 0
Unclassified 12.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10111207 3300005327 Bacteria 2270
2 Ga0070658_10397411 3300005327 Bacteria 1184
3 Ga0070690_100069856 3300005330 Bacteria 2280
4 Ga0070690_100358054 3300005330 Bacteria 1061
5 Ga0070680_100113782 3300005336 Bacteria 2254
6 Ga0070682_100345737 3300005337 Bacteria 1107
7 Ga0068868_100125212 3300005338 Bacteria 2099
8 Ga0070660_100091681 3300005339 Bacteria 2397
9 Ga0070689_100188044 3300005340 Bacteria 1680
10 Ga0070661_100102218 3300005344 Bacteria 2133
11 Ga0070661_100119487 3300005344 Bacteria 1973
12 Ga0070668_100056768 3300005347 Bacteria 3024
13 Ga0070668_100137196 3300005347 Bacteria 1968
14 Ga0070668_100551318 3300005347 Bacteria 1003
15 Ga0070675_100646417 3300005354 Bacteria 961
16 Ga0070671_100353722 3300005355 Bacteria 1254
17 Ga0070673_100537349 3300005364 Bacteria 1061
18 Ga0070709_10068786 3300005434 Bacteria 2278
19 Ga0070713_100029886 3300005436 Bacteria 4321
20 Ga0070710_10030098 3300005437 Bacteria 2919
21 Ga0070711_100011425 3300005439 Bacteria 5514
22 Ga0070711_100020708 3300005439 Bacteria 4242
23 Ga0070663_100007906 3300005455 Bacteria 6510
24 Ga0070663_100321174 3300005455 Bacteria 1245
25 Ga0070678_100430039 3300005456 Bacteria 1153
26 Ga0070698_100193567 3300005471 Bacteria 1970
27 Ga0070679_100204640 3300005530 Bacteria 1938
28 Ga0070684_100012560 3300005535 Bacteria 6794
29 Ga0070672_100054147 3300005543 Bacteria 3140
30 Ga0068855_100025881 3300005563 Bacteria 7017
31 Ga0068857_100018326 3300005577 Bacteria 6142
32 Ga0068852_100399425 3300005616 Bacteria 1352
33 Ga0068851_10048118 3300005834 Bacteria 2161
34 Ga0068858_100356787 3300005842 Bacteria 1401
35 Ga0068858_100598022 3300005842 Bacteria 1070
36 Ga0068860_100001708 3300005843 Bacteria 23464
37 Ga0068862_100067147 3300005844 Bacteria 3091
38 Ga0068862_100153328 3300005844 Bacteria 2052
39 Ga0081540_1002625 3300005983 Bacteria 14612
40 Ga0081540_1003015 3300005983 Bacteria 13484
41 Ga0081540_1032544 3300005983 Bacteria 2845
42 Ga0081539_10000140 3300005985 Bacteria 166746
43 Ga0075365_10045911 3300006038 Bacteria 2868
44 Ga0070712_100015756 3300006175 Bacteria 4875
45 Ga0075366_10168250 3300006195 Bacteria 1330
46 Ga0097621_100054849 3300006237 Bacteria 3253
47 Ga0075428_100196288 3300006844 Bacteria 2183
48 Ga0075428_100261922 3300006844 Bacteria 1861
49 Ga0105240_10047264 3300009093 Bacteria 5446
50 Ga0105240_10144402 3300009093 Bacteria 2841
51 Ga0111539_10082000 3300009094 Bacteria 3793
52 Ga0111539_10223896 3300009094 Bacteria 2191
53 Ga0105247_10028425 3300009101 Bacteria 3384
54 Ga0105247_10093656 3300009101 Bacteria 1910
55 Ga0114129_10225103 3300009147 Bacteria 2529
56 Ga0105243_10030150 3300009148 Bacteria 4175
57 Ga0105242_10679121 3300009176 Bacteria 1005
58 Ga0105248_10092410 3300009177 Bacteria 3408
59 Ga0105248_10318124 3300009177 Bacteria 1753
60 Ga0105237_10034867 3300009545 Bacteria 5092
61 Ga0105237_10069242 3300009545 Bacteria 3524
62 Ga0105238_10008599 3300009551 Bacteria 10215
63 Ga0105239_10049791 3300010375 Bacteria 4594
64 Ga0105239_10074047 3300010375 Bacteria 3744
65 Ga0105239_10218364 3300010375 Bacteria 2138
66 Ga0105239_10646375 3300010375 Bacteria 1208
67 Ga0105246_10186742 3300011119 Bacteria 1601
68 Ga0157370_10063105 3300013104 Bacteria 3511
69 Ga0157370_10090012 3300013104 Bacteria 2881
70 Ga0157369_10216938 3300013105 Bacteria 2004
71 Ga0157378_10031310 3300013297 Bacteria 4700
72 Ga0157378_10096838 3300013297 Bacteria 2689
73 Ga0163162_10026594 3300013306 Bacteria 5721
74 Ga0163162_10171935 3300013306 Bacteria 2291
75 Ga0163162_10468423 3300013306 Bacteria 1391
76 Ga0157375_10021748 3300013308 Bacteria 5889
77 Ga0157375_10085215 3300013308 Bacteria 3210
78 Ga0157375_10430490 3300013308 Bacteria 1485
79 Ga0157375_10517469 3300013308 Bacteria 1357
80 Ga0157380_10088377 3300014326 Bacteria 2550
81 Ga0157380_10142592 3300014326 Bacteria 2060
82 Ga0157380_10405493 3300014326 Bacteria 1295
83 Ga0157379_10043457 3300014968 Bacteria 4012
84 Ga0163161_10018470 3300017792 Bacteria 4887
85 Ga0209233_1000804 3300025261 Bacteria 14031
86 Ga0207697_10011142 3300025315 Bacteria 3811
87 Ga0207692_10078743 3300025898 Bacteria 1757
88 Ga0207642_10193536 3300025899 Bacteria 1118
89 Ga0207688_10052137 3300025901 Bacteria 2292
90 Ga0207705_10056050 3300025909 Bacteria 2841
91 Ga0207705_10180391 3300025909 Bacteria 1593
92 Ga0207654_10219737 3300025911 Bacteria 1260
93 Ga0207707_10010823 3300025912 Bacteria 7928
94 Ga0207695_10077486 3300025913 Bacteria 3376
95 Ga0207671_10074833 3300025914 Bacteria 2532
96 Ga0207671_10110718 3300025914 Bacteria 2089
97 Ga0207693_10024695 3300025915 Bacteria 4766
98 Ga0207693_10125453 3300025915 Bacteria 2018
99 Ga0207663_10014747 3300025916 Bacteria 4291
100 Ga0207660_10007099 3300025917 Bacteria 7254
101 Ga0207657_10003269 3300025919 Bacteria 17345
102 Ga0207649_10216170 3300025920 Bacteria 1363
103 Ga0207652_10021470 3300025921 Bacteria 5329
104 Ga0207694_10304130 3300025924 Bacteria 1313
105 Ga0207700_10247989 3300025928 Bacteria 1520
106 Ga0207706_10053284 3300025933 Bacteria 3572
107 Ga0207706_10401129 3300025933 Bacteria 1189
108 Ga0207686_10307330 3300025934 Bacteria 1180
109 Ga0207709_10027240 3300025935 Bacteria 3290
110 Ga0207670_10249849 3300025936 Bacteria 1370
111 Ga0207669_10218293 3300025937 Bacteria 1397
112 Ga0207691_10346343 3300025940 Bacteria 1271
113 Ga0207711_10264236 3300025941 Bacteria 1582
114 Ga0207711_10351843 3300025941 Bacteria 1364
115 Ga0207689_10006892 3300025942 Bacteria 9991
116 Ga0207661_10038591 3300025944 Bacteria 3745
117 Ga0207679_10162572 3300025945 Bacteria 1829
118 Ga0207667_10010367 3300025949 Bacteria 10892
119 Ga0207667_10034067 3300025949 Bacteria 5471
120 Ga0207651_10709207 3300025960 Bacteria 887
121 Ga0207668_10040273 3300025972 Bacteria 3151
122 Ga0207703_10271754 3300026035 Bacteria 1536
123 Ga0207639_10107607 3300026041 Bacteria 2265
124 Ga0207639_10202350 3300026041 Bacteria 1704
125 Ga0207678_10181460 3300026067 Bacteria 1797
126 Ga0207708_10167522 3300026075 Bacteria 1738
127 Ga0207641_10534164 3300026088 Bacteria 1142
128 Ga0207648_10035793 3300026089 Bacteria 4374
129 Ga0207676_10388617 3300026095 Bacteria 1301
130 Ga0207674_10033144 3300026116 Bacteria 5409
131 Ga0207675_100074428 3300026118 Bacteria 3178
132 Ga0207675_100091758 3300026118 Bacteria 2856
133 Ga0207683_10015556 3300026121 Bacteria 6478
134 Ga0207683_10200833 3300026121 Bacteria 1812
135 Ga0207698_10081464 3300026142 Bacteria 2613
136 Ga0209589_1000001 3300027357 Bacteria 794224
137 Ga0209489_100001 3300027361 Bacteria 794224
138 Ga0209700_100001 3300027363 Bacteria 794224
139 Ga0268266_10270286 3300028379 Bacteria 1578
140 Ga0268265_10047167 3300028380 Bacteria 3226
141 Ga0268264_10000149 3300028381 Bacteria 163972
142 Ga0307517_10000249 3300028786 Bacteria 91911
143 Ga0307511_10049232 3300030521 Bacteria 3415
144 Ga0307509_10004311 3300031507 Bacteria 20669
145 Ga0307516_10011365 3300031730 Bacteria 9683
146 Ga0307516_10038469 3300031730 Bacteria 4774
147 Ga0307516_10176895 3300031730 Bacteria 1870
148 Ga0307516_10473910 3300031730 Bacteria 907
149 Ga0307410_10409771 3300031852 Bacteria 1097
150 Ga0307416_100259723 3300032002 Bacteria 1697
151 Ga0307416_100384618 3300032002 Bacteria 1435
152 Ga0373935_0461959 3300035692 Bacteria 918
153 Ga0373947_0018382 3300035725 Bacteria 4023
154 Ga0373925_0051730 3300037068 Bacteria 3067
155 Ga0395905_0057682 3300037471 Bacteria 3632
156 Ga0466969_0162092 3300044656 Bacteria 1027
157 Ga0466966_0067153 3300044684 Bacteria 2253
158 Ga0466963_0158820 3300044694 Bacteria 1573
159 Ga0466968_0174348 3300044735 Bacteria 998
160 Ga0466957_0095722 3300044842 Bacteria 1865
161 Ga0466957_0099130 3300044842 Bacteria 1834
162 Ga0466967_0360497 3300045976 Bacteria 1408
163 Ga0495617_062725 3300046452 Bacteria 1228
164 Ga0495638_0106794 3300046460 Bacteria 1668
165 Ga0495639_0042044 3300046475 Bacteria 2060
166 Ga0495585_0104757 3300046492 Bacteria 1509
167 Ga0495606_0121570 3300046507 Bacteria 1563
168 Ga0495631_0064944 3300046518 Bacteria 1580
169 Ga0495598_0042959 3300046537 Bacteria 1329
170 Ga0495622_0039840 3300046557 Bacteria 2188
171 Ga0495668_0134371 3300046616 Bacteria 1354
172 Ga0495668_0138740 3300046616 Bacteria 1331
173 Ga0495588_0000648 3300046674 Bacteria 16194
174 Ga0495624_0051293 3300046690 Bacteria 2612
175 Ga0495649_0168043 3300046694 Bacteria 1149
176 Ga0495680_0289724 3300047322 Bacteria 1152
177 Ga0496100_0051360 3300048903 Bacteria 2676
178 Ga0496101_0060093 3300048904 Bacteria 2757
179 Ga0496101_0082405 3300048904 Bacteria 2381
180 Ga0496101_0107507 3300048904 Bacteria 2096
181 Ga0496101_0388969 3300048904 Bacteria 1098
182 Ga0496102_0002765 3300048905 Bacteria 14959
183 Ga0496102_0101997 3300048905 Bacteria 2667
184 Ga0496102_0153003 3300048905 Bacteria 2168
185 Ga0496102_0337085 3300048905 Bacteria 1420
186 Ga0496103_0105790 3300048906 Bacteria 1784
187 Ga0496106_0004983 3300048909 Bacteria 9830
188 Ga0496106_0007734 3300048909 Bacteria 7955
189 Ga0496106_0056978 3300048909 Bacteria 2955
190 Ga0496106_0121005 3300048909 Bacteria 2046
191 Ga0496107_0234320 3300048910 Bacteria 1366
192 Ga0496108_0080958 3300048911 Bacteria 2752
193 Ga0496111_0015337 3300048914 Bacteria 5257
194 Ga0496111_0041601 3300048914 Bacteria 3298
195 Ga0496112_0255012 3300048915 Bacteria 1704
196 Ga0496113_0014818 3300048916 Bacteria 5334
197 Ga0496114_0025525 3300048917 Bacteria 4830
198 Ga0496115_0023965 3300048918 Bacteria 4739
199 Ga0496117_0221941 3300048920 Bacteria 1051
200 Ga0496118_0111921 3300048921 Bacteria 1809
201 Ga0496118_0223871 3300048921 Bacteria 1092
202 Ga0496121_0001749 3300048924 Bacteria 35439
203 Ga0496121_0004375 3300048924 Bacteria 19087
204 Ga0496121_0040256 3300048924 Bacteria 4103
205 Ga0496121_0049291 3300048924 Bacteria 3572
206 Ga0496121_0151899 3300048924 Bacteria 1703
207 Ga0496121_0203524 3300048924 Bacteria 1409
208 Ga0496121_0271943 3300048924 Bacteria 1164
209 Ga0496124_0010603 3300048927 Bacteria 9314
210 Ga0496126_0034295 3300048929 Bacteria 4767
211 Ga0496126_0046444 3300048929 Bacteria 3983
212 Ga0496126_0509239 3300048929 Bacteria 961
213 Ga0501041_0207096 3300049577 Bacteria 1230
214 nmdc:mga0yw44_45023_c1 3300050492 Bacteria 2643
215 nmdc:mga0yw44_6835_c1 3300050492 Bacteria 5549
216 nmdc:mga05p37_31066_c1 3300050507 Bacteria 6522
217 nmdc:mga08y16_560575_c1 3300050511 Bacteria 1155
218 nmdc:mga0rr50_717302_c1 3300050513 Bacteria 853
219 Ga0495601_0071297 3300053077 Bacteria 2219
220 Ga0495601_0352954 3300053077 Bacteria 956
221 Ga0500651_0025793 3300053093 Bacteria 3690
222 Ga0500651_0032643 3300053093 Bacteria 3282
223 Ga0500595_000306 3300053119 Bacteria 32239
224 Ga0500595_001964 3300053119 Bacteria 10563
225 Ga0500595_023409 3300053119 Bacteria 2171
226 Ga0500642_0090060 3300053130 Bacteria 1417
227 Ga0500658_0112327 3300053134 Bacteria 1200
228 Ga0500568_0082665 3300053139 Bacteria 1218
229 Ga0500634_0053635 3300053161 Bacteria 2162
230 Ga0500638_001569 3300053162 Bacteria 7318
231 Ga0500636_0089566 3300053177 Bacteria 1763
232 Ga0500636_0164553 3300053177 Bacteria 1206
233 Ga0500657_040589 3300053728 Bacteria 2164
234 Ga0500552_004432 3300053733 Bacteria 1479
235 Ga0500661_001009 3300055283 Bacteria 5287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0134371 Ga0495668_0134371_10_780 256
2 3300050513 nmdc:mga0rr50_717302_c1 nmdc:mga0rr50_717302_c1_17_787 256
3 iso_pu_bacteria 2728368998 2728753140 260
4 3300048924 Ga0496121_0151899 Ga0496121_0151899_540_1373 262
5 3300048929 Ga0496126_0509239 Ga0496126_0509239_89_922 262
6 3300048920 Ga0496117_0221941 Ga0496117_0221941_15_830 271
7 iso_pu_bacteria 2513237098 2513674456 272
8 iso_pu_bacteria 2513237104 2513722598 272
9 iso_pu_bacteria 2513237137 2513855621 272
10 iso_pu_bacteria 2513237145 2513919984 272
11 iso_pu_bacteria 2517572143 2517892161 272
12 iso_pu_bacteria 2524023228 2524534259 272
13 iso_pu_bacteria 2667528175 2671120585 272
14 iso_pu_bacteria 2721755755 2723844824 272
15 iso_pu_bacteria 2791355197 2793068762 272
16 iso_pu_bacteria 2844315083 2844319280 272
17 iso_pu_bacteria 2874604998 2874605459 272
18 iso_pu_bacteria 2903727486 2903731120 272
19 iso_pu_bacteria 2903768456 2903771785 272
20 iso_pu_bacteria 2904699407 2904702302 272
21 iso_pu_bacteria 2906602504 2906607371 272
22 iso_pu_bacteria 2906610324 2906617287 272
23 iso_pu_bacteria 2906635258 2906643317 272
24 iso_pu_bacteria 2906660503 2906662553 272
25 iso_pu_bacteria 2922361189 2922365591 272
26 iso_pu_bacteria 2922386360 2922391207 272
27 iso_pu_bacteria 2922425934 2922430537 272
28 iso_pu_bacteria 8006926726 8006931342 272
29 iso_pu_bacteria 8006933436 8006940434 272
30 iso_pu_bacteria 8006964411 8006967074 272
31 iso_pu_bacteria 8006973647 8006980123 272
32 iso_pu_bacteria 8006984368 8006988033 272
33 iso_pu_bacteria 8006994254 8006995759 272
34 iso_pu_bacteria 8019555841 8019556338 272
35 iso_pu_bacteria 8019565922 8019568974 272
36 iso_pu_bacteria 8056967851 8056968252 272
37 3300005843 Ga0068860_100001708 Ga0068860_10000170812 273
38 3300009545 Ga0105237_10034867 Ga0105237_100348674 273
39 3300025914 Ga0207671_10110718 Ga0207671_101107181 273
40 3300028381 Ga0268264_10000149 Ga0268264_1000014914 273
41 3300048921 Ga0496118_0223871 Ga0496118_0223871_45_881 273
42 3300048924 Ga0496121_0004375 Ga0496121_0004375_10858_11694 273
43 3300048929 Ga0496126_0046444 Ga0496126_0046444_314_1153 274
44 3300005330 Ga0070690_100358054 Ga0070690_1003580542 275
45 3300005985 Ga0081539_10000140 Ga0081539_1000014070 275
46 3300009176 Ga0105242_10679121 Ga0105242_106791211 275
47 3300009177 Ga0105248_10092410 Ga0105248_100924103 275
48 3300010375 Ga0105239_10646375 Ga0105239_106463751 275
49 3300025899 Ga0207642_10193536 Ga0207642_101935361 275
50 3300025911 Ga0207654_10219737 Ga0207654_102197372 275
51 3300025915 Ga0207693_10125453 Ga0207693_101254533 275
52 3300025934 Ga0207686_10307330 Ga0207686_103073302 275
53 3300025941 Ga0207711_10351843 Ga0207711_103518432 275
54 3300026035 Ga0207703_10271754 Ga0207703_102717543 275
55 3300031730 Ga0307516_10011365 Ga0307516_1001136512 275
56 3300035692 Ga0373935_0461959 Ga0373935_0461959_58_885 275
57 3300037068 Ga0373925_0051730 Ga0373925_0051730_102_929 275
58 3300046690 Ga0495624_0051293 Ga0495624_0051293_1525_2352 275
59 3300048904 Ga0496101_0082405 Ga0496101_0082405_598_1425 275
60 3300048909 Ga0496106_0121005 Ga0496106_0121005_351_1178 275
61 3300048911 Ga0496108_0080958 Ga0496108_0080958_1652_2479 275
62 3300048914 Ga0496111_0041601 Ga0496111_0041601_1840_2667 275
63 3300048915 Ga0496112_0255012 Ga0496112_0255012_632_1459 275
64 3300048924 Ga0496121_0040256 Ga0496121_0040256_557_1408 275
65 3300053077 Ga0495601_0071297 Ga0495601_0071297_1297_2124 275
66 3300053077 Ga0495601_0352954 Ga0495601_0352954_30_857 275
67 3300005327 Ga0070658_10111207 Ga0070658_101112072 276
68 3300005327 Ga0070658_10397411 Ga0070658_103974112 276
69 3300005330 Ga0070690_100069856 Ga0070690_1000698561 276
70 3300005336 Ga0070680_100113782 Ga0070680_1001137821 276
71 3300005337 Ga0070682_100345737 Ga0070682_1003457371 276
72 3300005338 Ga0068868_100125212 Ga0068868_1001252122 276
73 3300005339 Ga0070660_100091681 Ga0070660_1000916813 276
74 3300005340 Ga0070689_100188044 Ga0070689_1001880441 276
75 3300005344 Ga0070661_100102218 Ga0070661_1001022184 276
76 3300005344 Ga0070661_100119487 Ga0070661_1001194872 276
77 3300005347 Ga0070668_100056768 Ga0070668_1000567683 276
78 3300005347 Ga0070668_100137196 Ga0070668_1001371962 276
79 3300005347 Ga0070668_100551318 Ga0070668_1005513181 276
80 3300005354 Ga0070675_100646417 Ga0070675_1006464171 276
81 3300005355 Ga0070671_100353722 Ga0070671_1003537222 276
82 3300005364 Ga0070673_100537349 Ga0070673_1005373491 276
83 3300005434 Ga0070709_10068786 Ga0070709_100687861 276
84 3300005436 Ga0070713_100029886 Ga0070713_1000298861 276
85 3300005437 Ga0070710_10030098 Ga0070710_100300982 276
86 3300005439 Ga0070711_100011425 Ga0070711_1000114254 276
87 3300005439 Ga0070711_100020708 Ga0070711_1000207082 276
88 3300005455 Ga0070663_100007906 Ga0070663_1000079065 276
89 3300005455 Ga0070663_100321174 Ga0070663_1003211742 276
90 3300005456 Ga0070678_100430039 Ga0070678_1004300391 276
91 3300005471 Ga0070698_100193567 Ga0070698_1001935673 276
92 3300005530 Ga0070679_100204640 Ga0070679_1002046403 276
93 3300005535 Ga0070684_100012560 Ga0070684_1000125606 276
94 3300005543 Ga0070672_100054147 Ga0070672_1000541472 276
95 3300005563 Ga0068855_100025881 Ga0068855_1000258813 276
96 3300005577 Ga0068857_100018326 Ga0068857_1000183264 276
97 3300005616 Ga0068852_100399425 Ga0068852_1003994252 276
98 3300005834 Ga0068851_10048118 Ga0068851_100481181 276
99 3300005842 Ga0068858_100356787 Ga0068858_1003567871 276
100 3300005842 Ga0068858_100598022 Ga0068858_1005980222 276
101 3300005844 Ga0068862_100067147 Ga0068862_1000671473 276
102 3300005844 Ga0068862_100153328 Ga0068862_1001533284 276
103 3300005983 Ga0081540_1002625 Ga0081540_10026255 276
104 3300005983 Ga0081540_1003015 Ga0081540_100301512 276
105 3300005983 Ga0081540_1032544 Ga0081540_10325441 276
106 3300006038 Ga0075365_10045911 Ga0075365_100459112 276
107 3300006175 Ga0070712_100015756 Ga0070712_1000157565 276
108 3300006195 Ga0075366_10168250 Ga0075366_101682501 276
109 3300006237 Ga0097621_100054849 Ga0097621_1000548492 276
110 3300006844 Ga0075428_100196288 Ga0075428_1001962882 276
111 3300006844 Ga0075428_100261922 Ga0075428_1002619222 276
112 3300009093 Ga0105240_10047264 Ga0105240_100472645 276
113 3300009093 Ga0105240_10144402 Ga0105240_101444022 276
114 3300009094 Ga0111539_10082000 Ga0111539_100820003 276
115 3300009094 Ga0111539_10223896 Ga0111539_102238962 276
116 3300009101 Ga0105247_10028425 Ga0105247_100284253 276
117 3300009101 Ga0105247_10093656 Ga0105247_100936562 276
118 3300009147 Ga0114129_10225103 Ga0114129_102251032 276
119 3300009148 Ga0105243_10030150 Ga0105243_100301504 276
120 3300009177 Ga0105248_10318124 Ga0105248_103181242 276
121 3300009545 Ga0105237_10069242 Ga0105237_100692425 276
122 3300009551 Ga0105238_10008599 Ga0105238_100085994 276
123 3300010375 Ga0105239_10049791 Ga0105239_100497911 276
124 3300010375 Ga0105239_10074047 Ga0105239_100740474 276
125 3300010375 Ga0105239_10218364 Ga0105239_102183641 276
126 3300011119 Ga0105246_10186742 Ga0105246_101867422 276
127 3300013104 Ga0157370_10063105 Ga0157370_100631052 276
128 3300013104 Ga0157370_10090012 Ga0157370_100900124 276
129 3300013105 Ga0157369_10216938 Ga0157369_102169381 276
130 3300013297 Ga0157378_10031310 Ga0157378_100313104 276
131 3300013297 Ga0157378_10096838 Ga0157378_100968382 276
132 3300013306 Ga0163162_10026594 Ga0163162_100265942 276
133 3300013306 Ga0163162_10171935 Ga0163162_101719353 276
134 3300013306 Ga0163162_10468423 Ga0163162_104684232 276
135 3300013308 Ga0157375_10021748 Ga0157375_100217482 276
136 3300013308 Ga0157375_10085215 Ga0157375_100852153 276
137 3300013308 Ga0157375_10430490 Ga0157375_104304901 276
138 3300013308 Ga0157375_10517469 Ga0157375_105174691 276
139 3300014326 Ga0157380_10088377 Ga0157380_100883773 276
140 3300014326 Ga0157380_10142592 Ga0157380_101425923 276
141 3300014326 Ga0157380_10405493 Ga0157380_104054932 276
142 3300014968 Ga0157379_10043457 Ga0157379_100434572 276
143 3300017792 Ga0163161_10018470 Ga0163161_100184704 276
144 3300025261 Ga0209233_1000804 Ga0209233_10008045 276
145 3300025315 Ga0207697_10011142 Ga0207697_100111424 276
146 3300025898 Ga0207692_10078743 Ga0207692_100787433 276
147 3300025901 Ga0207688_10052137 Ga0207688_100521373 276
148 3300025909 Ga0207705_10056050 Ga0207705_100560503 276
149 3300025909 Ga0207705_10180391 Ga0207705_101803911 276
150 3300025912 Ga0207707_10010823 Ga0207707_100108237 276
151 3300025913 Ga0207695_10077486 Ga0207695_100774862 276
152 3300025914 Ga0207671_10074833 Ga0207671_100748332 276
153 3300025915 Ga0207693_10024695 Ga0207693_100246955 276
154 3300025916 Ga0207663_10014747 Ga0207663_100147472 276
155 3300025917 Ga0207660_10007099 Ga0207660_100070996 276
156 3300025919 Ga0207657_10003269 Ga0207657_1000326914 276
157 3300025920 Ga0207649_10216170 Ga0207649_102161701 276
158 3300025921 Ga0207652_10021470 Ga0207652_100214703 276
159 3300025924 Ga0207694_10304130 Ga0207694_103041302 276
160 3300025928 Ga0207700_10247989 Ga0207700_102479891 276
161 3300025933 Ga0207706_10053284 Ga0207706_100532843 276
162 3300025933 Ga0207706_10401129 Ga0207706_104011292 276
163 3300025935 Ga0207709_10027240 Ga0207709_100272402 276
164 3300025936 Ga0207670_10249849 Ga0207670_102498491 276
165 3300025937 Ga0207669_10218293 Ga0207669_102182932 276
166 3300025940 Ga0207691_10346343 Ga0207691_103463432 276
167 3300025941 Ga0207711_10264236 Ga0207711_102642362 276
168 3300025942 Ga0207689_10006892 Ga0207689_100068928 276
169 3300025944 Ga0207661_10038591 Ga0207661_100385914 276
170 3300025945 Ga0207679_10162572 Ga0207679_101625722 276
171 3300025949 Ga0207667_10010367 Ga0207667_100103672 276
172 3300025949 Ga0207667_10034067 Ga0207667_100340675 276
173 3300025960 Ga0207651_10709207 Ga0207651_107092071 276
174 3300025972 Ga0207668_10040273 Ga0207668_100402734 276
175 3300026041 Ga0207639_10107607 Ga0207639_101076072 276
176 3300026041 Ga0207639_10202350 Ga0207639_102023502 276
177 3300026067 Ga0207678_10181460 Ga0207678_101814602 276
178 3300026075 Ga0207708_10167522 Ga0207708_101675222 276
179 3300026088 Ga0207641_10534164 Ga0207641_105341641 276
180 3300026089 Ga0207648_10035793 Ga0207648_100357932 276
181 3300026095 Ga0207676_10388617 Ga0207676_103886171 276
182 3300026116 Ga0207674_10033144 Ga0207674_100331442 276
183 3300026118 Ga0207675_100074428 Ga0207675_1000744283 276
184 3300026118 Ga0207675_100091758 Ga0207675_1000917583 276
185 3300026121 Ga0207683_10015556 Ga0207683_100155562 276
186 3300026121 Ga0207683_10200833 Ga0207683_102008332 276
187 3300026142 Ga0207698_10081464 Ga0207698_100814643 276
188 3300027357 Ga0209589_1000001 Ga0209589_1000001149 276
189 3300027361 Ga0209489_100001 Ga0209489_100001149 276
190 3300027363 Ga0209700_100001 Ga0209700_100001149 276
191 3300028379 Ga0268266_10270286 Ga0268266_102702862 276
192 3300028380 Ga0268265_10047167 Ga0268265_100471672 276
193 3300028786 Ga0307517_10000249 Ga0307517_1000024938 276
194 3300030521 Ga0307511_10049232 Ga0307511_100492323 276
195 3300031507 Ga0307509_10004311 Ga0307509_1000431119 276
196 3300031730 Ga0307516_10038469 Ga0307516_100384694 276
197 3300031730 Ga0307516_10176895 Ga0307516_101768951 276
198 3300031730 Ga0307516_10473910 Ga0307516_104739101 276
199 3300031852 Ga0307410_10409771 Ga0307410_104097711 276
200 3300032002 Ga0307416_100259723 Ga0307416_1002597232 276
201 3300032002 Ga0307416_100384618 Ga0307416_1003846182 276
202 3300035725 Ga0373947_0018382 Ga0373947_0018382_2133_3068 276
203 3300037471 Ga0395905_0057682 Ga0395905_0057682_1433_2272 276
204 3300044656 Ga0466969_0162092 Ga0466969_0162092_82_915 276
205 3300044684 Ga0466966_0067153 Ga0466966_0067153_566_1399 276
206 3300044694 Ga0466963_0158820 Ga0466963_0158820_720_1562 276
207 3300044735 Ga0466968_0174348 Ga0466968_0174348_132_965 276
208 3300044842 Ga0466957_0095722 Ga0466957_0095722_255_1088 276
209 3300044842 Ga0466957_0099130 Ga0466957_0099130_579_1421 276
210 3300045976 Ga0466967_0360497 Ga0466967_0360497_426_1268 276
211 3300046452 Ga0495617_062725 Ga0495617_062725_199_1032 276
212 3300046460 Ga0495638_0106794 Ga0495638_0106794_237_1070 276
213 3300046475 Ga0495639_0042044 Ga0495639_0042044_110_949 276
214 3300046492 Ga0495585_0104757 Ga0495585_0104757_291_1130 276
215 3300046507 Ga0495606_0121570 Ga0495606_0121570_586_1416 276
216 3300046518 Ga0495631_0064944 Ga0495631_0064944_305_1144 276
217 3300046537 Ga0495598_0042959 Ga0495598_0042959_361_1194 276
218 3300046557 Ga0495622_0039840 Ga0495622_0039840_1026_1865 276
219 3300046616 Ga0495668_0138740 Ga0495668_0138740_204_1037 276
220 3300046674 Ga0495588_0000648 Ga0495588_0000648_1893_2732 276
221 3300046694 Ga0495649_0168043 Ga0495649_0168043_239_1072 276
222 3300047322 Ga0495680_0289724 Ga0495680_0289724_117_965 276
223 3300048903 Ga0496100_0051360 Ga0496100_0051360_293_1132 276
224 3300048904 Ga0496101_0060093 Ga0496101_0060093_659_1498 276
225 3300048904 Ga0496101_0107507 Ga0496101_0107507_927_1760 276
226 3300048904 Ga0496101_0388969 Ga0496101_0388969_252_1085 276
227 3300048905 Ga0496102_0002765 Ga0496102_0002765_14032_14871 276
228 3300048905 Ga0496102_0101997 Ga0496102_0101997_1353_2192 276
229 3300048905 Ga0496102_0153003 Ga0496102_0153003_72_905 276
230 3300048905 Ga0496102_0337085 Ga0496102_0337085_324_1157 276
231 3300048906 Ga0496103_0105790 Ga0496103_0105790_293_1132 276
232 3300048909 Ga0496106_0004983 Ga0496106_0004983_8745_9584 276
233 3300048909 Ga0496106_0007734 Ga0496106_0007734_451_1386 276
234 3300048909 Ga0496106_0056978 Ga0496106_0056978_981_1814 276
235 3300048910 Ga0496107_0234320 Ga0496107_0234320_76_915 276
236 3300048914 Ga0496111_0015337 Ga0496111_0015337_1080_1919 276
237 3300048916 Ga0496113_0014818 Ga0496113_0014818_4023_4862 276
238 3300048917 Ga0496114_0025525 Ga0496114_0025525_576_1415 276
239 3300048918 Ga0496115_0023965 Ga0496115_0023965_3255_4094 276
240 3300048921 Ga0496118_0111921 Ga0496118_0111921_548_1378 276
241 3300048924 Ga0496121_0001749 Ga0496121_0001749_26526_27461 276
242 3300048924 Ga0496121_0049291 Ga0496121_0049291_1351_2190 276
243 3300048924 Ga0496121_0203524 Ga0496121_0203524_322_1158 276
244 3300048924 Ga0496121_0271943 Ga0496121_0271943_319_1149 276
245 3300048927 Ga0496124_0010603 Ga0496124_0010603_4779_5714 276
246 3300048929 Ga0496126_0034295 Ga0496126_0034295_1139_2074 276
247 3300049577 Ga0501041_0207096 Ga0501041_0207096_264_1097 276
248 3300050492 nmdc:mga0yw44_45023_c1 nmdc:mga0yw44_45023_c1_1611_2450 276
249 3300050492 nmdc:mga0yw44_6835_c1 nmdc:mga0yw44_6835_c1_1337_2170 276
250 3300050507 nmdc:mga05p37_31066_c1 nmdc:mga05p37_31066_c1_4162_5001 276
251 3300050511 nmdc:mga08y16_560575_c1 nmdc:mga08y16_560575_c1_142_981 276
252 3300053093 Ga0500651_0025793 Ga0500651_0025793_652_1503 276
253 3300053093 Ga0500651_0032643 Ga0500651_0032643_74_907 276
254 3300053119 Ga0500595_000306 Ga0500595_000306_11310_12140 276
255 3300053119 Ga0500595_001964 Ga0500595_001964_3459_4304 276
256 3300053119 Ga0500595_023409 Ga0500595_023409_84_917 276
257 3300053130 Ga0500642_0090060 Ga0500642_0090060_553_1386 276
258 3300053134 Ga0500658_0112327 Ga0500658_0112327_70_903 276
259 3300053139 Ga0500568_0082665 Ga0500568_0082665_115_975 276
260 3300053161 Ga0500634_0053635 Ga0500634_0053635_1188_2027 276
261 3300053162 Ga0500638_001569 Ga0500638_001569_3778_4608 276
262 3300053177 Ga0500636_0089566 Ga0500636_0089566_603_1538 276
263 3300053177 Ga0500636_0164553 Ga0500636_0164553_326_1156 276
264 3300053728 Ga0500657_040589 Ga0500657_040589_465_1400 276
265 3300053733 Ga0500552_004432 Ga0500552_004432_379_1314 276
266 3300055283 Ga0500661_001009 Ga0500661_001009_3912_4742 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

194

0.54

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.7597 4 260
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.7469 5 258
3d03-assembly1.cif.gz_A 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes 0.7459 5 258
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.7446 4 260
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.737 4 260
ID Description Score Start End Superfamily
af_Q8IM55_21_293_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8325 4 265 3.60.21.10
af_Q8IM55_21_293_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7985 4 265 3.60.21.10
af_Q66H71_55_308_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7846 23 273 3.60.21.10
af_A0A1D8PMT0_76_326_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7642 6 227 3.60.21.10
af_Q66H71_55_308_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7467 23 273 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7C9VRR1-F1-model_v4 Metallophosphoesterase 0.9942 80 270 GO:0005737
AF-A0A4Q8QI69-F1-model_v4 Phosphohydrolase 0.9934 1 162 GO:0005737
GO:0016787
AF-A0A2T2QL24-F1-model_v4 deleted 0.9933 1 273
AF-A0A4Q8QI69-F1-model_v4 Phosphohydrolase 0.9873 1 162 GO:0005737
GO:0016787
AF-A0A2T2QL24-F1-model_v4 deleted 0.9862 1 273

Feature Viewer

pLDDT pTM Quality
96.07 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map