F374182

General Info

Members Datasets Scaffolds Average Seq Length
266 152 532 195

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10123307|Ga0307413_101233072
Length 225
Sequence MNQDQVLSHFRETEALLEGHFLLSSGLHSPTYLQCALALQYPSDAAKFGRAIAERLVGTGSGSDRPLNSPPYKGGVAAASADRVVTDAEGRSTSMQFDTVASPAIGGLIIGFAVAQTLNKRFIWAERQEGKMILRRGFTLRPAERVLVVEDVITTGGSTRECIAAIEENGGKVVSAASIIDRSNGKADVGVPRVALAAQEVPSYDKDSCPLCAAGSEPYKPGSRK

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
136 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
144 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
145 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
146 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
149 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
150 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 2.26
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 24.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10123307 3300031824 Unclassified 1759
2 rootL2_10075814 3300003322 Bacteria 6276
3 Ga0065712_10072643 3300005290 Bacteria 4669
4 Ga0065715_10447069 3300005293 Bacteria 828
5 Ga0070658_10132291 3300005327 Unclassified 2079
6 Ga0070676_10127684 3300005328 Unclassified 1604
7 Ga0070676_10470730 3300005328 Bacteria 887
8 Ga0070683_101285599 3300005329 Unclassified 703
9 Ga0070690_100003659 3300005330 Bacteria 8464
10 Ga0070670_100007154 3300005331 Bacteria 9453
11 Ga0070666_10006652 3300005335 Bacteria 7108
12 Ga0070680_100144341 3300005336 Bacteria 1997
13 Ga0070680_100327500 3300005336 Bacteria 1301
14 Ga0068868_100008689 3300005338 Bacteria 7274
15 Ga0070660_100097258 3300005339 Bacteria 2329
16 Ga0070661_100030644 3300005344 Bacteria 3886
17 Ga0070661_100056885 3300005344 Unclassified 2866
18 Ga0070661_100452735 3300005344 Bacteria 1021
19 Ga0070668_100012247 3300005347 Bacteria 6391
20 Ga0070675_100317953 3300005354 Bacteria 1375
21 Ga0070671_100011457 3300005355 Bacteria 7128
22 Ga0070671_100067215 3300005355 Bacteria 2988
23 Ga0070671_100084852 3300005355 Bacteria 2649
24 Ga0070673_100296432 3300005364 Bacteria 1422
25 Ga0070688_100016543 3300005365 Bacteria 4219
26 Ga0070688_100063923 3300005365 Bacteria 2334
27 Ga0070659_100009102 3300005366 Bacteria 7284
28 Ga0070659_100071473 3300005366 Bacteria 2759
29 Ga0070659_100569565 3300005366 Unclassified 971
30 Ga0070667_100014760 3300005367 Bacteria 6454
31 Ga0070667_100354384 3300005367 Bacteria 1329
32 Ga0070703_10065048 3300005406 Unclassified 1203
33 Ga0070710_10344212 3300005437 Bacteria 985
34 Ga0070701_10705091 3300005438 Unclassified 679
35 Ga0070678_100048314 3300005456 Unclassified 3063
36 Ga0070678_100222461 3300005456 Bacteria 1570
37 Ga0070678_101014758 3300005456 Bacteria 763
38 Ga0070662_100759314 3300005457 Bacteria 823
39 Ga0070681_10034581 3300005458 Bacteria 5074
40 Ga0070681_10064102 3300005458 Bacteria 3646
41 Ga0070681_10558292 3300005458 Unclassified 1059
42 Ga0068867_100253768 3300005459 Unclassified 1431
43 Ga0068867_100629788 3300005459 Bacteria 939
44 Ga0070685_10040213 3300005466 Bacteria 2660
45 Ga0070685_10477503 3300005466 Unclassified 878
46 Ga0070699_100340536 3300005518 Bacteria 1350
47 Ga0070679_100011688 3300005530 Bacteria 8370
48 Ga0070697_100067781 3300005536 Bacteria 2920
49 Ga0070697_101161232 3300005536 Unclassified 688
50 Ga0068853_100036069 3300005539 Unclassified 4202
51 Ga0068853_100053115 3300005539 Bacteria 3490
52 Ga0068853_100108820 3300005539 Bacteria 2459
53 Ga0068853_100386430 3300005539 Bacteria 1308
54 Ga0068853_100449783 3300005539 Bacteria 1211
55 Ga0070672_100201417 3300005543 Bacteria 1665
56 Ga0070686_100004511 3300005544 Bacteria 7677
57 Ga0070704_100306786 3300005549 Unclassified 1325
58 Ga0068855_100062349 3300005563 Bacteria 4353
59 Ga0068855_100247976 3300005563 Unclassified 1987
60 Ga0068855_100336118 3300005563 Unclassified 1666
61 Ga0070664_100001584 3300005564 Bacteria 18178
62 Ga0070664_100167929 3300005564 Unclassified 1945
63 Ga0070664_100568989 3300005564 Unclassified 1049
64 Ga0068857_100018645 3300005577 Bacteria 6090
65 Ga0068854_100063178 3300005578 Bacteria 2687
66 Ga0068856_100015117 3300005614 Bacteria 7456
67 Ga0068856_100070886 3300005614 Unclassified 3449
68 Ga0068856_100171964 3300005614 Bacteria 2179
69 Ga0070702_100042652 3300005615 Unclassified 2552
70 Ga0068852_100092332 3300005616 Bacteria 2711
71 Ga0068859_100016840 3300005617 Bacteria 7338
72 Ga0068859_100080787 3300005617 Bacteria 3292
73 Ga0068859_100082878 3300005617 Bacteria 3249
74 Ga0068859_100088962 3300005617 Bacteria 3137
75 Ga0068864_100010999 3300005618 Bacteria 7483
76 Ga0068864_100028096 3300005618 Bacteria 4754
77 Ga0068864_100667129 3300005618 Bacteria 1014
78 Ga0068851_10017202 3300005834 Bacteria 3469
79 Ga0068863_100080654 3300005841 Bacteria 3082
80 Ga0068858_100266029 3300005842 Bacteria 1631
81 Ga0068860_100014818 3300005843 Bacteria 7626
82 Ga0068860_100111448 3300005843 Bacteria 2616
83 Ga0068860_101567208 3300005843 Unclassified 680
84 Ga0081455_10154809 3300005937 Bacteria 1763
85 Ga0070716_100055670 3300006173 Bacteria 2264
86 Ga0097621_100006136 3300006237 Bacteria 8511
87 Ga0097621_100288009 3300006237 Bacteria 1447
88 Ga0068871_100034447 3300006358 Bacteria 4018
89 Ga0068865_100003721 3300006881 Bacteria 9154
90 Ga0097620_100016839 3300006931 Bacteria 7338
91 Ga0097620_100080786 3300006931 Bacteria 3292
92 Ga0097620_100082877 3300006931 Bacteria 3249
93 Ga0097620_100088968 3300006931 Bacteria 3137
94 Ga0075435_100904305 3300007076 Unclassified 770
95 Ga0105240_10208280 3300009093 Bacteria 2287
96 Ga0105247_10047757 3300009101 Bacteria 2629
97 Ga0105247_10172832 3300009101 Unclassified 1438
98 Ga0105243_10151414 3300009148 Bacteria 1990
99 Ga0105241_10076458 3300009174 Bacteria 2611
100 Ga0105241_10094529 3300009174 Unclassified 2364
101 Ga0105242_10014018 3300009176 Bacteria 6203
102 Ga0105248_10184180 3300009177 Bacteria 2353
103 Ga0105237_10101990 3300009545 Bacteria 2861
104 Ga0105237_10904923 3300009545 Unclassified 889
105 Ga0105249_10000322 3300009553 Bacteria 48543
106 Ga0105249_10056508 3300009553 Bacteria 3593
107 Ga0105249_10849238 3300009553 Bacteria 978
108 Ga0105249_12216109 3300009553 Unclassified 622
109 Ga0105239_10486835 3300010375 Bacteria 1402
110 Ga0105239_10599305 3300010375 Bacteria 1257
111 Ga0105239_10733551 3300010375 Bacteria 1130
112 Ga0157373_10008394 3300013100 Bacteria 7671
113 Ga0157373_10138102 3300013100 Bacteria 1714
114 Ga0157370_10036799 3300013104 Bacteria 4748
115 Ga0157369_10001493 3300013105 Bacteria 28692
116 Ga0157369_10122630 3300013105 Bacteria 2757
117 Ga0157369_11162041 3300013105 Unclassified 788
118 Ga0157374_10001670 3300013296 Bacteria 18591
119 Ga0157374_10011770 3300013296 Bacteria 7589
120 Ga0157374_10027519 3300013296 Bacteria 5132
121 Ga0157374_10237776 3300013296 Unclassified 1791
122 Ga0157374_10273645 3300013296 Bacteria 1665
123 Ga0157378_10011381 3300013297 Bacteria 7787
124 Ga0163162_10000019 3300013306 Bacteria 220603
125 Ga0163162_10012048 3300013306 Bacteria 8433
126 Ga0163162_10288694 3300013306 Bacteria 1772
127 Ga0163162_11050966 3300013306 Bacteria 922
128 Ga0157372_10068976 3300013307 Unclassified 3977
129 Ga0157372_10210061 3300013307 Bacteria 2255
130 Ga0157372_10285485 3300013307 Unclassified 1919
131 Ga0157372_10433250 3300013307 Bacteria 1533
132 Ga0157372_10687041 3300013307 Bacteria 1191
133 Ga0157372_11150144 3300013307 Unclassified 897
134 Ga0157375_10030409 3300013308 Bacteria 5092
135 Ga0163163_10030938 3300014325 Bacteria 5161
136 Ga0163163_10319709 3300014325 Bacteria 1606
137 Ga0157380_10071023 3300014326 Bacteria 2815
138 Ga0157379_10016702 3300014968 Bacteria 6457
139 Ga0157379_10278403 3300014968 Bacteria 1522
140 Ga0157376_10025053 3300014969 Bacteria 4694
141 Ga0157376_10052744 3300014969 Bacteria 3382
142 Ga0157376_10128938 3300014969 Bacteria 2254
143 Ga0157376_10506885 3300014969 Bacteria 1187
144 Ga0163161_10005945 3300017792 Bacteria 8460
145 Ga0163161_10315570 3300017792 Bacteria 1234
146 Ga0213874_10055414 3300021377 Unclassified 1228
147 Ga0207682_10203411 3300025893 Bacteria 911
148 Ga0207710_10052985 3300025900 Unclassified 1825
149 Ga0207680_10028386 3300025903 Bacteria 3129
150 Ga0207645_10191748 3300025907 Unclassified 1343
151 Ga0207654_10222818 3300025911 Unclassified 1252
152 Ga0207707_10000625 3300025912 Bacteria 35059
153 Ga0207695_10441411 3300025913 Bacteria 1185
154 Ga0207671_10831297 3300025914 Bacteria 732
155 Ga0207660_10172954 3300025917 Bacteria 1673
156 Ga0207657_10086203 3300025919 Bacteria 2629
157 Ga0207649_10437591 3300025920 Unclassified 985
158 Ga0207649_10554571 3300025920 Bacteria 879
159 Ga0207650_10092678 3300025925 Bacteria 2311
160 Ga0207644_10016218 3300025931 Bacteria 5012
161 Ga0207644_10526994 3300025931 Unclassified 976
162 Ga0207690_10026162 3300025932 Bacteria 3673
163 Ga0207690_10231081 3300025932 Bacteria 1420
164 Ga0207706_10034211 3300025933 Bacteria 4521
165 Ga0207706_10346045 3300025933 Bacteria 1293
166 Ga0207686_10019439 3300025934 Bacteria 3864
167 Ga0207670_10485584 3300025936 Unclassified 1001
168 Ga0207704_10152436 3300025938 Bacteria 1633
169 Ga0207665_10047850 3300025939 Bacteria 2868
170 Ga0207691_10457707 3300025940 Unclassified 1085
171 Ga0207711_10008495 3300025941 Bacteria 8591
172 Ga0207711_10499614 3300025941 Bacteria 1133
173 Ga0207661_10273218 3300025944 Unclassified 1509
174 Ga0207679_10017462 3300025945 Unclassified 4787
175 Ga0207679_10065165 3300025945 Bacteria 2725
176 Ga0207679_11181652 3300025945 Bacteria 702
177 Ga0207667_10134863 3300025949 Bacteria 2542
178 Ga0207667_10158519 3300025949 Bacteria 2328
179 Ga0207667_10200899 3300025949 Bacteria 2045
180 Ga0207667_11378574 3300025949 Bacteria 679
181 Ga0207651_10154870 3300025960 Bacteria 1789
182 Ga0207712_10001566 3300025961 Bacteria 15403
183 Ga0207712_10039775 3300025961 Bacteria 3223
184 Ga0207712_10312429 3300025961 Bacteria 1294
185 Ga0207668_10000665 3300025972 Bacteria 21087
186 Ga0207640_10243127 3300025981 Unclassified 1392
187 Ga0207640_10382595 3300025981 Bacteria 1141
188 Ga0207703_10269300 3300026035 Unclassified 1542
189 Ga0207639_10008773 3300026041 Bacteria 6948
190 Ga0207639_10375179 3300026041 Bacteria 1276
191 Ga0207639_10456847 3300026041 Bacteria 1160
192 Ga0207639_10486679 3300026041 Unclassified 1125
193 Ga0207702_10468537 3300026078 Bacteria 1224
194 Ga0207641_10016317 3300026088 Bacteria 6081
195 Ga0207648_10306692 3300026089 Bacteria 1425
196 Ga0207648_10324527 3300026089 Unclassified 1384
197 Ga0207648_10620074 3300026089 Bacteria 998
198 Ga0207676_10018183 3300026095 Bacteria 5104
199 Ga0207676_10207741 3300026095 Unclassified 1735
200 Ga0207674_10242872 3300026116 Bacteria 1748
201 Ga0207675_100465699 3300026118 Bacteria 1254
202 Ga0207683_10138577 3300026121 Unclassified 2191
203 Ga0207683_10882010 3300026121 Bacteria 831
204 Ga0207698_10022045 3300026142 Bacteria 4418
205 Ga0207698_10126770 3300026142 Bacteria 2172
206 Ga0207698_10128087 3300026142 Unclassified 2163
207 Ga0268265_10422084 3300028380 Unclassified 1238
208 Ga0268264_10008678 3300028381 Bacteria 8446
209 Ga0268264_10010363 3300028381 Bacteria 7709
210 Ga0307408_100114571 3300031548 Bacteria 2077
211 Ga0307408_100414643 3300031548 Unclassified 1160
212 Ga0307408_100714364 3300031548 Bacteria 902
213 Ga0307405_10101002 3300031731 Bacteria 1934
214 Ga0307405_10992026 3300031731 Unclassified 716
215 Ga0307410_10020131 3300031852 Unclassified 4075
216 Ga0307410_10470188 3300031852 Unclassified 1029
217 Ga0307410_10775846 3300031852 Unclassified 813
218 Ga0307406_10021126 3300031901 Bacteria 3846
219 Ga0307406_10081226 3300031901 Bacteria 2155
220 Ga0307406_10356483 3300031901 Bacteria 1145
221 Ga0307407_10009755 3300031903 Bacteria 4489
222 Ga0307407_10033325 3300031903 Unclassified 2810
223 Ga0307407_10252428 3300031903 Bacteria 1209
224 Ga0307412_10055298 3300031911 Bacteria 2639
225 Ga0307412_10472676 3300031911 Unclassified 1038
226 Ga0307412_10645631 3300031911 Bacteria 902
227 Ga0307409_100006017 3300031995 Bacteria 7074
228 Ga0307409_100011924 3300031995 Bacteria 5508
229 Ga0307409_100255029 3300031995 Bacteria 1606
230 Ga0307409_100467524 3300031995 Bacteria 1221
231 Ga0307409_100506467 3300031995 Bacteria 1177
232 Ga0307409_101643791 3300031995 Unclassified 671
233 Ga0307416_100010344 3300032002 Bacteria 6158
234 Ga0307416_100105848 3300032002 Bacteria 2464
235 Ga0307416_100317760 3300032002 Unclassified 1558
236 Ga0307416_100340007 3300032002 Unclassified 1513
237 Ga0307416_101426181 3300032002 Bacteria 798
238 Ga0307416_101499873 3300032002 Bacteria 780
239 Ga0307414_10016374 3300032004 Bacteria 4506
240 Ga0307414_10220044 3300032004 Bacteria 1558
241 Ga0307415_100004129 3300032126 Bacteria 7492
242 Ga0307415_100018096 3300032126 Bacteria 4245
243 Ga0307415_100093393 3300032126 Bacteria 2185
244 Ga0316574_0252897 3300035398 Unclassified 1126
245 Ga0395905_0013359 3300037471 Bacteria 7869
246 Ga0436363_1394020 3300039450 Bacteria 1647
247 Ga0451791_0953191 3300041451 Bacteria 1156
248 Ga0451797_0730118 3300041453 Unclassified 653
249 Ga0450898_085671 3300042134 Unclassified 645
250 Ga0450902_049015 3300042137 Bacteria 724
251 Ga0495621_0065238 3300046539 Bacteria 1330
252 Ga0495668_0002181 3300046616 Bacteria 16758
253 Ga0496104_0687950 3300048907 Bacteria 931
254 Ga0496106_0294715 3300048909 Bacteria 1301
255 Ga0496108_0035111 3300048911 Bacteria 4167
256 Ga0496114_0014054 3300048917 Bacteria 6420
257 Ga0501217_023082 3300049661 Bacteria 1480
258 Ga0501235_011949 3300049669 Bacteria 1908
259 Ga0501242_000509 3300049674 Bacteria 3447
260 Ga0501247_000311 3300049677 Bacteria 3543
261 Ga0501249_001693 3300049679 Bacteria 4490
262 Ga0501257_003180 3300049686 Bacteria 3501
263 Ga0501268_000070 3300049765 Bacteria 8047
264 Ga0501270_001794 3300049767 Bacteria 2121
265 Ga0495601_0540744 3300053077 Unclassified 750
266 Ga0500616_0001365 3300053153 Bacteria 23725
267 Ga0307413_10123307
268 rootL2_10075814
269 Ga0065712_10072643
270 Ga0065715_10447069
271 Ga0070658_10132291
272 Ga0070676_10127684
273 Ga0070676_10470730
274 Ga0070683_101285599
275 Ga0070690_100003659
276 Ga0070670_100007154
277 Ga0070666_10006652
278 Ga0070680_100144341
279 Ga0070680_100327500
280 Ga0068868_100008689
281 Ga0070660_100097258
282 Ga0070661_100030644
283 Ga0070661_100056885
284 Ga0070661_100452735
285 Ga0070668_100012247
286 Ga0070675_100317953
287 Ga0070671_100011457
288 Ga0070671_100067215
289 Ga0070671_100084852
290 Ga0070673_100296432
291 Ga0070688_100016543
292 Ga0070688_100063923
293 Ga0070659_100009102
294 Ga0070659_100071473
295 Ga0070659_100569565
296 Ga0070667_100014760
297 Ga0070667_100354384
298 Ga0070703_10065048
299 Ga0070710_10344212
300 Ga0070701_10705091
301 Ga0070678_100048314
302 Ga0070678_100222461
303 Ga0070678_101014758
304 Ga0070662_100759314
305 Ga0070681_10034581
306 Ga0070681_10064102
307 Ga0070681_10558292
308 Ga0068867_100253768
309 Ga0068867_100629788
310 Ga0070685_10040213
311 Ga0070685_10477503
312 Ga0070699_100340536
313 Ga0070679_100011688
314 Ga0070697_100067781
315 Ga0070697_101161232
316 Ga0068853_100036069
317 Ga0068853_100053115
318 Ga0068853_100108820
319 Ga0068853_100386430
320 Ga0068853_100449783
321 Ga0070672_100201417
322 Ga0070686_100004511
323 Ga0070704_100306786
324 Ga0068855_100062349
325 Ga0068855_100247976
326 Ga0068855_100336118
327 Ga0070664_100001584
328 Ga0070664_100167929
329 Ga0070664_100568989
330 Ga0068857_100018645
331 Ga0068854_100063178
332 Ga0068856_100015117
333 Ga0068856_100070886
334 Ga0068856_100171964
335 Ga0070702_100042652
336 Ga0068852_100092332
337 Ga0068859_100016840
338 Ga0068859_100080787
339 Ga0068859_100082878
340 Ga0068859_100088962
341 Ga0068864_100010999
342 Ga0068864_100028096
343 Ga0068864_100667129
344 Ga0068851_10017202
345 Ga0068863_100080654
346 Ga0068858_100266029
347 Ga0068860_100014818
348 Ga0068860_100111448
349 Ga0068860_101567208
350 Ga0081455_10154809
351 Ga0070716_100055670
352 Ga0097621_100006136
353 Ga0097621_100288009
354 Ga0068871_100034447
355 Ga0068865_100003721
356 Ga0097620_100016839
357 Ga0097620_100080786
358 Ga0097620_100082877
359 Ga0097620_100088968
360 Ga0075435_100904305
361 Ga0105240_10208280
362 Ga0105247_10047757
363 Ga0105247_10172832
364 Ga0105243_10151414
365 Ga0105241_10076458
366 Ga0105241_10094529
367 Ga0105242_10014018
368 Ga0105248_10184180
369 Ga0105237_10101990
370 Ga0105237_10904923
371 Ga0105249_10000322
372 Ga0105249_10056508
373 Ga0105249_10849238
374 Ga0105249_12216109
375 Ga0105239_10486835
376 Ga0105239_10599305
377 Ga0105239_10733551
378 Ga0157373_10008394
379 Ga0157373_10138102
380 Ga0157370_10036799
381 Ga0157369_10001493
382 Ga0157369_10122630
383 Ga0157369_11162041
384 Ga0157374_10001670
385 Ga0157374_10011770
386 Ga0157374_10027519
387 Ga0157374_10237776
388 Ga0157374_10273645
389 Ga0157378_10011381
390 Ga0163162_10000019
391 Ga0163162_10012048
392 Ga0163162_10288694
393 Ga0163162_11050966
394 Ga0157372_10068976
395 Ga0157372_10210061
396 Ga0157372_10285485
397 Ga0157372_10433250
398 Ga0157372_10687041
399 Ga0157372_11150144
400 Ga0157375_10030409
401 Ga0163163_10030938
402 Ga0163163_10319709
403 Ga0157380_10071023
404 Ga0157379_10016702
405 Ga0157379_10278403
406 Ga0157376_10025053
407 Ga0157376_10052744
408 Ga0157376_10128938
409 Ga0157376_10506885
410 Ga0163161_10005945
411 Ga0163161_10315570
412 Ga0213874_10055414
413 Ga0207682_10203411
414 Ga0207710_10052985
415 Ga0207680_10028386
416 Ga0207645_10191748
417 Ga0207654_10222818
418 Ga0207707_10000625
419 Ga0207695_10441411
420 Ga0207671_10831297
421 Ga0207660_10172954
422 Ga0207657_10086203
423 Ga0207649_10437591
424 Ga0207649_10554571
425 Ga0207650_10092678
426 Ga0207644_10016218
427 Ga0207644_10526994
428 Ga0207690_10026162
429 Ga0207690_10231081
430 Ga0207706_10034211
431 Ga0207706_10346045
432 Ga0207686_10019439
433 Ga0207670_10485584
434 Ga0207704_10152436
435 Ga0207665_10047850
436 Ga0207691_10457707
437 Ga0207711_10008495
438 Ga0207711_10499614
439 Ga0207661_10273218
440 Ga0207679_10017462
441 Ga0207679_10065165
442 Ga0207679_11181652
443 Ga0207667_10134863
444 Ga0207667_10158519
445 Ga0207667_10200899
446 Ga0207667_11378574
447 Ga0207651_10154870
448 Ga0207712_10001566
449 Ga0207712_10039775
450 Ga0207712_10312429
451 Ga0207668_10000665
452 Ga0207640_10243127
453 Ga0207640_10382595
454 Ga0207703_10269300
455 Ga0207639_10008773
456 Ga0207639_10375179
457 Ga0207639_10456847
458 Ga0207639_10486679
459 Ga0207702_10468537
460 Ga0207641_10016317
461 Ga0207648_10306692
462 Ga0207648_10324527
463 Ga0207648_10620074
464 Ga0207676_10018183
465 Ga0207676_10207741
466 Ga0207674_10242872
467 Ga0207675_100465699
468 Ga0207683_10138577
469 Ga0207683_10882010
470 Ga0207698_10022045
471 Ga0207698_10126770
472 Ga0207698_10128087
473 Ga0268265_10422084
474 Ga0268264_10008678
475 Ga0268264_10010363
476 Ga0307408_100114571
477 Ga0307408_100414643
478 Ga0307408_100714364
479 Ga0307405_10101002
480 Ga0307405_10992026
481 Ga0307410_10020131
482 Ga0307410_10470188
483 Ga0307410_10775846
484 Ga0307406_10021126
485 Ga0307406_10081226
486 Ga0307406_10356483
487 Ga0307407_10009755
488 Ga0307407_10033325
489 Ga0307407_10252428
490 Ga0307412_10055298
491 Ga0307412_10472676
492 Ga0307412_10645631
493 Ga0307409_100006017
494 Ga0307409_100011924
495 Ga0307409_100255029
496 Ga0307409_100467524
497 Ga0307409_100506467
498 Ga0307409_101643791
499 Ga0307416_100010344
500 Ga0307416_100105848
501 Ga0307416_100317760
502 Ga0307416_100340007
503 Ga0307416_101426181
504 Ga0307416_101499873
505 Ga0307414_10016374
506 Ga0307414_10220044
507 Ga0307415_100004129
508 Ga0307415_100018096
509 Ga0307415_100093393
510 Ga0316574_0252897
511 Ga0395905_0013359
512 Ga0436363_1394020
513 Ga0451791_0953191
514 Ga0451797_0730118
515 Ga0450898_085671
516 Ga0450902_049015
517 Ga0495621_0065238
518 Ga0495668_0002181
519 Ga0496104_0687950
520 Ga0496106_0294715
521 Ga0496108_0035111
522 Ga0496114_0014054
523 Ga0501217_023082
524 Ga0501235_011949
525 Ga0501242_000509
526 Ga0501247_000311
527 Ga0501249_001693
528 Ga0501257_003180
529 Ga0501268_000070
530 Ga0501270_001794
531 Ga0495601_0540744
532 Ga0500616_0001365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

77

202

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4paw-assembly1.cif.gz_A structure of hypothetical protein hp1257. 0.9222 6 185
2aee-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.8901 1 162
4paw-assembly1.cif.gz_A structure of hypothetical protein hp1257. 0.8758 6 185
2aee-assembly1.cif.gz_B crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.8702 1 162
4rv4-assembly1.cif.gz_B 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp) 0.8607 3 162
ID Description Score Start End Superfamily
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8856 6 185 3.40.50.2020
af_Q59040_42_210_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8707 40 163 3.40.50.2020
af_O61790_6_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8699 5 162 3.40.50.2020
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8607 3 162 3.40.50.2020
af_Q4DBC5_255_457_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8488 3 163 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A838U9J1-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9841 6 129 GO:0004588
GO:0016020
GO:0019856
GO:0044205
AF-A0A1G1GAB1-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9803 8 132 GO:0004588
GO:0019856
GO:0044205
AF-A0A496UR18-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9777 1 189 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-W1YRY0-F1-model_v4 Orotate phosphoribosyltransferase 0.9771 39 140 GO:0006166
GO:0016757
AF-A0A836SE06-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.976 1 142 GO:0004588
GO:0019856
GO:0044205

Map