F374140

General Info

Members Datasets Scaffolds Average Seq Length
266 173 266 135

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10000907|Ga0207648_100009079
Length 150
Sequence MAPFTSDTGRVRAAMVDDPRGLVSHFDALIGTEWLDDDPEHARVRLPMRDDLRQPVGLLHGGVMSSLVESVCSRATALAVLDDGMMAMGQSIGVSFIRPITEGHAEVTARARHRGRTTWVWEAEVRDADERLCALAQMTIAVRPIPRSDS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.53
Rhizosphere 88.35
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000327 3300001977 Bacteria 6834
2 Ga0070676_10663058 3300005328 Bacteria 758
3 Ga0070683_100011762 3300005329 Bacteria 7578
4 Ga0070683_100030495 3300005329 Bacteria 4897
5 Ga0070683_100432536 3300005329 Bacteria 1256
6 Ga0070689_100245741 3300005340 Bacteria 1475
7 Ga0070689_100459017 3300005340 Bacteria 1085
8 Ga0070692_10609862 3300005345 Bacteria 723
9 Ga0070674_100000005 3300005356 Bacteria 168443
10 Ga0070674_100000023 3300005356 Bacteria 84887
11 Ga0070674_100729147 3300005356 Bacteria 850
12 Ga0070688_100000137 3300005365 Bacteria 39585
13 Ga0070667_100001183 3300005367 Bacteria 23762
14 Ga0070667_100390223 3300005367 Bacteria 1266
15 Ga0070703_10031807 3300005406 Bacteria 1598
16 Ga0070713_100000010 3300005436 Bacteria 151790
17 Ga0070710_10270351 3300005437 Bacteria 1099
18 Ga0070711_100001172 3300005439 Bacteria 14098
19 Ga0070700_101038200 3300005441 Bacteria 676
20 Ga0070681_11561367 3300005458 Bacteria 585
21 Ga0068867_100000226 3300005459 Bacteria 36850
22 Ga0070685_10000118 3300005466 Bacteria 50597
23 Ga0070684_100021679 3300005535 Bacteria 5352
24 Ga0070684_100033094 3300005535 Bacteria 4411
25 Ga0070684_100116113 3300005535 Bacteria 2404
26 Ga0070684_100428648 3300005535 Bacteria 1221
27 Ga0068853_100004255 3300005539 Bacteria 11049
28 Ga0070695_101611664 3300005545 Bacteria 542
29 Ga0070665_100179800 3300005548 Bacteria 2116
30 Ga0070664_100085911 3300005564 Bacteria 2718
31 Ga0068854_100000116 3300005578 Bacteria 54986
32 Ga0068854_100010283 3300005578 Bacteria 6065
33 Ga0068856_100010293 3300005614 Bacteria 9090
34 Ga0068864_100000031 3300005618 Bacteria 215331
35 Ga0068866_10000008 3300005718 Bacteria 117658
36 Ga0068866_10000195 3300005718 Bacteria 28485
37 Ga0068863_100241618 3300005841 Bacteria 1743
38 Ga0068858_100000097 3300005842 Bacteria 91503
39 Ga0068858_100523762 3300005842 Bacteria 1146
40 Ga0068862_100004534 3300005844 Bacteria 11709
41 Ga0081455_10007565 3300005937 Bacteria 11420
42 Ga0081455_10422882 3300005937 Bacteria 918
43 Ga0081455_11055764 3300005937 Bacteria 502
44 Ga0070715_10050425 3300006163 Bacteria 1787
45 Ga0070716_100142664 3300006173 Bacteria 1530
46 Ga0070716_101056252 3300006173 Unclassified 645
47 Ga0070712_101225579 3300006175 Bacteria 653
48 Ga0068871_100304468 3300006358 Bacteria 1400
49 Ga0075434_101320555 3300006871 Bacteria 732
50 Ga0105245_10000130 3300009098 Bacteria 72166
51 Ga0105245_10001228 3300009098 Bacteria 23130
52 Ga0105242_10174590 3300009176 Bacteria 1891
53 Ga0105249_10000332 3300009553 Bacteria 47770
54 Ga0105249_10010112 3300009553 Bacteria 8284
55 Ga0105239_11481911 3300010375 Unclassified 784
56 Ga0157370_10006631 3300013104 Bacteria 12720
57 Ga0163162_10230482 3300013306 Bacteria 1982
58 Ga0157375_10000349 3300013308 Bacteria 41764
59 Ga0157375_10050376 3300013308 Bacteria 4085
60 Ga0163163_10056654 3300014325 Bacteria 3873
61 Ga0163163_10295478 3300014325 Bacteria 1672
62 Ga0163163_10887082 3300014325 Bacteria 955
63 Ga0157380_10000391 3300014326 Bacteria 26465
64 Ga0157379_10034870 3300014968 Bacteria 4487
65 Ga0157379_10129503 3300014968 Bacteria 2271
66 Ga0163161_10000053 3300017792 Bacteria 117408
67 Ga0207642_10000002 3300025899 Bacteria 658166
68 Ga0207642_10001565 3300025899 Bacteria 7040
69 Ga0207685_10043458 3300025905 Bacteria 1693
70 Ga0207707_11149562 3300025912 Bacteria 630
71 Ga0207663_10001408 3300025916 Bacteria 11150
72 Ga0207681_10056015 3300025923 Bacteria 2688
73 Ga0207687_10000032 3300025927 Bacteria 143196
74 Ga0207687_10000073 3300025927 Bacteria 73917
75 Ga0207687_10017110 3300025927 Bacteria 4767
76 Ga0207700_10000007 3300025928 Bacteria 345720
77 Ga0207664_10120265 3300025929 Bacteria 2197
78 Ga0207706_10000250 3300025933 Bacteria 58868
79 Ga0207686_10124980 3300025934 Bacteria 1757
80 Ga0207670_10068968 3300025936 Bacteria 2438
81 Ga0207670_10206279 3300025936 Bacteria 1496
82 Ga0207669_10000006 3300025937 Bacteria 176348
83 Ga0207669_10000026 3300025937 Bacteria 92199
84 Ga0207669_10081998 3300025937 Bacteria 2069
85 Ga0207665_10184379 3300025939 Bacteria 1513
86 Ga0207689_10526583 3300025942 Bacteria 992
87 Ga0207661_10029658 3300025944 Bacteria 4205
88 Ga0207661_10035357 3300025944 Bacteria 3892
89 Ga0207651_10011330 3300025960 Bacteria 4988
90 Ga0207712_10000058 3300025961 Bacteria 140948
91 Ga0207712_10001072 3300025961 Bacteria 19132
92 Ga0207668_10011823 3300025972 Bacteria 5320
93 Ga0207640_10000134 3300025981 Bacteria 54961
94 Ga0207640_10008876 3300025981 Bacteria 5600
95 Ga0207658_10014987 3300025986 Bacteria 5315
96 Ga0207658_10537081 3300025986 Bacteria 1045
97 Ga0207703_10000103 3300026035 Bacteria 99918
98 Ga0207703_10553455 3300026035 Bacteria 1085
99 Ga0207639_10008849 3300026041 Bacteria 6923
100 Ga0207708_10052686 3300026075 Bacteria 3100
101 Ga0207702_10003521 3300026078 Bacteria 14268
102 Ga0207702_10594049 3300026078 Bacteria 1086
103 Ga0207641_10620339 3300026088 Bacteria 1060
104 Ga0207641_10697078 3300026088 Bacteria 1000
105 Ga0207648_10000907 3300026089 Bacteria 33370
106 Ga0207676_10000031 3300026095 Bacteria 215877
107 Ga0268266_10201809 3300028379 Bacteria 1820
108 Ga0268265_10004438 3300028380 Bacteria 9741
109 Ga0268264_10027583 3300028381 Bacteria 4642
110 Ga0373953_0061937 3300035117 Bacteria 1531
111 Ga0373933_0396319 3300035724 Bacteria 900
112 Ga0373937_0009637 3300036401 Bacteria 8411
113 Ga0395898_0814673 3300037466 Bacteria 874
114 Ga0451807_1289616 3300041486 Unclassified 502
115 Ga0451853_1718878 3300041512 Bacteria 642
116 Ga0451853_2576161 3300041512 Bacteria 2517
117 Ga0466963_0000008 3300044694 Bacteria 74916
118 Ga0495592_0000267 3300046454 Bacteria 44729
119 Ga0495629_0023097 3300046459 Bacteria 4432
120 Ga0495641_0212190 3300046461 Bacteria 868
121 Ga0495651_0106832 3300046462 Bacteria 2074
122 Ga0495651_0339537 3300046462 Bacteria 996
123 Ga0495651_0629290 3300046462 Unclassified 674
124 Ga0495653_0049692 3300046463 Bacteria 3229
125 Ga0495662_0000079 3300046476 Bacteria 34644
126 Ga0495662_0229409 3300046476 Bacteria 915
127 Ga0495664_0278322 3300046477 Bacteria 1011
128 Ga0495608_0000007 3300046511 Bacteria 313495
129 Ga0495608_0000641 3300046511 Bacteria 24067
130 Ga0495608_0056409 3300046511 Bacteria 2594
131 Ga0495608_0369664 3300046511 Bacteria 880
132 Ga0495608_0418155 3300046511 Bacteria 818
133 Ga0495620_0000211 3300046515 Bacteria 43874
134 Ga0495628_0001264 3300046516 Bacteria 23154
135 Ga0495628_0001838 3300046516 Bacteria 19271
136 Ga0495628_0260392 3300046516 Bacteria 1293
137 Ga0495628_0444582 3300046516 Bacteria 942
138 Ga0495628_0467406 3300046516 Bacteria 914
139 Ga0495628_0470081 3300046516 Bacteria 911
140 Ga0495630_0007122 3300046517 Bacteria 7970
141 Ga0495644_0048948 3300046523 Bacteria 1587
142 Ga0495652_0210631 3300046529 Unclassified 1468
143 Ga0495665_0630072 3300046531 Bacteria 535
144 Ga0495640_0014515 3300046533 Bacteria 5955
145 Ga0495640_0524944 3300046533 Bacteria 719
146 Ga0495640_0531520 3300046533 Bacteria 714
147 Ga0495586_0032328 3300046535 Bacteria 2805
148 Ga0495586_0197810 3300046535 Bacteria 1139
149 Ga0495586_0319384 3300046535 Bacteria 891
150 Ga0495587_0292732 3300046536 Unclassified 911
151 Ga0495598_0006576 3300046537 Bacteria 2631
152 Ga0495621_0002889 3300046539 Bacteria 4682
153 Ga0495667_0000020 3300046559 Bacteria 180876
154 Ga0495656_0000497 3300046615 Bacteria 12860
155 Ga0495668_0092138 3300046616 Bacteria 1660
156 Ga0495634_0000381 3300046642 Bacteria 43342
157 Ga0495634_0560846 3300046642 Bacteria 665
158 Ga0495635_0000086 3300046663 Bacteria 55020
159 Ga0495657_0000001 3300046675 Bacteria 445641
160 Ga0495657_0173100 3300046675 Bacteria 1328
161 Ga0495599_0047984 3300046678 Bacteria 2677
162 Ga0495646_0355347 3300046680 Unclassified 767
163 Ga0495647_0000330 3300046681 Bacteria 13357
164 Ga0495658_0000002 3300046683 Bacteria 309651
165 Ga0495658_0688197 3300046683 Bacteria 655
166 Ga0495669_0005005 3300046684 Bacteria 5510
167 Ga0495613_0000005 3300046689 Bacteria 222558
168 Ga0495613_1089454 3300046689 Unclassified 510
169 Ga0495624_0009103 3300046690 Bacteria 6887
170 Ga0495649_0002704 3300046694 Bacteria 12351
171 Ga0495600_0182393 3300046809 Bacteria 1352
172 Ga0495672_0037887 3300047320 Bacteria 2947
173 Ga0495676_0000131 3300047321 Bacteria 56689
174 Ga0495676_0793260 3300047321 Bacteria 610
175 Ga0495676_0912540 3300047321 Unclassified 562
176 Ga0495680_0000212 3300047322 Bacteria 63418
177 Ga0495680_0000241 3300047322 Bacteria 60168
178 Ga0495680_0002123 3300047322 Bacteria 20590
179 Ga0495680_0236737 3300047322 Bacteria 1298
180 Ga0495675_0000055 3300047444 Bacteria 77878
181 Ga0495679_013364 3300047446 Bacteria 3087
182 Ga0495685_091043 3300047447 Bacteria 1011
183 Ga0495673_0153678 3300047469 Bacteria 888
184 Ga0495593_0352819 3300047673 Bacteria 735
185 Ga0495602_0000571 3300048088 Bacteria 34252
186 Ga0495614_0015935 3300048089 Bacteria 3274
187 Ga0496100_0000013 3300048903 Bacteria 177476
188 Ga0496101_0000035 3300048904 Bacteria 177237
189 Ga0496104_0272735 3300048907 Bacteria 1604
190 Ga0496106_0000062 3300048909 Bacteria 85769
191 Ga0496106_0000139 3300048909 Bacteria 54238
192 Ga0496107_0000020 3300048910 Bacteria 148990
193 Ga0496107_0234587 3300048910 Bacteria 1365
194 Ga0496107_0593232 3300048910 Bacteria 819
195 Ga0496108_0005051 3300048911 Bacteria 10660
196 Ga0496108_0263568 3300048911 Bacteria 1500
197 Ga0496108_0366627 3300048911 Bacteria 1257
198 Ga0496109_0000218 3300048912 Bacteria 56316
199 Ga0496109_0727294 3300048912 Bacteria 930
200 Ga0496110_0000038 3300048913 Bacteria 64272
201 Ga0496110_0052184 3300048913 Bacteria 3594
202 Ga0496110_0344162 3300048913 Bacteria 1358
203 Ga0496111_0000939 3300048914 Bacteria 15955
204 Ga0496112_0000025 3300048915 Bacteria 146197
205 Ga0496112_0029061 3300048915 Bacteria 5344
206 Ga0496112_0136108 3300048915 Bacteria 2427
207 Ga0496112_0876496 3300048915 Bacteria 820
208 Ga0496113_0000027 3300048916 Bacteria 63463
209 Ga0496113_0035721 3300048916 Bacteria 3636
210 Ga0496113_0118649 3300048916 Bacteria 2066
211 Ga0496113_0903122 3300048916 Bacteria 699
212 Ga0496114_0094442 3300048917 Bacteria 2544
213 Ga0496115_0000162 3300048918 Bacteria 62522
214 Ga0496121_0242950 3300048924 Bacteria 1253
215 Ga0501031_0008813 3300049568 Bacteria 6559
216 Ga0501031_0498151 3300049568 Bacteria 786
217 Ga0501032_0011441 3300049569 Bacteria 6374
218 Ga0501033_0001738 3300049570 Bacteria 19042
219 Ga0501034_0016464 3300049571 Bacteria 7587
220 Ga0501036_0001408 3300049572 Bacteria 18483
221 Ga0501036_0132445 3300049572 Bacteria 2104
222 Ga0501037_0000901 3300049573 Bacteria 22167
223 Ga0501038_0002106 3300049574 Bacteria 18452
224 Ga0501039_0013427 3300049575 Bacteria 6264
225 Ga0501039_1016494 3300049575 Bacteria 644
226 Ga0501040_0172035 3300049576 Bacteria 1534
227 Ga0501040_0184801 3300049576 Unclassified 1478
228 Ga0501042_0022064 3300049578 Bacteria 4444
229 Ga0501042_0039308 3300049578 Bacteria 3361
230 Ga0501042_0635725 3300049578 Bacteria 776
231 Ga0501043_0011297 3300049579 Bacteria 6988
232 Ga0501046_0015188 3300049580 Bacteria 6474
233 Ga0501047_0002109 3300049581 Bacteria 19029
234 Ga0501048_0012235 3300049582 Bacteria 6386
235 Ga0501048_0162478 3300049582 Bacteria 1581
236 Ga0501069_0185055 3300049585 Unclassified 1204
237 Ga0501070_0000592 3300049586 Bacteria 33029
238 Ga0501070_0640265 3300049586 Bacteria 845
239 Ga0501072_0612293 3300049588 Unclassified 858
240 Ga0501072_1317190 3300049588 Unclassified 560
241 Ga0501073_0006491 3300049589 Bacteria 8703
242 Ga0501074_0129050 3300049590 Bacteria 1809
243 Ga0501075_0001791 3300049591 Bacteria 14133
244 Ga0501075_0462044 3300049591 Bacteria 968
245 Ga0501075_0643195 3300049591 Bacteria 809
246 Ga0501077_0888204 3300049593 Bacteria 573
247 Ga0501079_0013016 3300049741 Bacteria 6346
248 Ga0501079_0156753 3300049741 Bacteria 1775
249 Ga0501080_0540124 3300049742 Bacteria 1039
250 Ga0501083_0010981 3300049744 Bacteria 6365
251 Ga0501035_0000368 3300049822 Bacteria 51908
252 Ga0501044_0000684 3300049823 Bacteria 40967
253 Ga0501045_0591868 3300049824 Unclassified 822
254 nmdc:mga0rr50_648500_c1 3300050513 Bacteria 901
255 Ga0495601_0946015 3300053077 Unclassified 543
256 Ga0495612_0000230 3300053078 Bacteria 23681
257 Ga0495612_0001360 3300053078 Bacteria 10074
258 Ga0495595_0000002 3300053084 Bacteria 445641
259 Ga0495595_0000150 3300053084 Bacteria 27718
260 Ga0495619_0000010 3300053085 Bacteria 302390
261 Ga0495619_0000084 3300053085 Bacteria 70164
262 Ga0495619_0000494 3300053085 Bacteria 26437
263 Ga0495619_0002422 3300053085 Bacteria 12247
264 Ga0495619_0005688 3300053085 Bacteria 7904
265 Ga0501082_0023889 3300060353 Bacteria 5271
266 Ga0501082_0655712 3300060353 Bacteria 918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100030495 Ga0070683_1000304953 118
2 3300005535 Ga0070684_100033094 Ga0070684_1000330943 118
3 3300025944 Ga0207661_10029658 Ga0207661_100296583 118
4 3300005365 Ga0070688_100000137 Ga0070688_10000013738 120
5 3300005466 Ga0070685_10000118 Ga0070685_1000011838 120
6 3300046462 Ga0495651_0339537 Ga0495651_0339537_540_944 120
7 3300046516 Ga0495628_0260392 Ga0495628_0260392_328_735 120
8 3300046533 Ga0495640_0531520 Ga0495640_0531520_261_665 120
9 3300046539 Ga0495621_0002889 Ga0495621_0002889_3789_4196 120
10 3300046678 Ga0495599_0047984 Ga0495599_0047984_1273_1677 120
11 3300053078 Ga0495612_0001360 Ga0495612_0001360_4065_4469 120
12 3300046535 Ga0495586_0319384 Ga0495586_0319384_342_746 121
13 3300049742 Ga0501080_0540124 Ga0501080_0540124_421_831 121
14 3300005356 Ga0070674_100000005 Ga0070674_10000000543 122
15 3300005718 Ga0068866_10000195 Ga0068866_1000019510 122
16 3300009176 Ga0105242_10174590 Ga0105242_101745902 122
17 3300025899 Ga0207642_10001565 Ga0207642_100015656 122
18 3300025934 Ga0207686_10124980 Ga0207686_101249802 122
19 3300025937 Ga0207669_10000006 Ga0207669_10000006151 122
20 3300035117 Ga0373953_0061937 Ga0373953_0061937_522_929 122
21 3300035724 Ga0373933_0396319 Ga0373933_0396319_208_615 122
22 3300036401 Ga0373937_0009637 Ga0373937_0009637_3325_3732 122
23 3300046511 Ga0495608_0369664 Ga0495608_0369664_134_541 122
24 3300046533 Ga0495640_0524944 Ga0495640_0524944_245_652 122
25 3300046809 Ga0495600_0182393 Ga0495600_0182393_267_674 122
26 3300053085 Ga0495619_0002422 Ga0495619_0002422_8214_8621 122
27 3300046462 Ga0495651_0106832 Ga0495651_0106832_1576_1983 125
28 3300047322 Ga0495680_0000212 Ga0495680_0000212_34651_35058 125
29 3300048911 Ga0496108_0005051 Ga0496108_0005051_974_1381 127
30 3300048912 Ga0496109_0000218 Ga0496109_0000218_23269_23676 127
31 3300005535 Ga0070684_100428648 Ga0070684_1004286482 128
32 3300014968 Ga0157379_10129503 Ga0157379_101295034 128
33 3300049586 Ga0501070_0640265 Ga0501070_0640265_203_610 128
34 3300005937 Ga0081455_10422882 Ga0081455_104228822 131
35 3300014325 Ga0163163_10295478 Ga0163163_102954782 131
36 3300041486 Ga0451807_1289616 Ga0451807_1289616_12_410 131
37 3300005340 Ga0070689_100245741 Ga0070689_1002457412 132
38 3300006173 Ga0070716_100142664 Ga0070716_1001426641 132
39 3300006175 Ga0070712_101225579 Ga0070712_1012255792 132
40 3300014968 Ga0157379_10034870 Ga0157379_100348705 132
41 3300025936 Ga0207670_10068968 Ga0207670_100689683 132
42 3300025939 Ga0207665_10184379 Ga0207665_101843791 132
43 3300046511 Ga0495608_0000007 Ga0495608_0000007_38600_39007 132
44 3300046523 Ga0495644_0048948 Ga0495644_0048948_382_780 132
45 3300046675 Ga0495657_0000001 Ga0495657_0000001_170746_171153 132
46 3300047444 Ga0495675_0000055 Ga0495675_0000055_254_661 132
47 3300053084 Ga0495595_0000002 Ga0495595_0000002_274489_274896 132
48 3300053085 Ga0495619_0000494 Ga0495619_0000494_518_925 132
49 3300005458 Ga0070681_11561367 Ga0070681_115613671 133
50 3300005545 Ga0070695_101611664 Ga0070695_1016116641 133
51 3300005618 Ga0068864_100000031 Ga0068864_10000003113 133
52 3300006163 Ga0070715_10050425 Ga0070715_100504252 133
53 3300006358 Ga0068871_100304468 Ga0068871_1003044682 133
54 3300014325 Ga0163163_10056654 Ga0163163_100566542 133
55 3300025905 Ga0207685_10043458 Ga0207685_100434582 133
56 3300025912 Ga0207707_11149562 Ga0207707_111495622 133
57 3300026095 Ga0207676_10000031 Ga0207676_1000003113 133
58 3300041512 Ga0451853_1718878 Ga0451853_1718878_134_535 133
59 3300047447 Ga0495685_091043 Ga0495685_091043_507_908 133
60 3300048911 Ga0496108_0263568 Ga0496108_0263568_410_820 133
61 3300048915 Ga0496112_0876496 Ga0496112_0876496_42_452 133
62 3300048916 Ga0496113_0035721 Ga0496113_0035721_2873_3283 133
63 3300048916 Ga0496113_0903122 Ga0496113_0903122_61_471 133
64 3300049575 Ga0501039_1016494 Ga0501039_1016494_65_466 133
65 3300049578 Ga0501042_0635725 Ga0501042_0635725_170_571 133
66 3300005329 Ga0070683_100432536 Ga0070683_1004325362 134
67 3300005436 Ga0070713_100000010 Ga0070713_100000010107 134
68 3300005437 Ga0070710_10270351 Ga0070710_102703512 134
69 3300005578 Ga0068854_100000116 Ga0068854_10000011623 134
70 3300025928 Ga0207700_10000007 Ga0207700_10000007308 134
71 3300025981 Ga0207640_10000134 Ga0207640_1000013423 134
72 3300046516 Ga0495628_0001264 Ga0495628_0001264_17121_17525 134
73 3300046683 Ga0495658_0688197 Ga0495658_0688197_127_531 134
74 3300047673 Ga0495593_0352819 Ga0495593_0352819_281_685 134
75 3300048088 Ga0495602_0000571 Ga0495602_0000571_16707_17111 134
76 3300048907 Ga0496104_0272735 Ga0496104_0272735_271_675 134
77 3300048911 Ga0496108_0366627 Ga0496108_0366627_814_1218 134
78 3300048912 Ga0496109_0727294 Ga0496109_0727294_19_423 134
79 3300048916 Ga0496113_0118649 Ga0496113_0118649_56_460 134
80 3300048917 Ga0496114_0094442 Ga0496114_0094442_317_721 134
81 3300048918 Ga0496115_0000162 Ga0496115_0000162_28658_29062 134
82 3300049568 Ga0501031_0498151 Ga0501031_0498151_49_453 134
83 3300049572 Ga0501036_0132445 Ga0501036_0132445_1493_1897 134
84 3300049576 Ga0501040_0172035 Ga0501040_0172035_743_1147 134
85 3300049582 Ga0501048_0162478 Ga0501048_0162478_872_1276 134
86 3300049591 Ga0501075_0462044 Ga0501075_0462044_135_539 134
87 3300049593 Ga0501077_0888204 Ga0501077_0888204_82_486 134
88 3300049741 Ga0501079_0156753 Ga0501079_0156753_903_1307 134
89 3300053085 Ga0495619_0000084 Ga0495619_0000084_42164_42568 134
90 3300060353 Ga0501082_0655712 Ga0501082_0655712_86_490 134
91 3300005328 Ga0070676_10663058 Ga0070676_106630581 135
92 3300005329 Ga0070683_100011762 Ga0070683_1000117622 135
93 3300005340 Ga0070689_100459017 Ga0070689_1004590172 135
94 3300005345 Ga0070692_10609862 Ga0070692_106098622 135
95 3300005356 Ga0070674_100000023 Ga0070674_10000002382 135
96 3300005356 Ga0070674_100729147 Ga0070674_1007291472 135
97 3300005367 Ga0070667_100001183 Ga0070667_1000011839 135
98 3300005367 Ga0070667_100390223 Ga0070667_1003902232 135
99 3300005406 Ga0070703_10031807 Ga0070703_100318072 135
100 3300005439 Ga0070711_100001172 Ga0070711_1000011723 135
101 3300005441 Ga0070700_101038200 Ga0070700_1010382001 135
102 3300005459 Ga0068867_100000226 Ga0068867_10000022611 135
103 3300005535 Ga0070684_100021679 Ga0070684_1000216794 135
104 3300005535 Ga0070684_100116113 Ga0070684_1001161133 135
105 3300005539 Ga0068853_100004255 Ga0068853_1000042552 135
106 3300005548 Ga0070665_100179800 Ga0070665_1001798002 135
107 3300005564 Ga0070664_100085911 Ga0070664_1000859112 135
108 3300005578 Ga0068854_100010283 Ga0068854_1000102834 135
109 3300005614 Ga0068856_100010293 Ga0068856_1000102938 135
110 3300005718 Ga0068866_10000008 Ga0068866_1000000841 135
111 3300005841 Ga0068863_100241618 Ga0068863_1002416183 135
112 3300005842 Ga0068858_100000097 Ga0068858_10000009731 135
113 3300005842 Ga0068858_100523762 Ga0068858_1005237622 135
114 3300005844 Ga0068862_100004534 Ga0068862_1000045344 135
115 3300005937 Ga0081455_10007565 Ga0081455_100075653 135
116 3300005937 Ga0081455_11055764 Ga0081455_110557641 135
117 3300006173 Ga0070716_101056252 Ga0070716_1010562521 135
118 3300006871 Ga0075434_101320555 Ga0075434_1013205551 135
119 3300009098 Ga0105245_10000130 Ga0105245_1000013062 135
120 3300009098 Ga0105245_10001228 Ga0105245_1000122822 135
121 3300009553 Ga0105249_10000332 Ga0105249_1000033243 135
122 3300009553 Ga0105249_10010112 Ga0105249_100101127 135
123 3300013104 Ga0157370_10006631 Ga0157370_100066313 135
124 3300013306 Ga0163162_10230482 Ga0163162_102304822 135
125 3300013308 Ga0157375_10000349 Ga0157375_1000034941 135
126 3300013308 Ga0157375_10050376 Ga0157375_100503762 135
127 3300014325 Ga0163163_10887082 Ga0163163_108870822 135
128 3300014326 Ga0157380_10000391 Ga0157380_1000039131 135
129 3300017792 Ga0163161_10000053 Ga0163161_1000005342 135
130 3300025899 Ga0207642_10000002 Ga0207642_10000002628 135
131 3300025916 Ga0207663_10001408 Ga0207663_100014089 135
132 3300025923 Ga0207681_10056015 Ga0207681_100560153 135
133 3300025927 Ga0207687_10000032 Ga0207687_10000032102 135
134 3300025927 Ga0207687_10000073 Ga0207687_1000007344 135
135 3300025927 Ga0207687_10017110 Ga0207687_100171102 135
136 3300025929 Ga0207664_10120265 Ga0207664_101202652 135
137 3300025933 Ga0207706_10000250 Ga0207706_1000025021 135
138 3300025936 Ga0207670_10206279 Ga0207670_102062792 135
139 3300025937 Ga0207669_10000026 Ga0207669_1000002688 135
140 3300025937 Ga0207669_10081998 Ga0207669_100819982 135
141 3300025942 Ga0207689_10526583 Ga0207689_105265832 135
142 3300025944 Ga0207661_10035357 Ga0207661_100353574 135
143 3300025960 Ga0207651_10011330 Ga0207651_100113304 135
144 3300025961 Ga0207712_10000058 Ga0207712_1000005843 135
145 3300025961 Ga0207712_10001072 Ga0207712_100010724 135
146 3300025972 Ga0207668_10011823 Ga0207668_100118235 135
147 3300025981 Ga0207640_10008876 Ga0207640_100088763 135
148 3300025986 Ga0207658_10014987 Ga0207658_100149872 135
149 3300025986 Ga0207658_10537081 Ga0207658_105370812 135
150 3300026035 Ga0207703_10000103 Ga0207703_1000010342 135
151 3300026035 Ga0207703_10553455 Ga0207703_105534552 135
152 3300026041 Ga0207639_10008849 Ga0207639_100088493 135
153 3300026075 Ga0207708_10052686 Ga0207708_100526862 135
154 3300026078 Ga0207702_10003521 Ga0207702_1000352113 135
155 3300026078 Ga0207702_10594049 Ga0207702_105940492 135
156 3300026088 Ga0207641_10620339 Ga0207641_106203392 135
157 3300026088 Ga0207641_10697078 Ga0207641_106970782 135
158 3300026089 Ga0207648_10000907 Ga0207648_100009079 135
159 3300028379 Ga0268266_10201809 Ga0268266_102018092 135
160 3300028380 Ga0268265_10004438 Ga0268265_100044382 135
161 3300028381 Ga0268264_10027583 Ga0268264_100275833 135
162 3300037466 Ga0395898_0814673 Ga0395898_0814673_200_637 135
163 3300041512 Ga0451853_2576161 Ga0451853_2576161_645_1052 135
164 3300044694 Ga0466963_0000008 Ga0466963_0000008_37368_37775 135
165 3300046454 Ga0495592_0000267 Ga0495592_0000267_24864_25271 135
166 3300046459 Ga0495629_0023097 Ga0495629_0023097_451_864 135
167 3300046461 Ga0495641_0212190 Ga0495641_0212190_299_706 135
168 3300046462 Ga0495651_0629290 Ga0495651_0629290_166_573 135
169 3300046463 Ga0495653_0049692 Ga0495653_0049692_506_919 135
170 3300046476 Ga0495662_0000079 Ga0495662_0000079_26003_26410 135
171 3300046476 Ga0495662_0229409 Ga0495662_0229409_238_645 135
172 3300046477 Ga0495664_0278322 Ga0495664_0278322_387_794 135
173 3300046511 Ga0495608_0000641 Ga0495608_0000641_22057_22464 135
174 3300046511 Ga0495608_0056409 Ga0495608_0056409_541_948 135
175 3300046511 Ga0495608_0418155 Ga0495608_0418155_163_573 135
176 3300046515 Ga0495620_0000211 Ga0495620_0000211_33975_34382 135
177 3300046516 Ga0495628_0001838 Ga0495628_0001838_1391_1798 135
178 3300046516 Ga0495628_0444582 Ga0495628_0444582_482_889 135
179 3300046516 Ga0495628_0467406 Ga0495628_0467406_281_691 135
180 3300046516 Ga0495628_0470081 Ga0495628_0470081_139_552 135
181 3300046517 Ga0495630_0007122 Ga0495630_0007122_6961_7368 135
182 3300046529 Ga0495652_0210631 Ga0495652_0210631_983_1390 135
183 3300046531 Ga0495665_0630072 Ga0495665_0630072_21_428 135
184 3300046533 Ga0495640_0014515 Ga0495640_0014515_4230_4637 135
185 3300046535 Ga0495586_0032328 Ga0495586_0032328_2260_2667 135
186 3300046535 Ga0495586_0197810 Ga0495586_0197810_371_778 135
187 3300046536 Ga0495587_0292732 Ga0495587_0292732_17_424 135
188 3300046537 Ga0495598_0006576 Ga0495598_0006576_1511_1918 135
189 3300046559 Ga0495667_0000020 Ga0495667_0000020_145784_146191 135
190 3300046615 Ga0495656_0000497 Ga0495656_0000497_10647_11054 135
191 3300046616 Ga0495668_0092138 Ga0495668_0092138_735_1142 135
192 3300046642 Ga0495634_0000381 Ga0495634_0000381_33215_33628 135
193 3300046642 Ga0495634_0560846 Ga0495634_0560846_11_418 135
194 3300046663 Ga0495635_0000086 Ga0495635_0000086_34925_35332 135
195 3300046675 Ga0495657_0173100 Ga0495657_0173100_360_767 135
196 3300046680 Ga0495646_0355347 Ga0495646_0355347_231_638 135
197 3300046681 Ga0495647_0000330 Ga0495647_0000330_2640_3047 135
198 3300046683 Ga0495658_0000002 Ga0495658_0000002_275545_275952 135
199 3300046684 Ga0495669_0005005 Ga0495669_0005005_2197_2613 135
200 3300046689 Ga0495613_0000005 Ga0495613_0000005_25821_26228 135
201 3300046689 Ga0495613_1089454 Ga0495613_1089454_41_448 135
202 3300046690 Ga0495624_0009103 Ga0495624_0009103_6423_6830 135
203 3300046694 Ga0495649_0002704 Ga0495649_0002704_6835_7242 135
204 3300047320 Ga0495672_0037887 Ga0495672_0037887_1789_2223 135
205 3300047321 Ga0495676_0000131 Ga0495676_0000131_35448_35855 135
206 3300047321 Ga0495676_0793260 Ga0495676_0793260_165_578 135
207 3300047321 Ga0495676_0912540 Ga0495676_0912540_11_418 135
208 3300047322 Ga0495680_0000241 Ga0495680_0000241_14306_14713 135
209 3300047322 Ga0495680_0002123 Ga0495680_0002123_8740_9147 135
210 3300047322 Ga0495680_0236737 Ga0495680_0236737_814_1230 135
211 3300047446 Ga0495679_013364 Ga0495679_013364_1629_2036 135
212 3300047469 Ga0495673_0153678 Ga0495673_0153678_248_661 135
213 3300048089 Ga0495614_0015935 Ga0495614_0015935_677_1084 135
214 3300048903 Ga0496100_0000013 Ga0496100_0000013_138956_139363 135
215 3300048904 Ga0496101_0000035 Ga0496101_0000035_138956_139363 135
216 3300048909 Ga0496106_0000062 Ga0496106_0000062_47488_47895 135
217 3300048909 Ga0496106_0000139 Ga0496106_0000139_16786_17193 135
218 3300048910 Ga0496107_0000020 Ga0496107_0000020_110105_110512 135
219 3300048910 Ga0496107_0234587 Ga0496107_0234587_111_518 135
220 3300048910 Ga0496107_0593232 Ga0496107_0593232_149_583 135
221 3300048913 Ga0496110_0000038 Ga0496110_0000038_1635_2045 135
222 3300048913 Ga0496110_0052184 Ga0496110_0052184_660_1067 135
223 3300048913 Ga0496110_0344162 Ga0496110_0344162_252_659 135
224 3300048914 Ga0496111_0000939 Ga0496111_0000939_4648_5058 135
225 3300048915 Ga0496112_0000025 Ga0496112_0000025_38019_38432 135
226 3300048915 Ga0496112_0029061 Ga0496112_0029061_714_1124 135
227 3300048915 Ga0496112_0136108 Ga0496112_0136108_1238_1645 135
228 3300048916 Ga0496113_0000027 Ga0496113_0000027_26404_26814 135
229 3300048924 Ga0496121_0242950 Ga0496121_0242950_532_966 135
230 3300049568 Ga0501031_0008813 Ga0501031_0008813_212_634 135
231 3300049569 Ga0501032_0011441 Ga0501032_0011441_5740_6162 135
232 3300049570 Ga0501033_0001738 Ga0501033_0001738_17932_18354 135
233 3300049571 Ga0501034_0016464 Ga0501034_0016464_4181_4603 135
234 3300049572 Ga0501036_0001408 Ga0501036_0001408_17864_18286 135
235 3300049573 Ga0501037_0000901 Ga0501037_0000901_4292_4714 135
236 3300049574 Ga0501038_0002106 Ga0501038_0002106_309_731 135
237 3300049575 Ga0501039_0013427 Ga0501039_0013427_249_671 135
238 3300049576 Ga0501040_0184801 Ga0501040_0184801_193_615 135
239 3300049578 Ga0501042_0022064 Ga0501042_0022064_183_605 135
240 3300049578 Ga0501042_0039308 Ga0501042_0039308_729_1136 135
241 3300049579 Ga0501043_0011297 Ga0501043_0011297_665_1087 135
242 3300049580 Ga0501046_0015188 Ga0501046_0015188_5840_6262 135
243 3300049581 Ga0501047_0002109 Ga0501047_0002109_14421_14843 135
244 3300049582 Ga0501048_0012235 Ga0501048_0012235_192_614 135
245 3300049585 Ga0501069_0185055 Ga0501069_0185055_135_557 135
246 3300049586 Ga0501070_0000592 Ga0501070_0000592_5973_6395 135
247 3300049588 Ga0501072_0612293 Ga0501072_0612293_215_637 135
248 3300049588 Ga0501072_1317190 Ga0501072_1317190_52_459 135
249 3300049589 Ga0501073_0006491 Ga0501073_0006491_4032_4454 135
250 3300049590 Ga0501074_0129050 Ga0501074_0129050_74_496 135
251 3300049591 Ga0501075_0001791 Ga0501075_0001791_13155_13562 135
252 3300049591 Ga0501075_0643195 Ga0501075_0643195_118_528 135
253 3300049741 Ga0501079_0013016 Ga0501079_0013016_5735_6157 135
254 3300049744 Ga0501083_0010981 Ga0501083_0010981_184_606 135
255 3300049822 Ga0501035_0000368 Ga0501035_0000368_33581_34003 135
256 3300049823 Ga0501044_0000684 Ga0501044_0000684_7814_8236 135
257 3300049824 Ga0501045_0591868 Ga0501045_0591868_219_641 135
258 3300053077 Ga0495601_0946015 Ga0495601_0946015_52_459 135
259 3300053078 Ga0495612_0000230 Ga0495612_0000230_13281_13694 135
260 3300053084 Ga0495595_0000150 Ga0495595_0000150_4211_4618 135
261 3300053085 Ga0495619_0000010 Ga0495619_0000010_37434_37841 135
262 3300053085 Ga0495619_0005688 Ga0495619_0005688_303_710 135
263 3300060353 Ga0501082_0023889 Ga0501082_0023889_4641_5063 135
264 3300010375 Ga0105239_11481911 Ga0105239_114819112 136
265 3300001977 JGI24746J21847_1000327 JGI24746J21847_10003278 137
266 3300050513 nmdc:mga0rr50_648500_c1 nmdc:mga0rr50_648500_c1_250_675 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

56

134

0.98

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

50

141

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9372 11 131
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9361 10 130
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9299 11 131
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.9293 27 130
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9287 10 130
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9457 10 130 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9382 10 130 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.927 12 133 3.10.129.10
3r32A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9096 1 133 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9059 12 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6J4TQ88-F1-model_v4 Thioesterase domain-containing protein 0.9672 12 129 GO:0005829
GO:0061522
AF-A0A7K0S2A5-F1-model_v4 Hotdog fold thioesterase 0.963 12 133 GO:0005829
GO:0061522
AF-A0A538KF51-F1-model_v4 PaaI family thioesterase 0.9615 10 133 GO:0005829
GO:0061522
AF-A0A538F6D6-F1-model_v4 PaaI family thioesterase 0.9604 13 133 GO:0005829
GO:0061522
AF-A0A660L5K7-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA hydrolase 0.9603 13 130 GO:0005829
GO:0061522

Feature Viewer

pLDDT pTM Quality
90.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map