F374122

General Info

Members Datasets Scaffolds Average Seq Length
266 154 532 284

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10131899|Ga0207652_101318992
Length 318
Sequence MTSATVLQTTVAALEFQNPIVLAAGTAGYGRELAGVVPLEQLGGLVTKAVSREPRHGAPAPRVAEFRGGMLNAVGLANPGLDAVCREHLPWLATHLPRTRKLMNVVGFSTTEFADVVRGVEQAMAPAANAAAVDAFELNVSCPNVKAGGLEFGADPQALAAVIRGARAETRRPVFVKLSPTLPAIADAARVAADAGADGITVVNTMPGLLIDVERRAPAVGFGTGGMSGPALLPIGVLATWRVSRAVSLPVMGVGGVGSGEDALQYILAGASLVGMGTAALRDPASPSRVVRELVRWCERHGVRAIDELRGTLAWPSA

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
136 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
137 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
143 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.38
Rhizosphere 99.62
Stem 0
Stem Tuber 0
Unclassified 21.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10131899 3300025921 Bacteria 2229
2 Ga0070676_10001462 3300005328 Bacteria 11948
3 Ga0070683_100022908 3300005329 Bacteria 5584
4 Ga0068869_100081460 3300005334 Bacteria 2417
5 Ga0070680_100002283 3300005336 Bacteria 14179
6 Ga0070680_100010473 3300005336 Bacteria 7150
7 Ga0070680_100125727 3300005336 Bacteria 2142
8 Ga0070680_100178948 3300005336 Bacteria 1786
9 Ga0068868_100217798 3300005338 Bacteria 1597
10 Ga0070691_10014539 3300005341 Bacteria 3612
11 Ga0070691_10024733 3300005341 Bacteria 2793
12 Ga0070661_100011578 3300005344 Bacteria 6148
13 Ga0070692_10001991 3300005345 Bacteria 7740
14 Ga0070668_100019931 3300005347 Bacteria 5054
15 Ga0070671_100007369 3300005355 Bacteria 8788
16 Ga0070673_100161086 3300005364 Unclassified 1908
17 Ga0070703_10000856 3300005406 Bacteria 9819
18 Ga0070703_10051650 3300005406 Bacteria 1316
19 Ga0070709_10001790 3300005434 Bacteria 11674
20 Ga0070713_100199316 3300005436 Bacteria 1807
21 Ga0070710_10184218 3300005437 Bacteria 1309
22 Ga0070701_10003848 3300005438 Bacteria 5997
23 Ga0070711_100000011 3300005439 Bacteria 163666
24 Ga0070705_100001161 3300005440 Bacteria 14451
25 Ga0070705_100150804 3300005440 Unclassified 1542
26 Ga0070705_100206976 3300005440 Bacteria 1349
27 Ga0070700_100005442 3300005441 Bacteria 6749
28 Ga0070694_100019212 3300005444 Bacteria 4344
29 Ga0070694_100025530 3300005444 Unclassified 3823
30 Ga0070694_100049115 3300005444 Bacteria 2840
31 Ga0070708_100003483 3300005445 Bacteria 12318
32 Ga0070708_100007315 3300005445 Bacteria 8836
33 Ga0070708_100106993 3300005445 Bacteria 2567
34 Ga0070708_100219216 3300005445 Unclassified 1784
35 Ga0070708_100388437 3300005445 Bacteria 1316
36 Ga0070662_100333082 3300005457 Bacteria 1240
37 Ga0070681_10157228 3300005458 Bacteria 2197
38 Ga0068867_100175671 3300005459 Bacteria 1699
39 Ga0070706_100013962 3300005467 Bacteria 7420
40 Ga0070706_100018294 3300005467 Bacteria 6466
41 Ga0070706_100058306 3300005467 Bacteria 3564
42 Ga0070707_100007932 3300005468 Bacteria 9858
43 Ga0070707_100025856 3300005468 Bacteria 5573
44 Ga0070707_100038131 3300005468 Bacteria 4589
45 Ga0070707_100213011 3300005468 Unclassified 1883
46 Ga0070698_100006071 3300005471 Bacteria 13158
47 Ga0070698_100034549 3300005471 Bacteria 5233
48 Ga0070698_100072538 3300005471 Bacteria 3451
49 Ga0070699_100007099 3300005518 Bacteria 9729
50 Ga0070699_100008665 3300005518 Bacteria 8816
51 Ga0070699_100009357 3300005518 Bacteria 8486
52 Ga0070699_100016874 3300005518 Bacteria 6268
53 Ga0070699_100025534 3300005518 Bacteria 5092
54 Ga0070699_100063114 3300005518 Bacteria 3212
55 Ga0070684_100029660 3300005535 Bacteria 4639
56 Ga0070697_100011486 3300005536 Bacteria 6923
57 Ga0070697_100116472 3300005536 Bacteria 2232
58 Ga0070695_100007123 3300005545 Bacteria 6628
59 Ga0070695_100007241 3300005545 Bacteria 6576
60 Ga0070695_100024420 3300005545 Bacteria 3723
61 Ga0070695_100057999 3300005545 Unclassified 2503
62 Ga0070696_100000378 3300005546 Bacteria 27211
63 Ga0070696_100004658 3300005546 Bacteria 9161
64 Ga0070696_100006037 3300005546 Bacteria 8083
65 Ga0070696_100027334 3300005546 Unclassified 3886
66 Ga0070704_100016291 3300005549 Bacteria 4694
67 Ga0070704_100024409 3300005549 Unclassified 3967
68 Ga0070704_100031646 3300005549 Bacteria 3561
69 Ga0070704_100042821 3300005549 Bacteria 3134
70 Ga0068855_100028536 3300005563 Bacteria 6675
71 Ga0070664_100037493 3300005564 Bacteria 4077
72 Ga0070664_100066527 3300005564 Bacteria 3078
73 Ga0068857_100032221 3300005577 Bacteria 4634
74 Ga0068862_100091003 3300005844 Bacteria 2656
75 Ga0070716_100042459 3300006173 Bacteria 2539
76 Ga0075428_100019145 3300006844 Bacteria 7572
77 Ga0075428_100110589 3300006844 Bacteria 2993
78 Ga0075430_100123300 3300006846 Bacteria 2160
79 Ga0075430_100372937 3300006846 Bacteria 1178
80 Ga0075431_100038137 3300006847 Bacteria 4948
81 Ga0075431_100146019 3300006847 Bacteria 2438
82 Ga0075433_10003251 3300006852 Bacteria 12545
83 Ga0075433_10011638 3300006852 Bacteria 7086
84 Ga0075433_10047833 3300006852 Bacteria 3720
85 Ga0075434_100027672 3300006871 Bacteria 5566
86 Ga0075434_100042202 3300006871 Bacteria 4521
87 Ga0075434_100051591 3300006871 Bacteria 4088
88 Ga0075434_100076165 3300006871 Bacteria 3349
89 Ga0075434_100182863 3300006871 Bacteria 2117
90 Ga0075434_100186223 3300006871 Bacteria 2096
91 Ga0075434_100279383 3300006871 Bacteria 1689
92 Ga0075429_100004343 3300006880 Bacteria 12179
93 Ga0075429_100390056 3300006880 Bacteria 1219
94 Ga0075436_100000532 3300006914 Bacteria 24785
95 Ga0075436_100022868 3300006914 Bacteria 4294
96 Ga0075436_100032800 3300006914 Bacteria 3580
97 Ga0075436_100061641 3300006914 Unclassified 2591
98 Ga0075436_100174918 3300006914 Bacteria 1516
99 Ga0075435_100015175 3300007076 Bacteria 5785
100 Ga0075435_100036239 3300007076 Bacteria 3919
101 Ga0075435_100075107 3300007076 Bacteria 2766
102 Ga0075435_100277226 3300007076 Bacteria 1431
103 Ga0099794_10001046 3300007265 Bacteria 9431
104 Ga0099794_10021168 3300007265 Unclassified 2952
105 Ga0099794_10115165 3300007265 Bacteria 1349
106 Ga0105240_10017622 3300009093 Bacteria 9620
107 Ga0105240_10057408 3300009093 Bacteria 4864
108 Ga0105240_10483511 3300009093 Bacteria 1380
109 Ga0111539_10150633 3300009094 Unclassified 2723
110 Ga0111539_10546173 3300009094 Bacteria 1350
111 Ga0105245_10023926 3300009098 Bacteria 5361
112 Ga0114129_10864406 3300009147 Bacteria 1149
113 Ga0105243_10002469 3300009148 Bacteria 15442
114 Ga0105241_10022446 3300009174 Bacteria 4675
115 Ga0105242_10001152 3300009176 Bacteria 20825
116 Ga0105242_10293323 3300009176 Unclassified 1482
117 Ga0105248_10005457 3300009177 Bacteria 13976
118 Ga0105249_10044056 3300009553 Unclassified 4059
119 Ga0105239_10119764 3300010375 Unclassified 2922
120 Ga0157373_10001762 3300013100 Bacteria 16473
121 Ga0157371_10048783 3300013102 Bacteria 3010
122 Ga0157378_10024218 3300013297 Bacteria 5338
123 Ga0157378_10132511 3300013297 Bacteria 2308
124 Ga0163162_10054348 3300013306 Unclassified 4028
125 Ga0157372_10006609 3300013307 Bacteria 12340
126 Ga0157372_10118088 3300013307 Bacteria 3043
127 Ga0157375_10067629 3300013308 Bacteria 3571
128 Ga0157379_10043178 3300014968 Bacteria 4025
129 Ga0207653_10000042 3300025885 Bacteria 96617
130 Ga0207653_10015416 3300025885 Unclassified 2398
131 Ga0207684_10077789 3300025910 Unclassified 2821
132 Ga0207684_10115820 3300025910 Bacteria 2296
133 Ga0207684_10177969 3300025910 Unclassified 1834
134 Ga0207707_10000519 3300025912 Bacteria 39417
135 Ga0207695_10001473 3300025913 Bacteria 39382
136 Ga0207663_10000150 3300025916 Bacteria 32307
137 Ga0207660_10000107 3300025917 Bacteria 46998
138 Ga0207660_10001240 3300025917 Bacteria 17083
139 Ga0207657_10241153 3300025919 Bacteria 1443
140 Ga0207649_10021722 3300025920 Bacteria 3699
141 Ga0207652_10000580 3300025921 Bacteria 36803
142 Ga0207646_10009011 3300025922 Bacteria 9919
143 Ga0207646_10136762 3300025922 Bacteria 2206
144 Ga0207646_10372487 3300025922 Bacteria 1290
145 Ga0207700_10191711 3300025928 Unclassified 1718
146 Ga0207644_10133861 3300025931 Bacteria 1901
147 Ga0207706_10309593 3300025933 Bacteria 1375
148 Ga0207686_10269937 3300025934 Unclassified 1251
149 Ga0207665_10005761 3300025939 Bacteria 8245
150 Ga0207689_10127740 3300025942 Bacteria 2091
151 Ga0207661_10126827 3300025944 Bacteria 2180
152 Ga0207679_10050583 3300025945 Bacteria 3038
153 Ga0207679_10068837 3300025945 Bacteria 2661
154 Ga0207667_10048259 3300025949 Bacteria 4503
155 Ga0207651_10318292 3300025960 Unclassified 1300
156 Ga0207640_10000481 3300025981 Bacteria 24335
157 Ga0207708_10008093 3300026075 Bacteria 7790
158 Ga0207698_10017783 3300026142 Bacteria 4832
159 Ga0209588_1000577 3300027671 Bacteria 9368
160 Ga0209588_1013305 3300027671 Unclassified 2509
161 Ga0209588_1063936 3300027671 Bacteria 1189
162 Ga0307413_10019491 3300031824 Bacteria 3586
163 Ga0307410_10095439 3300031852 Bacteria 2120
164 Ga0307410_10172527 3300031852 Unclassified 1631
165 Ga0307406_10068591 3300031901 Bacteria 2316
166 Ga0307406_10122703 3300031901 Bacteria 1809
167 Ga0307407_10046085 3300031903 Bacteria 2467
168 Ga0307409_100363919 3300031995 Bacteria 1369
169 Ga0307416_100098425 3300032002 Bacteria 2537
170 Ga0307415_100062400 3300032126 Bacteria 2585
171 Ga0307415_100299915 3300032126 Unclassified 1331
172 Ga0316582_0150148 3300036647 Unclassified 1575
173 Ga0451577_0029021 3300042876 Bacteria 5002
174 Ga0451577_0189526 3300042876 Bacteria 1855
175 Ga0451577_0310849 3300042876 Unclassified 1428
176 Ga0453683_0016290 3300044673 Bacteria 4799
177 Ga0453683_0177360 3300044673 Unclassified 1351
178 Ga0451576_0003242 3300045051 Bacteria 22618
179 Ga0451576_0004830 3300045051 Bacteria 17255
180 Ga0451576_0015131 3300045051 Bacteria 8564
181 Ga0451576_0137423 3300045051 Bacteria 2549
182 Ga0451576_0238477 3300045051 Bacteria 1899
183 Ga0451576_0281591 3300045051 Unclassified 1738
184 Ga0495603_0125894 3300046455 Unclassified 1493
185 Ga0495582_0102339 3300046473 Unclassified 1604
186 Ga0495639_0020658 3300046475 Bacteria 2877
187 Ga0495664_0032565 3300046477 Unclassified 3060
188 Ga0495618_0132240 3300046514 Unclassified 1596
189 Ga0495628_0338069 3300046516 Unclassified 1109
190 Ga0495630_0000529 3300046517 Bacteria 28133
191 Ga0495666_0005108 3300046526 Bacteria 6633
192 Ga0495640_0018385 3300046533 Bacteria 5187
193 Ga0495621_0039905 3300046539 Bacteria 1643
194 Ga0495667_0093483 3300046559 Unclassified 1947
195 Ga0495634_0003567 3300046642 Bacteria 12447
196 Ga0495658_0139121 3300046683 Unclassified 1483
197 Ga0495600_0162561 3300046809 Unclassified 1443
198 Ga0495674_0025271 3300047319 Bacteria 5448
199 Ga0495676_0059924 3300047321 Unclassified 2986
200 Ga0495680_0013561 3300047322 Bacteria 7105
201 Ga0495614_0049646 3300048089 Unclassified 1799
202 Ga0496101_0131981 3300048904 Unclassified 1897
203 Ga0501292_009545 3300049515 Unclassified 1442
204 Ga0501031_0161908 3300049568 Bacteria 1462
205 Ga0501036_0124713 3300049572 Bacteria 2175
206 Ga0501036_0191595 3300049572 Bacteria 1720
207 Ga0501039_0023315 3300049575 Bacteria 4752
208 Ga0501040_0050389 3300049576 Unclassified 2848
209 Ga0501040_0143313 3300049576 Bacteria 1684
210 Ga0501040_0143990 3300049576 Unclassified 1679
211 Ga0501041_0023167 3300049577 Bacteria 3723
212 Ga0501042_0046949 3300049578 Bacteria 3079
213 Ga0501042_0305764 3300049578 Bacteria 1149
214 Ga0501043_0337713 3300049579 Unclassified 1146
215 Ga0501046_0049465 3300049580 Unclassified 3325
216 Ga0501046_0257458 3300049580 Bacteria 1283
217 Ga0501048_0033738 3300049582 Bacteria 3696
218 Ga0501048_0068183 3300049582 Unclassified 2514
219 Ga0501071_0096560 3300049587 Bacteria 2175
220 Ga0501072_0115150 3300049588 Unclassified 2140
221 Ga0501074_0144197 3300049590 Unclassified 1703
222 Ga0501075_0051603 3300049591 Bacteria 3093
223 Ga0501075_0099751 3300049591 Unclassified 2205
224 Ga0501075_0367117 3300049591 Bacteria 1097
225 Ga0501076_0019169 3300049592 Bacteria 5224
226 Ga0501076_0024872 3300049592 Bacteria 4632
227 Ga0501077_0000630 3300049593 Bacteria 21371
228 Ga0501077_0024388 3300049593 Bacteria 3841
229 Ga0501199_006826 3300049650 Unclassified 1169
230 Ga0501202_008785 3300049652 Bacteria 1847
231 Ga0501217_014445 3300049661 Unclassified 1784
232 Ga0501079_0039584 3300049741 Bacteria 3636
233 Ga0501079_0047340 3300049741 Bacteria 3317
234 Ga0501080_0147794 3300049742 Bacteria 2173
235 Ga0501081_0019611 3300049743 Bacteria 4504
236 Ga0501081_0088112 3300049743 Bacteria 2180
237 Ga0501081_0263391 3300049743 Bacteria 1260
238 Ga0501081_0263703 3300049743 Bacteria 1259
239 Ga0501083_0134562 3300049744 Bacteria 1620
240 Ga0501268_012992 3300049765 Unclassified 1339
241 Ga0501273_006782 3300049770 Unclassified 1334
242 Ga0501044_0368815 3300049823 Bacteria 1353
243 Ga0501045_0014299 3300049824 Bacteria 5625
244 nmdc:mga05p37_330185_c1 3300050507 Unclassified 1802
245 nmdc:mga09592_219999_c1 3300050508 Bacteria 1645
246 nmdc:mga0n895_107776_c1 3300050512 Unclassified 2800
247 nmdc:mga0n895_140694_c1 3300050512 Unclassified 2442
248 nmdc:mga0n895_184092_c1 3300050512 Bacteria 2120
249 nmdc:mga0n895_37571_c1 3300050512 Bacteria 4686
250 nmdc:mga0rr50_25521_c1 3300050513 Unclassified 4110
251 nmdc:mga0rr50_311643_c1 3300050513 Bacteria 1318
252 nmdc:mga0rr50_39258_c1 3300050513 Bacteria 3433
253 nmdc:mga08x19_17265_c1 3300050514 Bacteria 4414
254 nmdc:mga08x19_32323_c1 3300050514 Bacteria 3296
255 nmdc:mga08x19_46302_c1 3300050514 Unclassified 2781
256 nmdc:mga08x19_8076_c1 3300050514 Bacteria 2422
257 nmdc:mga0a205_38396_c1 3300050515 Bacteria 4607
258 nmdc:mga0a205_62325_c1 3300050515 Bacteria 3603
259 Ga0501084_0007466 3300054114 Bacteria 9013
260 Ga0501084_0031194 3300054114 Bacteria 4457
261 Ga0590071_003306 3300059421 Bacteria 3971
262 Ga0590071_003504 3300059421 Bacteria 3851
263 Ga0590071_017227 3300059421 Bacteria 1696
264 Ga0501082_0008687 3300060353 Bacteria 8760
265 Ga0501082_0023676 3300060353 Bacteria 5295
266 Ga0501082_0227368 3300060353 Bacteria 1624
267 Ga0207652_10131899
268 Ga0070676_10001462
269 Ga0070683_100022908
270 Ga0068869_100081460
271 Ga0070680_100002283
272 Ga0070680_100010473
273 Ga0070680_100125727
274 Ga0070680_100178948
275 Ga0068868_100217798
276 Ga0070691_10014539
277 Ga0070691_10024733
278 Ga0070661_100011578
279 Ga0070692_10001991
280 Ga0070668_100019931
281 Ga0070671_100007369
282 Ga0070673_100161086
283 Ga0070703_10000856
284 Ga0070703_10051650
285 Ga0070709_10001790
286 Ga0070713_100199316
287 Ga0070710_10184218
288 Ga0070701_10003848
289 Ga0070711_100000011
290 Ga0070705_100001161
291 Ga0070705_100150804
292 Ga0070705_100206976
293 Ga0070700_100005442
294 Ga0070694_100019212
295 Ga0070694_100025530
296 Ga0070694_100049115
297 Ga0070708_100003483
298 Ga0070708_100007315
299 Ga0070708_100106993
300 Ga0070708_100219216
301 Ga0070708_100388437
302 Ga0070662_100333082
303 Ga0070681_10157228
304 Ga0068867_100175671
305 Ga0070706_100013962
306 Ga0070706_100018294
307 Ga0070706_100058306
308 Ga0070707_100007932
309 Ga0070707_100025856
310 Ga0070707_100038131
311 Ga0070707_100213011
312 Ga0070698_100006071
313 Ga0070698_100034549
314 Ga0070698_100072538
315 Ga0070699_100007099
316 Ga0070699_100008665
317 Ga0070699_100009357
318 Ga0070699_100016874
319 Ga0070699_100025534
320 Ga0070699_100063114
321 Ga0070684_100029660
322 Ga0070697_100011486
323 Ga0070697_100116472
324 Ga0070695_100007123
325 Ga0070695_100007241
326 Ga0070695_100024420
327 Ga0070695_100057999
328 Ga0070696_100000378
329 Ga0070696_100004658
330 Ga0070696_100006037
331 Ga0070696_100027334
332 Ga0070704_100016291
333 Ga0070704_100024409
334 Ga0070704_100031646
335 Ga0070704_100042821
336 Ga0068855_100028536
337 Ga0070664_100037493
338 Ga0070664_100066527
339 Ga0068857_100032221
340 Ga0068862_100091003
341 Ga0070716_100042459
342 Ga0075428_100019145
343 Ga0075428_100110589
344 Ga0075430_100123300
345 Ga0075430_100372937
346 Ga0075431_100038137
347 Ga0075431_100146019
348 Ga0075433_10003251
349 Ga0075433_10011638
350 Ga0075433_10047833
351 Ga0075434_100027672
352 Ga0075434_100042202
353 Ga0075434_100051591
354 Ga0075434_100076165
355 Ga0075434_100182863
356 Ga0075434_100186223
357 Ga0075434_100279383
358 Ga0075429_100004343
359 Ga0075429_100390056
360 Ga0075436_100000532
361 Ga0075436_100022868
362 Ga0075436_100032800
363 Ga0075436_100061641
364 Ga0075436_100174918
365 Ga0075435_100015175
366 Ga0075435_100036239
367 Ga0075435_100075107
368 Ga0075435_100277226
369 Ga0099794_10001046
370 Ga0099794_10021168
371 Ga0099794_10115165
372 Ga0105240_10017622
373 Ga0105240_10057408
374 Ga0105240_10483511
375 Ga0111539_10150633
376 Ga0111539_10546173
377 Ga0105245_10023926
378 Ga0114129_10864406
379 Ga0105243_10002469
380 Ga0105241_10022446
381 Ga0105242_10001152
382 Ga0105242_10293323
383 Ga0105248_10005457
384 Ga0105249_10044056
385 Ga0105239_10119764
386 Ga0157373_10001762
387 Ga0157371_10048783
388 Ga0157378_10024218
389 Ga0157378_10132511
390 Ga0163162_10054348
391 Ga0157372_10006609
392 Ga0157372_10118088
393 Ga0157375_10067629
394 Ga0157379_10043178
395 Ga0207653_10000042
396 Ga0207653_10015416
397 Ga0207684_10077789
398 Ga0207684_10115820
399 Ga0207684_10177969
400 Ga0207707_10000519
401 Ga0207695_10001473
402 Ga0207663_10000150
403 Ga0207660_10000107
404 Ga0207660_10001240
405 Ga0207657_10241153
406 Ga0207649_10021722
407 Ga0207652_10000580
408 Ga0207646_10009011
409 Ga0207646_10136762
410 Ga0207646_10372487
411 Ga0207700_10191711
412 Ga0207644_10133861
413 Ga0207706_10309593
414 Ga0207686_10269937
415 Ga0207665_10005761
416 Ga0207689_10127740
417 Ga0207661_10126827
418 Ga0207679_10050583
419 Ga0207679_10068837
420 Ga0207667_10048259
421 Ga0207651_10318292
422 Ga0207640_10000481
423 Ga0207708_10008093
424 Ga0207698_10017783
425 Ga0209588_1000577
426 Ga0209588_1013305
427 Ga0209588_1063936
428 Ga0307413_10019491
429 Ga0307410_10095439
430 Ga0307410_10172527
431 Ga0307406_10068591
432 Ga0307406_10122703
433 Ga0307407_10046085
434 Ga0307409_100363919
435 Ga0307416_100098425
436 Ga0307415_100062400
437 Ga0307415_100299915
438 Ga0316582_0150148
439 Ga0451577_0029021
440 Ga0451577_0189526
441 Ga0451577_0310849
442 Ga0453683_0016290
443 Ga0453683_0177360
444 Ga0451576_0003242
445 Ga0451576_0004830
446 Ga0451576_0015131
447 Ga0451576_0137423
448 Ga0451576_0238477
449 Ga0451576_0281591
450 Ga0495603_0125894
451 Ga0495582_0102339
452 Ga0495639_0020658
453 Ga0495664_0032565
454 Ga0495618_0132240
455 Ga0495628_0338069
456 Ga0495630_0000529
457 Ga0495666_0005108
458 Ga0495640_0018385
459 Ga0495621_0039905
460 Ga0495667_0093483
461 Ga0495634_0003567
462 Ga0495658_0139121
463 Ga0495600_0162561
464 Ga0495674_0025271
465 Ga0495676_0059924
466 Ga0495680_0013561
467 Ga0495614_0049646
468 Ga0496101_0131981
469 Ga0501292_009545
470 Ga0501031_0161908
471 Ga0501036_0124713
472 Ga0501036_0191595
473 Ga0501039_0023315
474 Ga0501040_0050389
475 Ga0501040_0143313
476 Ga0501040_0143990
477 Ga0501041_0023167
478 Ga0501042_0046949
479 Ga0501042_0305764
480 Ga0501043_0337713
481 Ga0501046_0049465
482 Ga0501046_0257458
483 Ga0501048_0033738
484 Ga0501048_0068183
485 Ga0501071_0096560
486 Ga0501072_0115150
487 Ga0501074_0144197
488 Ga0501075_0051603
489 Ga0501075_0099751
490 Ga0501075_0367117
491 Ga0501076_0019169
492 Ga0501076_0024872
493 Ga0501077_0000630
494 Ga0501077_0024388
495 Ga0501199_006826
496 Ga0501202_008785
497 Ga0501217_014445
498 Ga0501079_0039584
499 Ga0501079_0047340
500 Ga0501080_0147794
501 Ga0501081_0019611
502 Ga0501081_0088112
503 Ga0501081_0263391
504 Ga0501081_0263703
505 Ga0501083_0134562
506 Ga0501268_012992
507 Ga0501273_006782
508 Ga0501044_0368815
509 Ga0501045_0014299
510 nmdc:mga05p37_330185_c1
511 nmdc:mga09592_219999_c1
512 nmdc:mga0n895_107776_c1
513 nmdc:mga0n895_140694_c1
514 nmdc:mga0n895_184092_c1
515 nmdc:mga0n895_37571_c1
516 nmdc:mga0rr50_25521_c1
517 nmdc:mga0rr50_311643_c1
518 nmdc:mga0rr50_39258_c1
519 nmdc:mga08x19_17265_c1
520 nmdc:mga08x19_32323_c1
521 nmdc:mga08x19_46302_c1
522 nmdc:mga08x19_8076_c1
523 nmdc:mga0a205_38396_c1
524 nmdc:mga0a205_62325_c1
525 Ga0501084_0007466
526 Ga0501084_0031194
527 Ga0590071_003306
528 Ga0590071_003504
529 Ga0590071_017227
530 Ga0501082_0008687
531 Ga0501082_0023676
532 Ga0501082_0227368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

6

297

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.9027 5 288
1ep2-assembly1.cif.gz_A-2 crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate 0.9018 5 288
5ksw-assembly1.cif.gz_A dhodb-i74d mutant 0.9014 5 288
1ep3-assembly1.cif.gz_A crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. 0.901 5 288
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.879 5 288
ID Description Score Start End Superfamily
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9007 5 288 3.20.20.70
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8771 5 288 3.20.20.70
3c61A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8382 6 288 3.20.20.70
af_P25889_6_307_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8265 6 288 3.20.20.70
af_Q12882_533_844_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8181 7 288 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V7K2S5-F1-model_v4 Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) 0.9243 5 289 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A2V7R4S0-F1-model_v4 Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) 0.9225 6 289 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A3N6A829-F1-model_v4 Dihydroorotate dehydrogenase (EC 1.3.1.14) 0.9178 68 288 GO:0004589
GO:0005737
GO:0006207
GO:0006221
AF-A0A2V9LPK5-F1-model_v4 Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) 0.9168 2 288 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A2V7NS70-F1-model_v4 Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) 0.9162 1 286 GO:0004152
GO:0005737
GO:0006207
GO:0044205

Map