F373710

General Info

Members Datasets Scaffolds Average Seq Length
265 212 530 624

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862382967|2862389696
Length 731
Sequence RRLGGRYELGQVLGRGGMAEVYLAMDTRLGRTVAVKTLRADLARDPTFQARFRREAQSAASLNHPAIVAVYDTGEDYIDGVSIPYIVMEYVEGSTLRELLHSGRKLLPERAMEMTIGILQGLEYAHRNQIVHRDIKPANVMLTRNGQVKVMDFGIARAMGDSGMTMTQTSAVIGTAQYLSPEQAKGEQVDARSDLYSTGCLLYELLTVRPPFIGDSPVAVAYQHVREEPQAPSVFDPEITPEMDAIVLRALVKDPDYRYQSADEMRADIEACLDGQPVAATAAMGSVGYGGYPDDQPTTAMRADAGATTMLPPVGPDDGYGGYDDRQGRRRQQKKNNTSTILLVVAGVLVLIGAVLIGQWMFSGNDAGNDTLKAPNFVGQSEADAKQAATNVDLKVQVSQKPCENQKKGNVCEQNPQAGVEVKKGDTIDLVVSTGAPKVAVPSVIGDQIADAKDKLEGKDYEFVVETKTKESPEEAGTVLDQNPTTGKEVEKGSTITLTVAKAEEKATVPTVTGRSCDDAKSQMEANNLVGTCTEVETDDPNLVGKVVATNPEAGSELNKGDTVTIQIGKAAEEEEQEAEVPNVVGRTVGQAKQILQASGFTNIQFAGGSDQSDTALVTDQDPDGGNDADPAQTTITLASVGFGGNNGGNNNGGNNGGGXXXXGSFVIPIAIAMFHVKQGVSRETSPSAETDQAASAAPSAACAPRSPAPRAPARPTRCTGTGRCRRACRW

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
5 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
6 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
7 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
8 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
9 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
10 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
11 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
12 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
13 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
15 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
16 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
17 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
18 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
19 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
20 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
21 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
22 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
23 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
24 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
25 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
26 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
27 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
28 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
29 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
30 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
31 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
32 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
33 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
34 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
35 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
36 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
37 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
38 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
39 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
40 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
41 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
42 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
43 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
44 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
45 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
46 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
47 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
48 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
49 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
50 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
51 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
52 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
53 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
54 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
55 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
56 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
57 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
58 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
59 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
60 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
61 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
62 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
63 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
64 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
65 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
66 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
67 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
68 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
69 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
70 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
76 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
77 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
104 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
105 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
106 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
107 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
108 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
109 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
115 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
116 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
117 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
118 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
119 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
120 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
121 2643221548 Streptomyces sp. Root55 Isolate Unclassified
122 2643221578 Streptomyces sp. Root63 Isolate Unclassified
123 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
124 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
125 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
126 2643221647 Streptomyces sp. Root369 Isolate Unclassified
127 2643221670 Streptomyces sp. Root431 Isolate Unclassified
128 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
129 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
130 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
131 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
132 2643221714 Streptomyces sp. Root264 Isolate Unclassified
133 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
134 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
135 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
136 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
137 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
138 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
139 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
140 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
141 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
142 2808606448 Streptomyces sp. 193411 Isolate Unclassified
143 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
144 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
145 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
146 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
147 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
148 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
149 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
150 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
151 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
152 2862574272 Streptomyces sp. AcE210 Isolate Nodule
153 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
154 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
155 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
156 2867369537 Streptomyces sp. Z26 Isolate Unclassified
157 2867428634 Streptomyces sp. RP5T Isolate Unclassified
158 2867475112 Streptomyces sp. TM32 Isolate Unclassified
159 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
160 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
161 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
162 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
163 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
164 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
165 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
166 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
167 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
168 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
169 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
170 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
171 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
172 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
173 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
174 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
175 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
176 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
177 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
178 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
179 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
180 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
181 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
182 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
183 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
184 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
185 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
186 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
187 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
188 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
189 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
190 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
191 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
192 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
193 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
194 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
195 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
196 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
197 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
198 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
199 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
200 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
201 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
202 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
203 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
204 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
205 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
206 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
207 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
208 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
209 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
210 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
211 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
212 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.26
Metatranscriptomes 0
Isolates 37.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 1.13
Rhizoplane 0.38
Rhizosphere 73.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010372 3300003316 Bacteria 11203
2 rootL2_10014591 3300003322 Bacteria 4271
3 Ga0081455_10029838 3300005937 Bacteria 4967
4 Ga0075367_10001177 3300006178 Bacteria 10965
5 Ga0099826_10054493 3300006948 Bacteria 2654
6 Ga0105246_10001055 3300011119 Bacteria 15889
7 Ga0182008_10001329 3300014497 Bacteria 16860
8 Ga0182007_10001301 3300015262 Bacteria 13503
9 Ga0182005_1007392 3300015265 Bacteria 3298
10 Ga0183367_1008 3300015688 Bacteria 490626
11 Ga0209758_1005444 3300025297 Bacteria 9802
12 Ga0207426_1004266 3300025302 Bacteria 7086
13 Ga0207426_1005207 3300025302 Bacteria 6039
14 Ga0207713_1018444 3300025735 Bacteria 3455
15 Ga0307517_10015666 3300028786 Bacteria 10048
16 Ga0307515_10013647 3300028794 Bacteria 15141
17 Ga0307511_10009345 3300030521 Bacteria 9770
18 Ga0307512_10003822 3300030522 Bacteria 16980
19 Ga0307513_10019948 3300031456 Bacteria 7963
20 Ga0307509_10051870 3300031507 Bacteria 4381
21 Ga0307508_10001438 3300031616 Bacteria 26820
22 Ga0307508_10010760 3300031616 Bacteria 8365
23 Ga0307507_10017670 3300033179 Bacteria 8172
24 Ga0307510_10100454 3300033180 Bacteria 2686
25 Ga0395898_0002467 3300037466 Bacteria 21817
26 Ga0395898_0002590 3300037466 Bacteria 21126
27 Ga0451853_1172804 3300041512 Bacteria 3197
28 Ga0439433_0002456 3300041999 Bacteria 3931
29 Ga0439449_0000236 3300042007 Bacteria 19915
30 Ga0439457_000228 3300042014 Bacteria 15000
31 Ga0439457_001660 3300042014 Bacteria 6608
32 Ga0450903_000417 3300042138 Bacteria 9141
33 Ga0439458_0003512 3300042157 Bacteria 3661
34 Ga0466965_0001582 3300044683 Bacteria 9291
35 Ga0466966_0006565 3300044684 Bacteria 7701
36 Ga0466966_0027160 3300044684 Bacteria 3732
37 Ga0466963_0000848 3300044694 Bacteria 15396
38 Ga0466963_0002330 3300044694 Bacteria 10587
39 Ga0466971_0000467 3300044719 Bacteria 15848
40 Ga0466968_0003566 3300044735 Bacteria 5755
41 Ga0466970_0008262 3300044765 Bacteria 5231
42 Ga0466957_0009364 3300044842 Bacteria 5591
43 Ga0466958_0009780 3300045836 Bacteria 5351
44 Ga0466967_0062041 3300045976 Bacteria 3317
45 Ga0495592_0003299 3300046454 Bacteria 11564
46 Ga0495603_0001712 3300046455 Bacteria 12915
47 Ga0495603_0004876 3300046455 Bacteria 8024
48 Ga0495603_0024197 3300046455 Bacteria 3672
49 Ga0495629_0006000 3300046459 Bacteria 9033
50 Ga0495629_0031381 3300046459 Bacteria 3763
51 Ga0495638_0033878 3300046460 Bacteria 3263
52 Ga0495651_0000900 3300046462 Bacteria 23054
53 Ga0495605_0002138 3300046474 Bacteria 12351
54 Ga0495662_0001347 3300046476 Bacteria 12146
55 Ga0495662_0001532 3300046476 Bacteria 11473
56 Ga0495662_0034344 3300046476 Bacteria 2448
57 Ga0495664_0004851 3300046477 Bacteria 7353
58 Ga0495594_0000269 3300046499 Bacteria 25583
59 Ga0495594_0028842 3300046499 Bacteria 2996
60 Ga0495606_0018224 3300046507 Bacteria 5273
61 Ga0495616_0007784 3300046513 Bacteria 6394
62 Ga0495618_0005694 3300046514 Bacteria 7574
63 Ga0495640_0073987 3300046533 Bacteria 2279
64 Ga0495587_0000405 3300046536 Bacteria 30522
65 Ga0495609_0010741 3300046538 Bacteria 4380
66 Ga0495645_0007443 3300046543 Bacteria 7621
67 Ga0495633_0009701 3300046558 Bacteria 5294
68 Ga0495668_0010996 3300046616 Bacteria 5445
69 Ga0495634_0002661 3300046642 Bacteria 14689
70 Ga0495634_0016886 3300046642 Bacteria 5214
71 Ga0495625_0007186 3300046660 Bacteria 9759
72 Ga0495635_0003903 3300046663 Bacteria 10363
73 Ga0495588_0001299 3300046674 Bacteria 10689
74 Ga0495657_0001638 3300046675 Bacteria 19231
75 Ga0495646_0001203 3300046680 Bacteria 15150
76 Ga0495613_0003426 3300046689 Bacteria 11853
77 Ga0495613_0006384 3300046689 Bacteria 8809
78 Ga0495624_0032671 3300046690 Bacteria 3373
79 Ga0495649_0016644 3300046694 Bacteria 4166
80 Ga0495589_0005176 3300046794 Bacteria 6895
81 Ga0495600_0005666 3300046809 Bacteria 7542
82 Ga0495660_0035866 3300046810 Bacteria 2768
83 Ga0495604_0000211 3300047317 Bacteria 53509
84 Ga0495604_0001731 3300047317 Bacteria 17910
85 Ga0495604_0018809 3300047317 Bacteria 5531
86 Ga0495604_0075788 3300047317 Bacteria 2531
87 Ga0495636_0003816 3300047318 Bacteria 5871
88 Ga0495674_0113248 3300047319 Bacteria 2297
89 Ga0495676_0002562 3300047321 Bacteria 16183
90 Ga0495676_0006337 3300047321 Bacteria 10898
91 Ga0495676_0021466 3300047321 Bacteria 5637
92 Ga0495687_013758 3300047443 Bacteria 4202
93 Ga0495675_0003955 3300047444 Bacteria 8981
94 Ga0495685_007396 3300047447 Bacteria 3624
95 Ga0495681_0004864 3300047470 Bacteria 9081
96 Ga0495681_0005097 3300047470 Bacteria 8858
97 Ga0495593_0005743 3300047673 Bacteria 7324
98 Ga0495602_0016962 3300048088 Bacteria 7307
99 Ga0495614_0000405 3300048089 Bacteria 17587
100 Ga0495614_0005310 3300048089 Bacteria 5808
101 Ga0501031_0001023 3300049568 Bacteria 16953
102 Ga0501031_0005002 3300049568 Bacteria 8619
103 Ga0501031_0065164 3300049568 Bacteria 2373
104 Ga0501032_0048587 3300049569 Bacteria 2864
105 Ga0501033_0001943 3300049570 Bacteria 17996
106 Ga0501033_0006467 3300049570 Bacteria 9168
107 Ga0501034_0030407 3300049571 Bacteria 5490
108 Ga0501034_0068054 3300049571 Bacteria 3572
109 Ga0501034_0165333 3300049571 Bacteria 2181
110 Ga0501036_0000606 3300049572 Bacteria 26021
111 Ga0501036_0003195 3300049572 Bacteria 13083
112 Ga0501036_0009605 3300049572 Bacteria 7957
113 Ga0501036_0026442 3300049572 Bacteria 4898
114 Ga0501036_0045364 3300049572 Bacteria 3724
115 Ga0501037_0001454 3300049573 Bacteria 17404
116 Ga0501037_0004923 3300049573 Bacteria 9720
117 Ga0501037_0017314 3300049573 Bacteria 5308
118 Ga0501038_0001743 3300049574 Bacteria 20226
119 Ga0501038_0022405 3300049574 Bacteria 5662
120 Ga0501038_0040532 3300049574 Bacteria 4066
121 Ga0501040_0020824 3300049576 Bacteria 4372
122 Ga0501041_0001328 3300049577 Bacteria 13604
123 Ga0501042_0005771 3300049578 Bacteria 7993
124 Ga0501043_0000941 3300049579 Bacteria 25840
125 Ga0501043_0005014 3300049579 Bacteria 10718
126 Ga0501043_0007062 3300049579 Bacteria 8938
127 Ga0501043_0031602 3300049579 Bacteria 4161
128 Ga0501043_0044373 3300049579 Bacteria 3495
129 Ga0501046_0002397 3300049580 Bacteria 17599
130 Ga0501047_0000075 3300049581 Bacteria 124995
131 Ga0501047_0000280 3300049581 Bacteria 59132
132 Ga0501047_0011351 3300049581 Bacteria 8433
133 Ga0501047_0011487 3300049581 Bacteria 8382
134 Ga0501047_0019602 3300049581 Bacteria 6491
135 Ga0501047_0029049 3300049581 Bacteria 5333
136 Ga0501067_0005138 3300049583 Bacteria 7273
137 Ga0501068_0000625 3300049584 Bacteria 18053
138 Ga0501070_0006484 3300049586 Bacteria 9960
139 Ga0501071_0001568 3300049587 Bacteria 13369
140 Ga0501072_0000945 3300049588 Bacteria 21381
141 Ga0501074_0000971 3300049590 Bacteria 18563
142 Ga0501074_0008583 3300049590 Bacteria 7400
143 Ga0501076_0011557 3300049592 Bacteria 6583
144 Ga0501080_0020644 3300049742 Bacteria 6101
145 Ga0501035_0000852 3300049822 Bacteria 32539
146 Ga0501035_0001962 3300049822 Bacteria 20594
147 Ga0501035_0019509 3300049822 Bacteria 6233
148 Ga0501035_0073545 3300049822 Bacteria 3024
149 Ga0501044_0001992 3300049823 Bacteria 23587
150 Ga0501044_0008227 3300049823 Bacteria 11443
151 Ga0501044_0014432 3300049823 Bacteria 8528
152 Ga0501044_0065071 3300049823 Bacteria 3719
153 Ga0501044_0106498 3300049823 Bacteria 2816
154 Ga0501044_0144711 3300049823 Bacteria 2363
155 nmdc:mga06z11_586_c1 3300050494 Bacteria 13318
156 Ga0495612_0021849 3300053078 Bacteria 2566
157 Ga0495655_0005576 3300053083 Bacteria 2233
158 Ga0500640_009068 3300053095 Bacteria 3960
159 Ga0500569_000444 3300053109 Bacteria 6775
160 Ga0500652_021871 3300053131 Bacteria 2414
161 Ga0500600_0006457 3300053149 Bacteria 6995
162 Ga0500616_0002954 3300053153 Bacteria 13504
163 Ga0500634_0008659 3300053161 Bacteria 5096
164 Ga0501084_0016676 3300054114 Bacteria 6101
165 Ga0501082_0000551 3300060353 Bacteria 33339
166 2862389696 2862382967 Bacteria 10317375
167 2547406162 2547132111 Bacteria 8013147
168 2554257467 2554235005 Bacteria 6457341
169 2585298402 2582581312 Bacteria 7308206
170 2585305700 2582581313 Bacteria 10042643
171 2585314610 2582581314 Bacteria 11452267
172 2616904143 2616644941 Bacteria 8510691
173 2643763197 2643221548 Bacteria 8053412
174 2643900241 2643221578 Bacteria 9213798
175 2643947967 2643221587 Bacteria 7586415
176 2644018251 2643221601 Bacteria 7493239
177 2644174288 2643221631 Bacteria 8168043
178 2644262824 2643221647 Bacteria 10741251
179 2644390597 2643221670 Bacteria 6497041
180 2644405535 2643221673 Bacteria 9196637
181 2644433833 2643221677 Bacteria 7584031
182 2644443028 2643221678 Bacteria 9540101
183 2644463933 2643221682 Bacteria 6743283
184 2644627161 2643221714 Bacteria 9015452
185 2768642397 2767802112 Bacteria 6465194
186 2784589087 2784132148 Bacteria 8627943
187 2785342765 2784746763 Bacteria 9783172
188 2785370038 2784746768 Bacteria 10036182
189 2786671110 2786546132 Bacteria 10419719
190 2793983516 2791355406 Bacteria 11364898
191 2804846288 2802429296 Bacteria 7227771
192 2808842549 2808606359 Bacteria 9866990
193 2808921056 2808606375 Bacteria 9466072
194 2809232689 2808606448 Bacteria 8656184
195 2811845692 2808606982 Bacteria 7791042
196 2812357565 2811994879 Bacteria 9313447
197 2812480089 2811994917 Bacteria 7761064
198 2819697441 2818991463 Bacteria 7948711
199 2852637358 2852635781 Bacteria 8251373
200 2862178890 2862178590 Bacteria 8583590
201 2862286141 2862281513 Bacteria 9621493
202 2862295610 2862290372 Bacteria 7471434
203 2862508207 2862507626 Bacteria 9425308
204 2862578778 2862574272 Bacteria 10567477
205 2862708376 2862705112 Bacteria 6563286
206 2863412656 2863404153 Bacteria 9672205
207 2867350519 2867346516 Bacteria 7608576
208 2867372410 2867369537 Bacteria 6501581
209 2867430588 2867428634 Bacteria 9590268
210 2867476923 2867475112 Bacteria 6909112
211 2873155268 2873151551 Bacteria 8625867
212 2875395119 2875391855 Bacteria 7600475
213 2877680587 2877676314 Bacteria 9512378
214 2912719293 2912715099 Bacteria 9460473
215 2912724012 2912723979 Bacteria 8557534
216 2912731517 2912723979 Bacteria 8557534
217 2912761368 2912757875 Bacteria 7940295
218 2918505021 2918501144 Bacteria 8668083
219 2919471796 2919468124 Bacteria 9133025
220 2935390728 2935390628 Bacteria 7043367
221 2946049421 2946045630 Bacteria 8527308
222 2946068287 2946064051 Bacteria 8957905
223 2946076429 2946072368 Bacteria 8999607
224 2947228633 2947224130 Bacteria 9938529
225 2954006898 2954002825 Bacteria 9173742
226 2954385708 2954380949 Bacteria 10050426
227 2954677441 2954673503 Bacteria 9685905
228 2954686713 2954682443 Bacteria 9862841
229 2954696360 2954691527 Bacteria 10720516
230 2954705917 2954701450 Bacteria 10834262
231 2954715718 2954711539 Bacteria 10867210
232 2954725656 2954721474 Bacteria 10456478
233 2954736156 2954731030 Bacteria 10243860
234 2954744595 2954740390 Bacteria 10229294
235 2954755004 2954749733 Bacteria 10366972
236 2954763577 2954759201 Bacteria 9358192
237 2966602162 2966598605 Bacteria 7676064
238 2990049880 2990044586 Bacteria 6603797
239 2990061568 2990059506 Bacteria 9321252
240 2990091173 2990088156 Bacteria 6657676
241 2997458976 2997451912 Bacteria 8492419
242 2997604614 2997600082 Bacteria 9896405
243 3006325791 3006321560 Bacteria 8247479
244 3006399209 3006393351 Bacteria 6615579
245 3006425800 3006425503 Bacteria 6491253
246 3006488530 3006486233 Bacteria 8157040
247 3006499464 3006493962 Bacteria 8825450
248 8008486053 8008485437 Bacteria 7198341
249 8008578450 8008574985 Bacteria 7815457
250 8023624945 8023623736 Bacteria 8593882
251 8025419954 8025413630 Bacteria 7014048
252 8025485738 8025478263 Bacteria 8209203
253 8025525369 8025524527 Bacteria 7197316
254 8025534494 8025530807 Bacteria 8495698
255 8033686424 8033684223 Bacteria 6906479
256 8047897528 8047893842 Bacteria 11723082
257 8048127884 8048127548 Bacteria 11053136
258 8048361342 8048356638 Bacteria 11044339
259 8048374515 8048369669 Bacteria 11666822
260 8048383707 8048379754 Bacteria 11877923
261 8048410283 8048406513 Bacteria 8936924
262 8054167499 8054160619 Bacteria 7783213
263 8056452911 8056447290 Bacteria 7680491
264 8056671377 8056667051 Bacteria 6953971
265 8056837982 8056829672 Bacteria 9045328
266 rootH1_10010372
267 rootL2_10014591
268 Ga0081455_10029838
269 Ga0075367_10001177
270 Ga0099826_10054493
271 Ga0105246_10001055
272 Ga0182008_10001329
273 Ga0182007_10001301
274 Ga0182005_1007392
275 Ga0183367_1008
276 Ga0209758_1005444
277 Ga0207426_1004266
278 Ga0207426_1005207
279 Ga0207713_1018444
280 Ga0307517_10015666
281 Ga0307515_10013647
282 Ga0307511_10009345
283 Ga0307512_10003822
284 Ga0307513_10019948
285 Ga0307509_10051870
286 Ga0307508_10001438
287 Ga0307508_10010760
288 Ga0307507_10017670
289 Ga0307510_10100454
290 Ga0395898_0002467
291 Ga0395898_0002590
292 Ga0451853_1172804
293 Ga0439433_0002456
294 Ga0439449_0000236
295 Ga0439457_000228
296 Ga0439457_001660
297 Ga0450903_000417
298 Ga0439458_0003512
299 Ga0466965_0001582
300 Ga0466966_0006565
301 Ga0466966_0027160
302 Ga0466963_0000848
303 Ga0466963_0002330
304 Ga0466971_0000467
305 Ga0466968_0003566
306 Ga0466970_0008262
307 Ga0466957_0009364
308 Ga0466958_0009780
309 Ga0466967_0062041
310 Ga0495592_0003299
311 Ga0495603_0001712
312 Ga0495603_0004876
313 Ga0495603_0024197
314 Ga0495629_0006000
315 Ga0495629_0031381
316 Ga0495638_0033878
317 Ga0495651_0000900
318 Ga0495605_0002138
319 Ga0495662_0001347
320 Ga0495662_0001532
321 Ga0495662_0034344
322 Ga0495664_0004851
323 Ga0495594_0000269
324 Ga0495594_0028842
325 Ga0495606_0018224
326 Ga0495616_0007784
327 Ga0495618_0005694
328 Ga0495640_0073987
329 Ga0495587_0000405
330 Ga0495609_0010741
331 Ga0495645_0007443
332 Ga0495633_0009701
333 Ga0495668_0010996
334 Ga0495634_0002661
335 Ga0495634_0016886
336 Ga0495625_0007186
337 Ga0495635_0003903
338 Ga0495588_0001299
339 Ga0495657_0001638
340 Ga0495646_0001203
341 Ga0495613_0003426
342 Ga0495613_0006384
343 Ga0495624_0032671
344 Ga0495649_0016644
345 Ga0495589_0005176
346 Ga0495600_0005666
347 Ga0495660_0035866
348 Ga0495604_0000211
349 Ga0495604_0001731
350 Ga0495604_0018809
351 Ga0495604_0075788
352 Ga0495636_0003816
353 Ga0495674_0113248
354 Ga0495676_0002562
355 Ga0495676_0006337
356 Ga0495676_0021466
357 Ga0495687_013758
358 Ga0495675_0003955
359 Ga0495685_007396
360 Ga0495681_0004864
361 Ga0495681_0005097
362 Ga0495593_0005743
363 Ga0495602_0016962
364 Ga0495614_0000405
365 Ga0495614_0005310
366 Ga0501031_0001023
367 Ga0501031_0005002
368 Ga0501031_0065164
369 Ga0501032_0048587
370 Ga0501033_0001943
371 Ga0501033_0006467
372 Ga0501034_0030407
373 Ga0501034_0068054
374 Ga0501034_0165333
375 Ga0501036_0000606
376 Ga0501036_0003195
377 Ga0501036_0009605
378 Ga0501036_0026442
379 Ga0501036_0045364
380 Ga0501037_0001454
381 Ga0501037_0004923
382 Ga0501037_0017314
383 Ga0501038_0001743
384 Ga0501038_0022405
385 Ga0501038_0040532
386 Ga0501040_0020824
387 Ga0501041_0001328
388 Ga0501042_0005771
389 Ga0501043_0000941
390 Ga0501043_0005014
391 Ga0501043_0007062
392 Ga0501043_0031602
393 Ga0501043_0044373
394 Ga0501046_0002397
395 Ga0501047_0000075
396 Ga0501047_0000280
397 Ga0501047_0011351
398 Ga0501047_0011487
399 Ga0501047_0019602
400 Ga0501047_0029049
401 Ga0501067_0005138
402 Ga0501068_0000625
403 Ga0501070_0006484
404 Ga0501071_0001568
405 Ga0501072_0000945
406 Ga0501074_0000971
407 Ga0501074_0008583
408 Ga0501076_0011557
409 Ga0501080_0020644
410 Ga0501035_0000852
411 Ga0501035_0001962
412 Ga0501035_0019509
413 Ga0501035_0073545
414 Ga0501044_0001992
415 Ga0501044_0008227
416 Ga0501044_0014432
417 Ga0501044_0065071
418 Ga0501044_0106498
419 Ga0501044_0144711
420 nmdc:mga06z11_586_c1
421 Ga0495612_0021849
422 Ga0495655_0005576
423 Ga0500640_009068
424 Ga0500569_000444
425 Ga0500652_021871
426 Ga0500600_0006457
427 Ga0500616_0002954
428 Ga0500634_0008659
429 Ga0501084_0016676
430 Ga0501082_0000551
431 2862389696
432 2547406162
433 2554257467
434 2585298402
435 2585305700
436 2585314610
437 2616904143
438 2643763197
439 2643900241
440 2643947967
441 2644018251
442 2644174288
443 2644262824
444 2644390597
445 2644405535
446 2644433833
447 2644443028
448 2644463933
449 2644627161
450 2768642397
451 2784589087
452 2785342765
453 2785370038
454 2786671110
455 2793983516
456 2804846288
457 2808842549
458 2808921056
459 2809232689
460 2811845692
461 2812357565
462 2812480089
463 2819697441
464 2852637358
465 2862178890
466 2862286141
467 2862295610
468 2862508207
469 2862578778
470 2862708376
471 2863412656
472 2867350519
473 2867372410
474 2867430588
475 2867476923
476 2873155268
477 2875395119
478 2877680587
479 2912719293
480 2912724012
481 2912731517
482 2912761368
483 2918505021
484 2919471796
485 2935390728
486 2946049421
487 2946068287
488 2946076429
489 2947228633
490 2954006898
491 2954385708
492 2954677441
493 2954686713
494 2954696360
495 2954705917
496 2954715718
497 2954725656
498 2954736156
499 2954744595
500 2954755004
501 2954763577
502 2966602162
503 2990049880
504 2990061568
505 2990091173
506 2997458976
507 2997604614
508 3006325791
509 3006399209
510 3006425800
511 3006488530
512 3006499464
513 8008486053
514 8008578450
515 8023624945
516 8025419954
517 8025485738
518 8025525369
519 8025534494
520 8033686424
521 8047897528
522 8048127884
523 8048361342
524 8048374515
525 8048383707
526 8048410283
527 8054167499
528 8056452911
529 8056671377
530 8056837982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03793

PASTA

PASTA domain

439

502

0.95

PF03793

PASTA

PASTA domain

507

570

0.94

PF03793

PASTA

PASTA domain

372

434

0.93

PF00069

Pkinase

Protein kinase domain

7

269

0.92

PF07714

PK_Tyr_Ser-Thr

Protein tyrosine and serine/threonine kinase

7

266

0.84

PF03109

ABC1

ABC1 atypical kinase-like domain

41

169

0.84

PF03793

PASTA

PASTA domain

579

640

0.83

Map