F373352

General Info

Members Datasets Scaffolds Average Seq Length
265 180 530 200

Family's Representative Sequence

Representative Sequence 3300025893|Ga0207682_10137840|Ga0207682_101378401
Length 248
Sequence MQDLIRQLIEQLGEDPNREGLVRTPQRVEKALRFLTSGYAANIDEVLNEALFTVDYSEMVIVKDIDFYSLCEHHLLPFFGKCHVAYIPSNRVIGLSKIPRLVDVFSRRLQVQERLTTQIADALMRKLDPRVQFRNPVMFVVYVGSILTTVIGSLAAFVLAISAWLWLTVLFANFAEAVAEGRGKAQAATLRSMRRHVHARRIVGSHRNDTHTVEAADLLAQCCEHIFQACDLSARFLEVRLERGAQFG

Samples

Sample ID Description Type Environment
1 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
113 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 1.13
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207682_10137840 3300025893 Bacteria 1093
2 JGI24739J22299_10131101 3300001989 Unclassified 746
3 Ga0065715_10258440 3300005293 Bacteria 1145
4 Ga0065715_10465485 3300005293 Bacteria 805
5 Ga0065707_10187670 3300005295 Bacteria 1379
6 Ga0070690_100193716 3300005330 Bacteria 1411
7 Ga0070690_100432277 3300005330 Bacteria 973
8 Ga0068869_100024990 3300005334 Bacteria 4143
9 Ga0070666_10274740 3300005335 Bacteria 1197
10 Ga0070691_10039154 3300005341 Bacteria 2240
11 Ga0070661_100417734 3300005344 Bacteria 1063
12 Ga0070692_10009004 3300005345 Bacteria 4480
13 Ga0070669_100015700 3300005353 Bacteria 5400
14 Ga0070669_100337779 3300005353 Bacteria 1220
15 Ga0070669_100517177 3300005353 Bacteria 992
16 Ga0070675_100040069 3300005354 Bacteria 3823
17 Ga0070675_100081474 3300005354 Bacteria 2699
18 Ga0070675_100634264 3300005354 Bacteria 971
19 Ga0070671_100465170 3300005355 Bacteria 1086
20 Ga0070671_100599535 3300005355 Bacteria 952
21 Ga0070674_100284048 3300005356 Bacteria 1313
22 Ga0070674_100460088 3300005356 Bacteria 1052
23 Ga0070673_100111943 3300005364 Bacteria 2265
24 Ga0070673_101010542 3300005364 Bacteria 775
25 Ga0070688_100054598 3300005365 Bacteria 2503
26 Ga0070688_100123399 3300005365 Bacteria 1738
27 Ga0070667_100511201 3300005367 Bacteria 1102
28 Ga0070709_10571666 3300005434 Bacteria 867
29 Ga0070701_10018979 3300005438 Bacteria 3241
30 Ga0070701_10316317 3300005438 Bacteria 964
31 Ga0070694_100018715 3300005444 Bacteria 4399
32 Ga0070678_100143994 3300005456 Bacteria 1911
33 Ga0070662_100325202 3300005457 Bacteria 1255
34 Ga0070662_100770719 3300005457 Bacteria 817
35 Ga0070706_100666205 3300005467 Bacteria 966
36 Ga0070707_100092915 3300005468 Bacteria 2921
37 Ga0070707_100111115 3300005468 Bacteria 2658
38 Ga0070707_100119566 3300005468 Bacteria 2558
39 Ga0070707_100971516 3300005468 Bacteria 814
40 Ga0070698_100002545 3300005471 Bacteria 20085
41 Ga0070698_100013183 3300005471 Bacteria 8746
42 Ga0070698_100324037 3300005471 Bacteria 1472
43 Ga0070698_100376094 3300005471 Bacteria 1353
44 Ga0070699_100000475 3300005518 Bacteria 38225
45 Ga0070699_100127280 3300005518 Bacteria 2243
46 Ga0070697_100179591 3300005536 Bacteria 1794
47 Ga0070672_100168228 3300005543 Bacteria 1822
48 Ga0070672_100233798 3300005543 Bacteria 1545
49 Ga0070672_100777106 3300005543 Bacteria 842
50 Ga0070695_100004971 3300005545 Bacteria 7840
51 Ga0070696_100002804 3300005546 Bacteria 11574
52 Ga0070696_100626762 3300005546 Bacteria 869
53 Ga0070704_100017188 3300005549 Bacteria 4592
54 Ga0070704_100048133 3300005549 Unclassified 2982
55 Ga0068855_101536466 3300005563 Bacteria 683
56 Ga0070664_100190759 3300005564 Bacteria 1826
57 Ga0070664_100382852 3300005564 Bacteria 1284
58 Ga0068857_100230515 3300005577 Unclassified 1694
59 Ga0070702_100383834 3300005615 Unclassified 1000
60 Ga0068859_100534731 3300005617 Bacteria 1267
61 Ga0068864_100247828 3300005618 Bacteria 1653
62 Ga0068864_100687357 3300005618 Unclassified 999
63 Ga0068866_10069572 3300005718 Bacteria 1855
64 Ga0068866_10486352 3300005718 Bacteria 814
65 Ga0068861_100690044 3300005719 Bacteria 947
66 Ga0068861_100721094 3300005719 Bacteria 929
67 Ga0068861_101020009 3300005719 Unclassified 791
68 Ga0068863_100004083 3300005841 Bacteria 14422
69 Ga0068863_100099237 3300005841 Bacteria 2767
70 Ga0068860_101005614 3300005843 Bacteria 852
71 Ga0068862_100101628 3300005844 Bacteria 2515
72 Ga0068862_100798381 3300005844 Bacteria 921
73 Ga0081455_10352355 3300005937 Bacteria 1038
74 Ga0075368_10081920 3300006042 Bacteria 1314
75 Ga0075432_10178427 3300006058 Bacteria 830
76 Ga0075367_10013408 3300006178 Bacteria 4404
77 Ga0075366_10059510 3300006195 Bacteria 2269
78 Ga0097621_100057630 3300006237 Bacteria 3177
79 Ga0068871_100045208 3300006358 Bacteria 3543
80 Ga0068871_100861802 3300006358 Bacteria 838
81 Ga0075428_101060530 3300006844 Archaea 857
82 Ga0075430_100000262 3300006846 Bacteria 36942
83 Ga0075430_100033498 3300006846 Bacteria 4360
84 Ga0075431_100000517 3300006847 Bacteria 32332
85 Ga0075431_100071374 3300006847 Bacteria 3583
86 Ga0075433_10026162 3300006852 Bacteria 4937
87 Ga0075433_10101306 3300006852 Bacteria 2550
88 Ga0075433_10467301 3300006852 Bacteria 1111
89 Ga0075434_100034939 3300006871 Bacteria 4968
90 Ga0075434_100092416 3300006871 Bacteria 3028
91 Ga0075429_100005064 3300006880 Bacteria 11333
92 Ga0075429_100273559 3300006880 Bacteria 1479
93 Ga0068865_100031934 3300006881 Bacteria 3514
94 Ga0075436_100040303 3300006914 Bacteria 3223
95 Ga0075436_100088896 3300006914 Bacteria 2146
96 Ga0097620_100534694 3300006931 Bacteria 1267
97 Ga0075435_100123579 3300007076 Bacteria 2161
98 Ga0099794_10078127 3300007265 Unclassified 1629
99 Ga0105240_10239772 3300009093 Bacteria 2103
100 Ga0105240_10298932 3300009093 Bacteria 1842
101 Ga0111539_10158723 3300009094 Bacteria 2646
102 Ga0111539_10412916 3300009094 Bacteria 1572
103 Ga0111539_11159493 3300009094 Bacteria 898
104 Ga0105245_10020832 3300009098 Bacteria 5747
105 Ga0105245_10155522 3300009098 Bacteria 2165
106 Ga0114129_10001462 3300009147 Bacteria 31921
107 Ga0114129_10019860 3300009147 Bacteria 9563
108 Ga0114129_10605851 3300009147 Bacteria 1418
109 Ga0105243_10126227 3300009148 Bacteria 2165
110 Ga0105243_11013464 3300009148 Unclassified 834
111 Ga0105242_10263240 3300009176 Bacteria 1559
112 Ga0105248_10027414 3300009177 Bacteria 6343
113 Ga0105248_10037261 3300009177 Bacteria 5441
114 Ga0105238_10478761 3300009551 Unclassified 1244
115 Ga0105249_10615712 3300009553 Bacteria 1141
116 Ga0157374_11110815 3300013296 Bacteria 811
117 Ga0157375_10151016 3300013308 Bacteria 2458
118 Ga0157375_10313815 3300013308 Bacteria 1732
119 Ga0157375_10499278 3300013308 Bacteria 1381
120 Ga0157375_10620526 3300013308 Bacteria 1239
121 Ga0157375_10799044 3300013308 Bacteria 1092
122 Ga0163163_10019258 3300014325 Bacteria 6407
123 Ga0163163_10158484 3300014325 Bacteria 2308
124 Ga0157380_10371499 3300014326 Bacteria 1346
125 Ga0157377_10016610 3300014745 Bacteria 3789
126 Ga0157376_10162554 3300014969 Bacteria 2026
127 Ga0157376_10185662 3300014969 Bacteria 1904
128 Ga0157376_11519939 3300014969 Bacteria 703
129 Ga0206352_11071663 3300020078 Bacteria 751
130 Ga0207688_10138991 3300025901 Bacteria 1429
131 Ga0207680_10527354 3300025903 Bacteria 842
132 Ga0207684_10541293 3300025910 Bacteria 996
133 Ga0207649_10286698 3300025920 Bacteria 1199
134 Ga0207646_10136157 3300025922 Bacteria 2211
135 Ga0207681_10086635 3300025923 Bacteria 2226
136 Ga0207681_10141294 3300025923 Bacteria 1793
137 Ga0207681_10361707 3300025923 Bacteria 1164
138 Ga0207659_10002001 3300025926 Bacteria 12075
139 Ga0207659_10023813 3300025926 Bacteria 4093
140 Ga0207687_10232811 3300025927 Bacteria 1456
141 Ga0207686_10011654 3300025934 Bacteria 4821
142 Ga0207686_10372663 3300025934 Bacteria 1081
143 Ga0207669_10149297 3300025937 Bacteria 1635
144 Ga0207669_10416900 3300025937 Unclassified 1056
145 Ga0207669_10462127 3300025937 Bacteria 1008
146 Ga0207691_10237849 3300025940 Bacteria 1575
147 Ga0207711_10014346 3300025941 Bacteria 6580
148 Ga0207711_10153652 3300025941 Bacteria 2078
149 Ga0207711_10695796 3300025941 Bacteria 948
150 Ga0207689_10023013 3300025942 Bacteria 5233
151 Ga0207679_10065357 3300025945 Bacteria 2722
152 Ga0207667_11155196 3300025949 Bacteria 755
153 Ga0207651_10669224 3300025960 Bacteria 912
154 Ga0207658_10410680 3300025986 Bacteria 1192
155 Ga0207677_10038195 3300026023 Bacteria 3146
156 Ga0207678_10315635 3300026067 Bacteria 1344
157 Ga0207708_10049616 3300026075 Unclassified 3196
158 Ga0207641_10000885 3300026088 Bacteria 31246
159 Ga0207641_10516792 3300026088 Unclassified 1161
160 Ga0207648_10321488 3300026089 Bacteria 1391
161 Ga0207648_10347909 3300026089 Bacteria 1336
162 Ga0207648_10405465 3300026089 Bacteria 1236
163 Ga0207676_10222524 3300026095 Bacteria 1682
164 Ga0207674_10238344 3300026116 Bacteria 1766
165 Ga0207675_100942296 3300026118 Bacteria 881
166 Ga0207683_10103081 3300026121 Bacteria 2548
167 Ga0207683_10125000 3300026121 Unclassified 2311
168 Ga0207683_10134219 3300026121 Bacteria 2228
169 Ga0207698_10676525 3300026142 Unclassified 1025
170 Ga0209966_1018447 3300027695 Bacteria 1336
171 Ga0207428_10243197 3300027907 Bacteria 1344
172 Ga0268266_10062604 3300028379 Bacteria 3212
173 Ga0268265_10336172 3300028380 Bacteria 1373
174 Ga0268264_10166674 3300028381 Bacteria 1989
175 Ga0268264_10933437 3300028381 Bacteria 872
176 Ga0307408_100103055 3300031548 Bacteria 2178
177 Ga0307410_10355404 3300031852 Bacteria 1172
178 Ga0307412_10236671 3300031911 Bacteria 1410
179 Ga0373948_0065453 3300034817 Unclassified 806
180 Ga0373949_0044973 3300035090 Bacteria 1097
181 Ga0373923_0079687 3300035111 Bacteria 1419
182 Ga0373923_0159652 3300035111 Unclassified 1028
183 Ga0373953_0074075 3300035117 Unclassified 1408
184 Ga0373953_0295498 3300035117 Bacteria 707
185 Ga0373960_0038297 3300035121 Unclassified 1374
186 Ga0373946_0062039 3300035171 Unclassified 1593
187 Ga0373935_0082678 3300035692 Unclassified 2089
188 Ga0373933_0136467 3300035724 Bacteria 1546
189 Ga0373947_0141113 3300035725 Unclassified 1545
190 Ga0373937_0312149 3300036401 Bacteria 1487
191 Ga0373925_0013851 3300037068 Bacteria 5839
192 Ga0439445_0079276 3300042004 Bacteria 916
193 Ga0439449_0093327 3300042007 Bacteria 1111
194 Ga0439462_0056869 3300042015 Bacteria 1056
195 Ga0495592_0110664 3300046454 Bacteria 1944
196 Ga0495603_0031977 3300046455 Unclassified 3167
197 Ga0495629_0309573 3300046459 Bacteria 1081
198 Ga0495651_0157344 3300046462 Bacteria 1632
199 Ga0495639_0202452 3300046475 Bacteria 972
200 Ga0495584_0039653 3300046491 Bacteria 2379
201 Ga0495584_0342248 3300046491 Bacteria 760
202 Ga0495608_0157837 3300046511 Bacteria 1443
203 Ga0495618_0447490 3300046514 Bacteria 784
204 Ga0495628_0048243 3300046516 Bacteria 3376
205 Ga0495630_0089353 3300046517 Bacteria 2327
206 Ga0495630_0230508 3300046517 Unclassified 1415
207 Ga0495643_0002896 3300046522 Bacteria 13019
208 Ga0495663_0022471 3300046525 Bacteria 1822
209 Ga0495652_0611288 3300046529 Bacteria 742
210 Ga0495665_0151228 3300046531 Bacteria 1212
211 Ga0495598_0140851 3300046537 Bacteria 834
212 Ga0495609_0023584 3300046538 Bacteria 2828
213 Ga0495609_0105314 3300046538 Bacteria 1220
214 Ga0495645_0040778 3300046543 Bacteria 3385
215 Ga0495667_0052577 3300046559 Bacteria 2683
216 Ga0495656_0099787 3300046615 Bacteria 1341
217 Ga0495588_0059055 3300046674 Unclassified 1983
218 Ga0495658_0015554 3300046683 Bacteria 3904
219 Ga0495669_0227688 3300046684 Bacteria 894
220 Ga0495613_0026240 3300046689 Bacteria 4341
221 Ga0495613_0416260 3300046689 Unclassified 915
222 Ga0495600_0605161 3300046809 Bacteria 666
223 Ga0495636_0137911 3300047318 Bacteria 1088
224 Ga0495674_0399612 3300047319 Bacteria 1109
225 Ga0495677_0008695 3300047445 Bacteria 3767
226 Ga0495685_027714 3300047447 Bacteria 1949
227 Ga0495684_0000131 3300047471 Bacteria 54636
228 Ga0496112_0239673 3300048915 Bacteria 1767
229 Ga0496114_0106786 3300048917 Bacteria 2396
230 Ga0496115_0439246 3300048918 Bacteria 1055
231 Ga0501038_0275785 3300049574 Bacteria 1325
232 Ga0501040_0584288 3300049576 Bacteria 807
233 Ga0501041_0077432 3300049577 Bacteria 2046
234 Ga0501041_0092906 3300049577 Bacteria 1863
235 Ga0501042_0271333 3300049578 Bacteria 1225
236 Ga0501048_0261292 3300049582 Bacteria 1230
237 Ga0501071_0015920 3300049587 Bacteria 5166
238 Ga0501072_0209010 3300049588 Bacteria 1555
239 Ga0501075_0012746 3300049591 Bacteria 5983
240 Ga0501076_0012170 3300049592 Bacteria 6432
241 Ga0501045_0273978 3300049824 Bacteria 1256
242 nmdc:mga05p37_106002_c1 3300050507 Bacteria 3457
243 nmdc:mga05p37_508417_c1 3300050507 Bacteria 1381
244 nmdc:mga05p37_66238_c1 3300050507 Bacteria 4443
245 nmdc:mga0qj67_370064_c1 3300050509 Bacteria 1158
246 nmdc:mga06r32_88056_c1 3300050510 Bacteria 3031
247 nmdc:mga08y16_11847_c1 3300050511 Bacteria 9160
248 nmdc:mga08y16_387446_c1 3300050511 Bacteria 1432
249 nmdc:mga0n895_155171_c1 3300050512 Bacteria 2320
250 nmdc:mga0n895_206352_c1 3300050512 Bacteria 1996
251 nmdc:mga0n895_36_c1 3300050512 Bacteria 78366
252 nmdc:mga0rr50_182550_c1 3300050513 Bacteria 1716
253 nmdc:mga0rr50_215440_c1 3300050513 Bacteria 1584
254 nmdc:mga0rr50_29_c1 3300050513 Bacteria 106517
255 nmdc:mga08x19_1015_c1 3300050514 Bacteria 17545
256 nmdc:mga0a205_17044_c1 3300050515 Bacteria 6801
257 nmdc:mga0a205_36267_c1 3300050515 Bacteria 4738
258 nmdc:mga0a205_71846_c1 3300050515 Bacteria 3342
259 Ga0495601_0070280 3300053077 Bacteria 2235
260 Ga0495595_0016735 3300053084 Bacteria 3143
261 Ga0495595_0167621 3300053084 Bacteria 1086
262 Ga0495619_0041024 3300053085 Bacteria 3026
263 Ga0495619_0059500 3300053085 Bacteria 2538
264 Ga0501084_0103350 3300054114 Bacteria 2393
265 Ga0590075_042874 3300059424 Bacteria 1157
266 Ga0207682_10137840
267 JGI24739J22299_10131101
268 Ga0065715_10258440
269 Ga0065715_10465485
270 Ga0065707_10187670
271 Ga0070690_100193716
272 Ga0070690_100432277
273 Ga0068869_100024990
274 Ga0070666_10274740
275 Ga0070691_10039154
276 Ga0070661_100417734
277 Ga0070692_10009004
278 Ga0070669_100015700
279 Ga0070669_100337779
280 Ga0070669_100517177
281 Ga0070675_100040069
282 Ga0070675_100081474
283 Ga0070675_100634264
284 Ga0070671_100465170
285 Ga0070671_100599535
286 Ga0070674_100284048
287 Ga0070674_100460088
288 Ga0070673_100111943
289 Ga0070673_101010542
290 Ga0070688_100054598
291 Ga0070688_100123399
292 Ga0070667_100511201
293 Ga0070709_10571666
294 Ga0070701_10018979
295 Ga0070701_10316317
296 Ga0070694_100018715
297 Ga0070678_100143994
298 Ga0070662_100325202
299 Ga0070662_100770719
300 Ga0070706_100666205
301 Ga0070707_100092915
302 Ga0070707_100111115
303 Ga0070707_100119566
304 Ga0070707_100971516
305 Ga0070698_100002545
306 Ga0070698_100013183
307 Ga0070698_100324037
308 Ga0070698_100376094
309 Ga0070699_100000475
310 Ga0070699_100127280
311 Ga0070697_100179591
312 Ga0070672_100168228
313 Ga0070672_100233798
314 Ga0070672_100777106
315 Ga0070695_100004971
316 Ga0070696_100002804
317 Ga0070696_100626762
318 Ga0070704_100017188
319 Ga0070704_100048133
320 Ga0068855_101536466
321 Ga0070664_100190759
322 Ga0070664_100382852
323 Ga0068857_100230515
324 Ga0070702_100383834
325 Ga0068859_100534731
326 Ga0068864_100247828
327 Ga0068864_100687357
328 Ga0068866_10069572
329 Ga0068866_10486352
330 Ga0068861_100690044
331 Ga0068861_100721094
332 Ga0068861_101020009
333 Ga0068863_100004083
334 Ga0068863_100099237
335 Ga0068860_101005614
336 Ga0068862_100101628
337 Ga0068862_100798381
338 Ga0081455_10352355
339 Ga0075368_10081920
340 Ga0075432_10178427
341 Ga0075367_10013408
342 Ga0075366_10059510
343 Ga0097621_100057630
344 Ga0068871_100045208
345 Ga0068871_100861802
346 Ga0075428_101060530
347 Ga0075430_100000262
348 Ga0075430_100033498
349 Ga0075431_100000517
350 Ga0075431_100071374
351 Ga0075433_10026162
352 Ga0075433_10101306
353 Ga0075433_10467301
354 Ga0075434_100034939
355 Ga0075434_100092416
356 Ga0075429_100005064
357 Ga0075429_100273559
358 Ga0068865_100031934
359 Ga0075436_100040303
360 Ga0075436_100088896
361 Ga0097620_100534694
362 Ga0075435_100123579
363 Ga0099794_10078127
364 Ga0105240_10239772
365 Ga0105240_10298932
366 Ga0111539_10158723
367 Ga0111539_10412916
368 Ga0111539_11159493
369 Ga0105245_10020832
370 Ga0105245_10155522
371 Ga0114129_10001462
372 Ga0114129_10019860
373 Ga0114129_10605851
374 Ga0105243_10126227
375 Ga0105243_11013464
376 Ga0105242_10263240
377 Ga0105248_10027414
378 Ga0105248_10037261
379 Ga0105238_10478761
380 Ga0105249_10615712
381 Ga0157374_11110815
382 Ga0157375_10151016
383 Ga0157375_10313815
384 Ga0157375_10499278
385 Ga0157375_10620526
386 Ga0157375_10799044
387 Ga0163163_10019258
388 Ga0163163_10158484
389 Ga0157380_10371499
390 Ga0157377_10016610
391 Ga0157376_10162554
392 Ga0157376_10185662
393 Ga0157376_11519939
394 Ga0206352_11071663
395 Ga0207688_10138991
396 Ga0207680_10527354
397 Ga0207684_10541293
398 Ga0207649_10286698
399 Ga0207646_10136157
400 Ga0207681_10086635
401 Ga0207681_10141294
402 Ga0207681_10361707
403 Ga0207659_10002001
404 Ga0207659_10023813
405 Ga0207687_10232811
406 Ga0207686_10011654
407 Ga0207686_10372663
408 Ga0207669_10149297
409 Ga0207669_10416900
410 Ga0207669_10462127
411 Ga0207691_10237849
412 Ga0207711_10014346
413 Ga0207711_10153652
414 Ga0207711_10695796
415 Ga0207689_10023013
416 Ga0207679_10065357
417 Ga0207667_11155196
418 Ga0207651_10669224
419 Ga0207658_10410680
420 Ga0207677_10038195
421 Ga0207678_10315635
422 Ga0207708_10049616
423 Ga0207641_10000885
424 Ga0207641_10516792
425 Ga0207648_10321488
426 Ga0207648_10347909
427 Ga0207648_10405465
428 Ga0207676_10222524
429 Ga0207674_10238344
430 Ga0207675_100942296
431 Ga0207683_10103081
432 Ga0207683_10125000
433 Ga0207683_10134219
434 Ga0207698_10676525
435 Ga0209966_1018447
436 Ga0207428_10243197
437 Ga0268266_10062604
438 Ga0268265_10336172
439 Ga0268264_10166674
440 Ga0268264_10933437
441 Ga0307408_100103055
442 Ga0307410_10355404
443 Ga0307412_10236671
444 Ga0373948_0065453
445 Ga0373949_0044973
446 Ga0373923_0079687
447 Ga0373923_0159652
448 Ga0373953_0074075
449 Ga0373953_0295498
450 Ga0373960_0038297
451 Ga0373946_0062039
452 Ga0373935_0082678
453 Ga0373933_0136467
454 Ga0373947_0141113
455 Ga0373937_0312149
456 Ga0373925_0013851
457 Ga0439445_0079276
458 Ga0439449_0093327
459 Ga0439462_0056869
460 Ga0495592_0110664
461 Ga0495603_0031977
462 Ga0495629_0309573
463 Ga0495651_0157344
464 Ga0495639_0202452
465 Ga0495584_0039653
466 Ga0495584_0342248
467 Ga0495608_0157837
468 Ga0495618_0447490
469 Ga0495628_0048243
470 Ga0495630_0089353
471 Ga0495630_0230508
472 Ga0495643_0002896
473 Ga0495663_0022471
474 Ga0495652_0611288
475 Ga0495665_0151228
476 Ga0495598_0140851
477 Ga0495609_0023584
478 Ga0495609_0105314
479 Ga0495645_0040778
480 Ga0495667_0052577
481 Ga0495656_0099787
482 Ga0495588_0059055
483 Ga0495658_0015554
484 Ga0495669_0227688
485 Ga0495613_0026240
486 Ga0495613_0416260
487 Ga0495600_0605161
488 Ga0495636_0137911
489 Ga0495674_0399612
490 Ga0495677_0008695
491 Ga0495685_027714
492 Ga0495684_0000131
493 Ga0496112_0239673
494 Ga0496114_0106786
495 Ga0496115_0439246
496 Ga0501038_0275785
497 Ga0501040_0584288
498 Ga0501041_0077432
499 Ga0501041_0092906
500 Ga0501042_0271333
501 Ga0501048_0261292
502 Ga0501071_0015920
503 Ga0501072_0209010
504 Ga0501075_0012746
505 Ga0501076_0012170
506 Ga0501045_0273978
507 nmdc:mga05p37_106002_c1
508 nmdc:mga05p37_508417_c1
509 nmdc:mga05p37_66238_c1
510 nmdc:mga0qj67_370064_c1
511 nmdc:mga06r32_88056_c1
512 nmdc:mga08y16_11847_c1
513 nmdc:mga08y16_387446_c1
514 nmdc:mga0n895_155171_c1
515 nmdc:mga0n895_206352_c1
516 nmdc:mga0n895_36_c1
517 nmdc:mga0rr50_182550_c1
518 nmdc:mga0rr50_215440_c1
519 nmdc:mga0rr50_29_c1
520 nmdc:mga08x19_1015_c1
521 nmdc:mga0a205_17044_c1
522 nmdc:mga0a205_36267_c1
523 nmdc:mga0a205_71846_c1
524 Ga0495601_0070280
525 Ga0495595_0016735
526 Ga0495595_0167621
527 Ga0495619_0041024
528 Ga0495619_0059500
529 Ga0501084_0103350
530 Ga0590075_042874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

1

133

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9739 50 179
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.966 50 179
7alc-assembly1.cif.gz_D-2 human gch-gfrp stimulatory complex 0.9539 2 179
6z88-assembly1.cif.gz_E human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9538 2 179
6z88-assembly1.cif.gz_A human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9537 2 179
ID Description Score Start End Superfamily
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9381 50 162 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9276 48 180 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9267 51 182 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9144 48 180 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9085 59 178 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A143PSB3-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9658 33 179 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A7X8M8Y8-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9643 24 179 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A258CKE6-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9614 36 179 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A671SLM3-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9605 19 180 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A820EEM1-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9604 38 176 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654

Map