F373327

General Info

Members Datasets Scaffolds Average Seq Length
265 191 531 130

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_12738229|Ga0163163_127382291
Length 143
Sequence VKEPVWVSREVVLAAHDEMLAEHGSRSGIRDEGLLDSALGRPQNLFLYQKPTIFELASAYAFGISKNHPFIDGNKRVAFLTTYIFLGRNGWLLSAPEVEATVKTLQLASGEISESEFAIWLKETSLPITDPGSKRRNQKRRKQ

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
113 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
176 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
177 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
178 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
179 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
180 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
183 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
184 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
188 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
189 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
190 2902330777 Methylobacterium sp. 2A Isolate Unclassified
191 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.21
Nodule 0.38
Rhizoplane 1.13
Rhizosphere 74.34
Stem 0
Stem Tuber 0
Unclassified 8.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_12738229 3300014325 Unclassified 550
2 JGI25406J46586_10000203 3300003203 Bacteria 26378
3 rootH1_10116761 3300003316 Bacteria 1332
4 rootH1_10116761 3300003323 Bacteria 1465
5 rootL2_10213157 3300003322 Bacteria 1413
6 rootH1_10079275 3300003323 Bacteria 1406
7 JGI25404J52841_10012713 3300003659 Bacteria 1825
8 JGI25404J52841_10037963 3300003659 Bacteria 1023
9 JGI25404J52841_10143521 3300003659 Bacteria 506
10 JGI25405J52794_10027940 3300003911 Bacteria 1163
11 Ga0070683_100909947 3300005329 Bacteria 844
12 Ga0070680_100010517 3300005336 Bacteria 7137
13 Ga0070682_101296361 3300005337 Bacteria 619
14 Ga0070675_101134837 3300005354 Bacteria 719
15 Ga0070671_101924950 3300005355 Bacteria 526
16 Ga0070688_101440972 3300005365 Bacteria 559
17 Ga0070667_100520716 3300005367 Bacteria 1091
18 Ga0070709_10007835 3300005434 Bacteria 5864
19 Ga0070709_10018322 3300005434 Bacteria 4030
20 Ga0070714_100461971 3300005435 Bacteria 1207
21 Ga0070713_100204791 3300005436 Bacteria 1784
22 Ga0070711_100007360 3300005439 Bacteria 6698
23 Ga0070663_100573574 3300005455 Bacteria 946
24 Ga0070681_10007484 3300005458 Bacteria 10672
25 Ga0070679_100004568 3300005530 Bacteria 12787
26 Ga0070684_100428229 3300005535 Bacteria 1222
27 Ga0068853_100841097 3300005539 Bacteria 880
28 Ga0068853_101388918 3300005539 Archaea 679
29 Ga0070693_101386244 3300005547 Unclassified 546
30 Ga0068855_100655804 3300005563 Bacteria 1126
31 Ga0070664_100536360 3300005564 Bacteria 1081
32 Ga0068854_100242153 3300005578 Bacteria 1437
33 Ga0068856_101879675 3300005614 Bacteria 610
34 Ga0070702_100484064 3300005615 Bacteria 905
35 Ga0068852_101123508 3300005616 Bacteria 806
36 Ga0068858_100301610 3300005842 Bacteria 1528
37 Ga0068858_100869375 3300005842 Bacteria 881
38 Ga0068858_100905366 3300005842 Unclassified 863
39 Ga0068860_100809939 3300005843 Bacteria 950
40 Ga0068862_100393410 3300005844 Bacteria 1295
41 Ga0068862_102007773 3300005844 Bacteria 589
42 Ga0081455_10074810 3300005937 Bacteria 2796
43 Ga0081540_1003408 3300005983 Bacteria 12584
44 Ga0081540_1008546 3300005983 Bacteria 7146
45 Ga0081540_1032176 3300005983 Bacteria 2869
46 Ga0081540_1062343 3300005983 Bacteria 1772
47 Ga0081540_1351761 3300005983 Bacteria 504
48 Ga0081539_10000240 3300005985 Bacteria 128629
49 Ga0081539_10108620 3300005985 Bacteria 1401
50 Ga0081539_10260458 3300005985 Unclassified 765
51 Ga0075365_10096086 3300006038 Bacteria 2025
52 Ga0075363_100047319 3300006048 Bacteria 2284
53 Ga0075364_10048121 3300006051 Bacteria 2778
54 Ga0070712_100003085 3300006175 Bacteria 10292
55 Ga0075367_10232766 3300006178 Bacteria 1154
56 Ga0075369_10015178 3300006186 Bacteria 3088
57 Ga0075369_10509524 3300006186 Unclassified 572
58 Ga0075366_10032718 3300006195 Bacteria 3061
59 Ga0075366_10121127 3300006195 Bacteria 1577
60 Ga0075370_10023431 3300006353 Bacteria 3400
61 Ga0075434_100539355 3300006871 Bacteria 1186
62 Ga0075435_100182982 3300007076 Bacteria 1771
63 Ga0105245_10382127 3300009098 Bacteria 1402
64 Ga0105247_10083448 3300009101 Bacteria 2018
65 Ga0114129_10795064 3300009147 Bacteria 1207
66 Ga0105241_10192728 3300009174 Bacteria 1697
67 Ga0105248_10070755 3300009177 Bacteria 3918
68 Ga0105248_10784895 3300009177 Bacteria 1075
69 Ga0105237_10149853 3300009545 Bacteria 2329
70 Ga0105237_10194197 3300009545 Bacteria 2029
71 Ga0105237_10605704 3300009545 Bacteria 1102
72 Ga0105249_10582758 3300009553 Bacteria 1172
73 Ga0105249_12337393 3300009553 Bacteria 607
74 Ga0105239_10290900 3300010375 Bacteria 1840
75 Ga0157371_10083920 3300013102 Bacteria 2256
76 Ga0157370_10010394 3300013104 Bacteria 9813
77 Ga0157370_10284336 3300013104 Bacteria 1528
78 Ga0157374_10123698 3300013296 Bacteria 2499
79 Ga0157374_11106858 3300013296 Bacteria 813
80 Ga0157372_10141182 3300013307 Bacteria 2775
81 Ga0157372_10161049 3300013307 Bacteria 2594
82 Ga0157372_10214215 3300013307 Bacteria 2232
83 Ga0213874_10293681 3300021377 Bacteria 610
84 Ga0213875_10000033 3300021388 Bacteria 170944
85 Ga0207710_10070737 3300025900 Bacteria 1599
86 Ga0207699_10007297 3300025906 Bacteria 5400
87 Ga0207699_10050884 3300025906 Bacteria 2445
88 Ga0207707_10012070 3300025912 Bacteria 7514
89 Ga0207695_10229657 3300025913 Unclassified 1761
90 Ga0207671_10056441 3300025914 Bacteria 2910
91 Ga0207671_10173096 3300025914 Bacteria 1677
92 Ga0207693_10016678 3300025915 Bacteria 5867
93 Ga0207663_10017022 3300025916 Bacteria 4042
94 Ga0207660_10049148 3300025917 Bacteria 2988
95 Ga0207652_10031827 3300025921 Bacteria 4430
96 Ga0207694_10058444 3300025924 Bacteria 2999
97 Ga0207659_11050091 3300025926 Bacteria 701
98 Ga0207687_10338479 3300025927 Bacteria 1223
99 Ga0207700_10028811 3300025928 Bacteria 3912
100 Ga0207700_10652205 3300025928 Bacteria 938
101 Ga0207664_11844613 3300025929 Bacteria 527
102 Ga0207661_12109519 3300025944 Unclassified 510
103 Ga0207667_10247774 3300025949 Bacteria 1823
104 Ga0207667_10366144 3300025949 Bacteria 1470
105 Ga0207712_10674077 3300025961 Bacteria 900
106 Ga0207703_10222946 3300026035 Bacteria 1687
107 Ga0207703_10719665 3300026035 Unclassified 950
108 Ga0207703_11168932 3300026035 Bacteria 740
109 Ga0207703_12065386 3300026035 Unclassified 546
110 Ga0207639_10478480 3300026041 Bacteria 1135
111 Ga0207678_10309444 3300026067 Bacteria 1358
112 Ga0207698_10765234 3300026142 Bacteria 965
113 Ga0268266_11157895 3300028379 Bacteria 748
114 Ga0268265_10895879 3300028380 Bacteria 871
115 Ga0307511_10028720 3300030521 Bacteria 5040
116 Ga0265339_10332617 3300031249 Bacteria 719
117 Ga0265327_10528905 3300031251 Unclassified 507
118 Ga0307508_10366085 3300031616 Bacteria 1032
119 Ga0265314_10007614 3300031711 Bacteria 9375
120 Ga0265342_10490019 3300031712 Bacteria 628
121 Ga0316576_10638897 3300031727 Bacteria 775
122 Ga0307412_10124406 3300031911 Bacteria 1862
123 Ga0307412_10952373 3300031911 Bacteria 756
124 Ga0307411_10960866 3300032005 Bacteria 763
125 Ga0307507_10036282 3300033179 Bacteria 5043
126 Ga0307510_10186317 3300033180 Bacteria 1630
127 Ga0373934_0108336 3300035086 Unclassified 1126
128 Ga0373943_0023009 3300035170 Bacteria 2894
129 Ga0373931_0149231 3300035691 Bacteria 1361
130 Ga0373935_0041408 3300035692 Bacteria 2893
131 Ga0373935_1197007 3300035692 Bacteria 566
132 Ga0373927_0015435 3300035695 Bacteria 5047
133 Ga0373933_0618761 3300035724 Unclassified 711
134 Ga0373947_0633847 3300035725 Bacteria 729
135 Ga0373937_0282884 3300036401 Unclassified 1566
136 Ga0373925_0162125 3300037068 Bacteria 1762
137 Ga0395905_0980694 3300037471 Bacteria 748
138 Ga0436364_0820133 3300037853 Bacteria 27662
139 Ga0436363_1185974 3300039450 Unclassified 819
140 Ga0439465_0105583 3300041413 Bacteria 976
141 Ga0439465_0430073 3300041413 Bacteria 505
142 Ga0451793_0109758 3300041452 Unclassified 608
143 Ga0451851_1080746 3300041507 Bacteria 760
144 Ga0439432_041919 3300042006 Bacteria 1448
145 Ga0439449_0017724 3300042007 Bacteria 2673
146 Ga0439454_079708 3300042011 Bacteria 592
147 Ga0450920_134052 3300042122 Bacteria 523
148 Ga0466965_0010560 3300044683 Bacteria 4314
149 Ga0466960_0265392 3300044901 Bacteria 958
150 Ga0466967_0212926 3300045976 Bacteria 1833
151 Ga0466967_0368315 3300045976 Bacteria 1393
152 Ga0495653_0178824 3300046463 Unclassified 1458
153 Ga0495650_0068843 3300046471 Bacteria 1395
154 Ga0495664_0671737 3300046477 Bacteria 613
155 Ga0495596_0232396 3300046500 Bacteria 716
156 Ga0495622_0203553 3300046557 Bacteria 881
157 Ga0495668_0069449 3300046616 Bacteria 1937
158 Ga0495669_0099797 3300046684 Bacteria 1348
159 Ga0495613_0004805 3300046689 Bacteria 10137
160 Ga0495589_0253310 3300046794 Bacteria 822
161 Ga0495672_0330808 3300047320 Bacteria 713
162 Ga0495680_0587679 3300047322 Unclassified 746
163 Ga0495684_0057526 3300047471 Unclassified 2963
164 Ga0495686_0050311 3300047472 Bacteria 2619
165 Ga0496100_1121696 3300048903 Bacteria 620
166 Ga0496106_0005958 3300048909 Bacteria 9002
167 Ga0496116_0103956 3300048919 Bacteria 1689
168 Ga0496117_0040193 3300048920 Bacteria 3444
169 Ga0496118_0008021 3300048921 Bacteria 11029
170 Ga0496120_0114346 3300048923 Bacteria 1405
171 Ga0496121_0000555 3300048924 Bacteria 70509
172 Ga0496121_0143467 3300048924 Bacteria 1768
173 Ga0496121_0581376 3300048924 Bacteria 695
174 Ga0496124_0001875 3300048927 Bacteria 28930
175 Ga0496125_0099764 3300048928 Bacteria 2143
176 Ga0496125_0116882 3300048928 Bacteria 1914
177 Ga0496126_0032208 3300048929 Bacteria 4941
178 Ga0496126_0132729 3300048929 Bacteria 2150
179 Ga0496126_0290535 3300048929 Bacteria 1352
180 Ga0496126_0416549 3300048929 Bacteria 1087
181 Ga0501031_0096519 3300049568 Bacteria 1929
182 Ga0501031_0201880 3300049568 Bacteria 1297
183 Ga0501031_0260697 3300049568 Bacteria 1126
184 Ga0501032_0074277 3300049569 Bacteria 2266
185 Ga0501032_0171535 3300049569 Bacteria 1422
186 Ga0501033_0103629 3300049570 Bacteria 2074
187 Ga0501034_0114349 3300049571 Bacteria 2687
188 Ga0501034_0734069 3300049571 Bacteria 884
189 Ga0501036_0146361 3300049572 Bacteria 1993
190 Ga0501036_0155995 3300049572 Bacteria 1925
191 Ga0501036_0397522 3300049572 Bacteria 1150
192 Ga0501036_0656612 3300049572 Bacteria 868
193 Ga0501037_0210326 3300049573 Bacteria 1372
194 Ga0501037_0388325 3300049573 Bacteria 959
195 Ga0501038_0004921 3300049574 Bacteria 12407
196 Ga0501038_0132506 3300049574 Bacteria 2044
197 Ga0501038_0663933 3300049574 Unclassified 784
198 Ga0501039_0104980 3300049575 Bacteria 2206
199 Ga0501039_0613847 3300049575 Bacteria 852
200 Ga0501043_0027478 3300049579 Bacteria 4467
201 Ga0501043_0175072 3300049579 Bacteria 1673
202 Ga0501047_0032942 3300049581 Bacteria 5003
203 Ga0501047_0644234 3300049581 Bacteria 879
204 Ga0501048_0613967 3300049582 Bacteria 781
205 Ga0501067_0078272 3300049583 Bacteria 1832
206 Ga0501068_0934296 3300049584 Bacteria 571
207 Ga0501069_0423729 3300049585 Bacteria 789
208 Ga0501069_1044608 3300049585 Bacteria 500
209 Ga0501070_0037815 3300049586 Bacteria 4028
210 Ga0501070_0060240 3300049586 Bacteria 3147
211 Ga0501070_0562721 3300049586 Bacteria 912
212 Ga0501070_0796263 3300049586 Unclassified 742
213 Ga0501070_0970496 3300049586 Bacteria 660
214 Ga0501073_0036600 3300049589 Bacteria 3487
215 Ga0501073_0041366 3300049589 Bacteria 3257
216 Ga0501073_0070584 3300049589 Bacteria 2433
217 Ga0501074_0947152 3300049590 Bacteria 606
218 Ga0501079_0633606 3300049741 Bacteria 842
219 Ga0501080_0139705 3300049742 Bacteria 2240
220 Ga0501080_0343075 3300049742 Bacteria 1349
221 Ga0501080_0366225 3300049742 Bacteria 1300
222 Ga0501080_0438277 3300049742 Bacteria 1172
223 Ga0501080_1093940 3300049742 Bacteria 688
224 Ga0501080_1165913 3300049742 Unclassified 663
225 Ga0501083_0335142 3300049744 Bacteria 984
226 Ga0501035_0019669 3300049822 Bacteria 6205
227 Ga0501035_0175868 3300049822 Bacteria 1846
228 Ga0501035_0292908 3300049822 Bacteria 1373
229 Ga0501044_0109145 3300049823 Bacteria 2776
230 Ga0501044_0657535 3300049823 Bacteria 936
231 Ga0501045_0172751 3300049824 Bacteria 1610
232 nmdc:mga03n38_13988_c1 3300050490 Bacteria 3064
233 nmdc:mga00v17_13666_c1 3300050491 Bacteria 4513
234 nmdc:mga00v17_264855_c1 3300050491 Bacteria 1115
235 nmdc:mga0yw44_34836_c1 3300050492 Bacteria 2953
236 nmdc:mga0k408_13948_c1 3300050493 Bacteria 4417
237 nmdc:mga0k408_26086_c1 3300050493 Bacteria 3312
238 nmdc:mga0k408_417549_c1 3300050493 Bacteria 798
239 nmdc:mga06z11_321515_c1 3300050494 Bacteria 923
240 nmdc:mga07m45_25662_c1 3300050496 Bacteria 3234
241 nmdc:mga05p37_234346_c1 3300050507 Bacteria 1505
242 nmdc:mga0sz30_2656_c1 3300050516 Bacteria 6376
243 nmdc:mga0sz30_459662_c1 3300050516 Unclassified 572
244 Ga0495619_1143328 3300053085 Bacteria 517
245 Ga0500566_0080965 3300053094 Bacteria 1807
246 Ga0500608_300762 3300053122 Bacteria 595
247 Ga0500559_0022639 3300053136 Bacteria 2665
248 Ga0500564_212367 3300053138 Bacteria 788
249 Ga0500573_0015381 3300053140 Bacteria 4336
250 Ga0500590_132528 3300053148 Bacteria 1151
251 Ga0500590_229721 3300053148 Bacteria 757
252 Ga0500619_041202 3300053154 Bacteria 1460
253 Ga0500638_157206 3300053162 Bacteria 1004
254 Ga0500639_085314 3300053163 Bacteria 1583
255 Ga0500636_0022276 3300053177 Bacteria 3749
256 Ga0500636_0366330 3300053177 Bacteria 681
257 Ga0500637_0121448 3300053178 Bacteria 1515
258 Ga0500552_003271 3300053733 Bacteria 1635
259 Ga0500596_001978 3300053735 Bacteria 4103
260 Ga0501082_0442185 3300060353 Bacteria 1136
261 Ga0530510_0056740 3300061734 Bacteria 2830
262 2514013892 2513237161 Bacteria 8871253
263 2753766795 2751185897 Bacteria 5322941
264 2861693267 2861691609 Bacteria 5628931
265 2902333362 2902330777 Bacteria 6395352
266 2906626802 2906626472 Bacteria 8826946
267 Ga0163163_12738229
268 JGI25406J46586_10000203
269 rootH1_10116761
270 rootL2_10213157
271 rootH1_10079275
272 JGI25404J52841_10012713
273 JGI25404J52841_10037963
274 JGI25404J52841_10143521
275 JGI25405J52794_10027940
276 Ga0070683_100909947
277 Ga0070680_100010517
278 Ga0070682_101296361
279 Ga0070675_101134837
280 Ga0070671_101924950
281 Ga0070688_101440972
282 Ga0070667_100520716
283 Ga0070709_10007835
284 Ga0070709_10018322
285 Ga0070714_100461971
286 Ga0070713_100204791
287 Ga0070711_100007360
288 Ga0070663_100573574
289 Ga0070681_10007484
290 Ga0070679_100004568
291 Ga0070684_100428229
292 Ga0068853_100841097
293 Ga0068853_101388918
294 Ga0070693_101386244
295 Ga0068855_100655804
296 Ga0070664_100536360
297 Ga0068854_100242153
298 Ga0068856_101879675
299 Ga0070702_100484064
300 Ga0068852_101123508
301 Ga0068858_100301610
302 Ga0068858_100869375
303 Ga0068858_100905366
304 Ga0068860_100809939
305 Ga0068862_100393410
306 Ga0068862_102007773
307 Ga0081455_10074810
308 Ga0081540_1003408
309 Ga0081540_1008546
310 Ga0081540_1032176
311 Ga0081540_1062343
312 Ga0081540_1351761
313 Ga0081539_10000240
314 Ga0081539_10108620
315 Ga0081539_10260458
316 Ga0075365_10096086
317 Ga0075363_100047319
318 Ga0075364_10048121
319 Ga0070712_100003085
320 Ga0075367_10232766
321 Ga0075369_10015178
322 Ga0075369_10509524
323 Ga0075366_10032718
324 Ga0075366_10121127
325 Ga0075370_10023431
326 Ga0075434_100539355
327 Ga0075435_100182982
328 Ga0105245_10382127
329 Ga0105247_10083448
330 Ga0114129_10795064
331 Ga0105241_10192728
332 Ga0105248_10070755
333 Ga0105248_10784895
334 Ga0105237_10149853
335 Ga0105237_10194197
336 Ga0105237_10605704
337 Ga0105249_10582758
338 Ga0105249_12337393
339 Ga0105239_10290900
340 Ga0157371_10083920
341 Ga0157370_10010394
342 Ga0157370_10284336
343 Ga0157374_10123698
344 Ga0157374_11106858
345 Ga0157372_10141182
346 Ga0157372_10161049
347 Ga0157372_10214215
348 Ga0213874_10293681
349 Ga0213875_10000033
350 Ga0207710_10070737
351 Ga0207699_10007297
352 Ga0207699_10050884
353 Ga0207707_10012070
354 Ga0207695_10229657
355 Ga0207671_10056441
356 Ga0207671_10173096
357 Ga0207693_10016678
358 Ga0207663_10017022
359 Ga0207660_10049148
360 Ga0207652_10031827
361 Ga0207694_10058444
362 Ga0207659_11050091
363 Ga0207687_10338479
364 Ga0207700_10028811
365 Ga0207700_10652205
366 Ga0207664_11844613
367 Ga0207661_12109519
368 Ga0207667_10247774
369 Ga0207667_10366144
370 Ga0207712_10674077
371 Ga0207703_10222946
372 Ga0207703_10719665
373 Ga0207703_11168932
374 Ga0207703_12065386
375 Ga0207639_10478480
376 Ga0207678_10309444
377 Ga0207698_10765234
378 Ga0268266_11157895
379 Ga0268265_10895879
380 Ga0307511_10028720
381 Ga0265339_10332617
382 Ga0265327_10528905
383 Ga0307508_10366085
384 Ga0265314_10007614
385 Ga0265342_10490019
386 Ga0316576_10638897
387 Ga0307412_10124406
388 Ga0307412_10952373
389 Ga0307411_10960866
390 Ga0307507_10036282
391 Ga0307510_10186317
392 Ga0373934_0108336
393 Ga0373943_0023009
394 Ga0373931_0149231
395 Ga0373935_0041408
396 Ga0373935_1197007
397 Ga0373927_0015435
398 Ga0373933_0618761
399 Ga0373947_0633847
400 Ga0373937_0282884
401 Ga0373925_0162125
402 Ga0395905_0980694
403 Ga0436364_0820133
404 Ga0436363_1185974
405 Ga0439465_0105583
406 Ga0439465_0430073
407 Ga0451793_0109758
408 Ga0451851_1080746
409 Ga0439432_041919
410 Ga0439449_0017724
411 Ga0439454_079708
412 Ga0450920_134052
413 Ga0466965_0010560
414 Ga0466960_0265392
415 Ga0466967_0212926
416 Ga0466967_0368315
417 Ga0495653_0178824
418 Ga0495650_0068843
419 Ga0495664_0671737
420 Ga0495596_0232396
421 Ga0495622_0203553
422 Ga0495668_0069449
423 Ga0495669_0099797
424 Ga0495613_0004805
425 Ga0495589_0253310
426 Ga0495672_0330808
427 Ga0495680_0587679
428 Ga0495684_0057526
429 Ga0495686_0050311
430 Ga0496100_1121696
431 Ga0496106_0005958
432 Ga0496116_0103956
433 Ga0496117_0040193
434 Ga0496118_0008021
435 Ga0496120_0114346
436 Ga0496121_0000555
437 Ga0496121_0143467
438 Ga0496121_0581376
439 Ga0496124_0001875
440 Ga0496125_0099764
441 Ga0496125_0116882
442 Ga0496126_0032208
443 Ga0496126_0132729
444 Ga0496126_0290535
445 Ga0496126_0416549
446 Ga0501031_0096519
447 Ga0501031_0201880
448 Ga0501031_0260697
449 Ga0501032_0074277
450 Ga0501032_0171535
451 Ga0501033_0103629
452 Ga0501034_0114349
453 Ga0501034_0734069
454 Ga0501036_0146361
455 Ga0501036_0155995
456 Ga0501036_0397522
457 Ga0501036_0656612
458 Ga0501037_0210326
459 Ga0501037_0388325
460 Ga0501038_0004921
461 Ga0501038_0132506
462 Ga0501038_0663933
463 Ga0501039_0104980
464 Ga0501039_0613847
465 Ga0501043_0027478
466 Ga0501043_0175072
467 Ga0501047_0032942
468 Ga0501047_0644234
469 Ga0501048_0613967
470 Ga0501067_0078272
471 Ga0501068_0934296
472 Ga0501069_0423729
473 Ga0501069_1044608
474 Ga0501070_0037815
475 Ga0501070_0060240
476 Ga0501070_0562721
477 Ga0501070_0796263
478 Ga0501070_0970496
479 Ga0501073_0036600
480 Ga0501073_0041366
481 Ga0501073_0070584
482 Ga0501074_0947152
483 Ga0501079_0633606
484 Ga0501080_0139705
485 Ga0501080_0343075
486 Ga0501080_0366225
487 Ga0501080_0438277
488 Ga0501080_1093940
489 Ga0501080_1165913
490 Ga0501083_0335142
491 Ga0501035_0019669
492 Ga0501035_0175868
493 Ga0501035_0292908
494 Ga0501044_0109145
495 Ga0501044_0657535
496 Ga0501045_0172751
497 nmdc:mga03n38_13988_c1
498 nmdc:mga00v17_13666_c1
499 nmdc:mga00v17_264855_c1
500 nmdc:mga0yw44_34836_c1
501 nmdc:mga0k408_13948_c1
502 nmdc:mga0k408_26086_c1
503 nmdc:mga0k408_417549_c1
504 nmdc:mga06z11_321515_c1
505 nmdc:mga07m45_25662_c1
506 nmdc:mga05p37_234346_c1
507 nmdc:mga0sz30_2656_c1
508 nmdc:mga0sz30_459662_c1
509 Ga0495619_1143328
510 Ga0500566_0080965
511 Ga0500608_300762
512 Ga0500559_0022639
513 Ga0500564_212367
514 Ga0500573_0015381
515 Ga0500590_132528
516 Ga0500590_229721
517 Ga0500619_041202
518 Ga0500638_157206
519 Ga0500639_085314
520 Ga0500636_0022276
521 Ga0500636_0366330
522 Ga0500637_0121448
523 Ga0500552_003271
524 Ga0500596_001978
525 Ga0501082_0442185
526 Ga0530510_0056740
527 2514013892
528 2753766795
529 2861693267
530 2902333362
531 2906626802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02661

Fic

Fic/DOC family

6

86

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.9313 5 128
3dd7-assembly1.cif.gz_A structure of doch66y in complex with the c-terminal domain of phd 0.9286 5 128
3k33-assembly1.cif.gz_A-2 crystal structure of the phd-doc complex 0.9255 5 127
3kh2-assembly2.cif.gz_C crystal structure of the p1 bacteriophage doc toxin (f68s) in complex with the phd antitoxin (l17m/v39a). northeast structural genomics targets er385-er386 0.9246 5 128
3dd7-assembly2.cif.gz_C structure of doch66y in complex with the c-terminal domain of phd 0.9169 5 128
ID Description Score Start End Superfamily
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.9313 5 128 1.20.120.1870
3dd7C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Fic/DOC protein, Fido domain 0.9169 5 128 1.20.120.1870
3dd9D01 Mainly Alpha;Orthogonal Bundle;PTS-regulatory domain, PRD; 0.8441 71 129 1.10.1790.50
5jj6B02 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.7282 6 126 1.10.3290.10
3cucA00 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.6818 33 126 1.10.3290.10
ID Description Score Start End GO Terms
AF-A0A2V8P2D7-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9946 1 92 GO:0016301
AF-A0A7Y5VIC0-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9868 2 128 GO:0016301
AF-A0A222SIM5-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9857 2 128 GO:0016301
AF-A0A537MXZ6-F1-model_v4 Type II toxin-antitoxin system death-on-curing family toxin 0.9844 1 128 GO:0016301
AF-A0A1E3G7H3-F1-model_v4 deleted 0.9836 5 126

Map