F373252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 265 | 136 | 530 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10211319|Ga0099794_102113191 |
| Length | 301 |
| Sequence | LAATRREFVRPSLVRSGGKAILSVAILDQQKVPYEGRRHRTQARLRRGVFLLPAAMTSANLLCGYYAVIASLMGTPDDFNHAAKAIGIAIVFDSLDGRIARMTGTNTEFGVQFDSLADVVSFGIAPAVLAYAWGVRSVSNLAPDALHQLGRFGWLCCLAFLICCAWRLARFNVQGMAPGGSKFFVGMPTPAAAGVIASIVHAFHAGGPLGDWRWSIPWLFLAVALAGLMTSTIRFYSFKDLPWGKKQPGVLILILLVFLAIVWNYSEISLLLIACSYAVAGVTLHIVRYARQHSASRTAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 2 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 3 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 4 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 27 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 28 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 29 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 30 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 37 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 41 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 55 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 58 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 59 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 60 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 62 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 64 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 65 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 66 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 67 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 68 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 69 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 70 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 71 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 72 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 73 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 74 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 75 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 76 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 77 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 78 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 79 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 80 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 81 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 82 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 83 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 85 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 86 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 87 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 88 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 89 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 131 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 1.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.51 |
| Rhizosphere | 98.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099794_10211319 | 3300007265 | Bacteria | 995 |
| 2 | Ga0070703_10001067 | 3300005406 | Bacteria | 8540 |
| 3 | Ga0070709_10009226 | 3300005434 | Bacteria | 5431 |
| 4 | Ga0070709_10132159 | 3300005434 | Unclassified | 1705 |
| 5 | Ga0070714_100212457 | 3300005435 | Bacteria | 1774 |
| 6 | Ga0070713_100097557 | 3300005436 | Unclassified | 2540 |
| 7 | Ga0070710_10212215 | 3300005437 | Bacteria | 1228 |
| 8 | Ga0070711_100025596 | 3300005439 | Unclassified | 3862 |
| 9 | Ga0070711_100056495 | 3300005439 | Bacteria | 2714 |
| 10 | Ga0070711_100122965 | 3300005439 | Unclassified | 1922 |
| 11 | Ga0070711_100308348 | 3300005439 | Bacteria | 1261 |
| 12 | Ga0070705_100004414 | 3300005440 | Bacteria | 6852 |
| 13 | Ga0070694_100008720 | 3300005444 | Bacteria | 6210 |
| 14 | Ga0070708_100006712 | 3300005445 | Bacteria | 9164 |
| 15 | Ga0070708_100008450 | 3300005445 | Bacteria | 8266 |
| 16 | Ga0070708_100111875 | 3300005445 | Bacteria | 2511 |
| 17 | Ga0070708_100126444 | 3300005445 | Unclassified | 2363 |
| 18 | Ga0070708_100492254 | 3300005445 | Unclassified | 1157 |
| 19 | Ga0070706_100011102 | 3300005467 | Bacteria | 8365 |
| 20 | Ga0070706_100034350 | 3300005467 | Bacteria | 4684 |
| 21 | Ga0070707_100000355 | 3300005468 | Bacteria | 45006 |
| 22 | Ga0070707_100001301 | 3300005468 | Bacteria | 24512 |
| 23 | Ga0070707_100136497 | 3300005468 | Unclassified | 2386 |
| 24 | Ga0070707_100388796 | 3300005468 | Unclassified | 1355 |
| 25 | Ga0070698_100000499 | 3300005471 | Bacteria | 41776 |
| 26 | Ga0070698_100031148 | 3300005471 | Bacteria | 5530 |
| 27 | Ga0070698_100052978 | 3300005471 | Bacteria | 4125 |
| 28 | Ga0070698_100236596 | 3300005471 | Bacteria | 1759 |
| 29 | Ga0070699_100142576 | 3300005518 | Bacteria | 2117 |
| 30 | Ga0070699_100464507 | 3300005518 | Bacteria | 1148 |
| 31 | Ga0070697_100000780 | 3300005536 | Bacteria | 23901 |
| 32 | Ga0070697_100061744 | 3300005536 | Bacteria | 3057 |
| 33 | Ga0070697_100162420 | 3300005536 | Bacteria | 1887 |
| 34 | Ga0070697_100272741 | 3300005536 | Unclassified | 1450 |
| 35 | Ga0070695_100015162 | 3300005545 | Unclassified | 4652 |
| 36 | Ga0070695_100123828 | 3300005545 | Bacteria | 1773 |
| 37 | Ga0070695_100206461 | 3300005545 | Bacteria | 1407 |
| 38 | Ga0070696_100001229 | 3300005546 | Bacteria | 16617 |
| 39 | Ga0070693_100000056 | 3300005547 | Bacteria | 43765 |
| 40 | Ga0070704_100023293 | 3300005549 | Unclassified | 4041 |
| 41 | Ga0068859_100130885 | 3300005617 | Unclassified | 2581 |
| 42 | Ga0068863_100002559 | 3300005841 | Bacteria | 18054 |
| 43 | Ga0070717_10138173 | 3300006028 | Unclassified | 2100 |
| 44 | Ga0070716_100001156 | 3300006173 | Bacteria | 11636 |
| 45 | Ga0070716_100006010 | 3300006173 | Bacteria | 5912 |
| 46 | Ga0070716_100085722 | 3300006173 | Unclassified | 1893 |
| 47 | Ga0070712_100023316 | 3300006175 | Bacteria | 4087 |
| 48 | Ga0070712_100117573 | 3300006175 | Unclassified | 1995 |
| 49 | Ga0097621_100004419 | 3300006237 | Bacteria | 9786 |
| 50 | Ga0068871_100001378 | 3300006358 | Bacteria | 16262 |
| 51 | Ga0075433_10477794 | 3300006852 | Unclassified | 1098 |
| 52 | Ga0075434_100014215 | 3300006871 | Bacteria | 7604 |
| 53 | Ga0075434_100167875 | 3300006871 | Bacteria | 2214 |
| 54 | Ga0068865_100076562 | 3300006881 | Unclassified | 2388 |
| 55 | Ga0075436_100000904 | 3300006914 | Bacteria | 19720 |
| 56 | Ga0075436_100002915 | 3300006914 | Bacteria | 11731 |
| 57 | Ga0075436_100036246 | 3300006914 | Bacteria | 3404 |
| 58 | Ga0097620_100130886 | 3300006931 | Unclassified | 2581 |
| 59 | Ga0099794_10001567 | 3300007265 | Bacteria | 8053 |
| 60 | Ga0099794_10002519 | 3300007265 | Bacteria | 6770 |
| 61 | Ga0099794_10009325 | 3300007265 | Unclassified | 4121 |
| 62 | Ga0099794_10023719 | 3300007265 | Unclassified | 2810 |
| 63 | Ga0099794_10026195 | 3300007265 | Bacteria | 2694 |
| 64 | Ga0099794_10028064 | 3300007265 | Bacteria | 2615 |
| 65 | Ga0099794_10039177 | 3300007265 | Unclassified | 2248 |
| 66 | Ga0099794_10101145 | 3300007265 | Unclassified | 1439 |
| 67 | Ga0099794_10124672 | 3300007265 | Unclassified | 1298 |
| 68 | Ga0099794_10145779 | 3300007265 | Unclassified | 1200 |
| 69 | Ga0105240_10030367 | 3300009093 | Bacteria | 7024 |
| 70 | Ga0105240_10078348 | 3300009093 | Bacteria | 4070 |
| 71 | Ga0105240_10279208 | 3300009093 | Bacteria | 1920 |
| 72 | Ga0105245_10334157 | 3300009098 | Unclassified | 1496 |
| 73 | Ga0105242_10032004 | 3300009176 | Unclassified | 4204 |
| 74 | Ga0105237_10253729 | 3300009545 | Unclassified | 1761 |
| 75 | Ga0099796_10022421 | 3300010159 | Unclassified | 1958 |
| 76 | Ga0157378_10006324 | 3300013297 | Bacteria | 10375 |
| 77 | Ga0157378_10242675 | 3300013297 | Bacteria | 1722 |
| 78 | Ga0157378_10405213 | 3300013297 | Bacteria | 1345 |
| 79 | Ga0163163_10759133 | 3300014325 | Unclassified | 1033 |
| 80 | Ga0157376_10000065 | 3300014969 | Bacteria | 86390 |
| 81 | Ga0157376_10002628 | 3300014969 | Bacteria | 12219 |
| 82 | Ga0228598_1008332 | 3300024227 | Unclassified | 2096 |
| 83 | Ga0207685_10031017 | 3300025905 | Unclassified | 1910 |
| 84 | Ga0207699_10019807 | 3300025906 | Unclassified | 3596 |
| 85 | Ga0207684_10027283 | 3300025910 | Unclassified | 4868 |
| 86 | Ga0207684_10161372 | 3300025910 | Bacteria | 1930 |
| 87 | Ga0207684_10262162 | 3300025910 | Bacteria | 1491 |
| 88 | Ga0207695_10028829 | 3300025913 | Bacteria | 6145 |
| 89 | Ga0207695_10167575 | 3300025913 | Bacteria | 2124 |
| 90 | Ga0207695_10230353 | 3300025913 | Bacteria | 1757 |
| 91 | Ga0207671_10129294 | 3300025914 | Bacteria | 1937 |
| 92 | Ga0207693_10007765 | 3300025915 | Bacteria | 8801 |
| 93 | Ga0207693_10073916 | 3300025915 | Unclassified | 2669 |
| 94 | Ga0207693_10147686 | 3300025915 | Unclassified | 1849 |
| 95 | Ga0207663_10028176 | 3300025916 | Unclassified | 3285 |
| 96 | Ga0207646_10000019 | 3300025922 | Bacteria | 282855 |
| 97 | Ga0207646_10001138 | 3300025922 | Bacteria | 33952 |
| 98 | Ga0207646_10002323 | 3300025922 | Bacteria | 22527 |
| 99 | Ga0207646_10048409 | 3300025922 | Bacteria | 3810 |
| 100 | Ga0207646_10077974 | 3300025922 | Unclassified | 2961 |
| 101 | Ga0207700_10010704 | 3300025928 | Bacteria | 5806 |
| 102 | Ga0207700_10077680 | 3300025928 | Unclassified | 2580 |
| 103 | Ga0207700_10315960 | 3300025928 | Bacteria | 1352 |
| 104 | Ga0207665_10000807 | 3300025939 | Bacteria | 21194 |
| 105 | Ga0207665_10001199 | 3300025939 | Bacteria | 17472 |
| 106 | Ga0207665_10009276 | 3300025939 | Bacteria | 6460 |
| 107 | Ga0207665_10040825 | 3300025939 | Bacteria | 3097 |
| 108 | Ga0207665_10208609 | 3300025939 | Unclassified | 1426 |
| 109 | Ga0207641_10008001 | 3300026088 | Bacteria | 8763 |
| 110 | Ga0209179_1021897 | 3300027512 | Unclassified | 1251 |
| 111 | Ga0209588_1008225 | 3300027671 | Bacteria | 3086 |
| 112 | Ga0265354_1000545 | 3300028016 | Bacteria | 6449 |
| 113 | Ga0268266_10001200 | 3300028379 | Bacteria | 31990 |
| 114 | Ga0268264_10186871 | 3300028381 | Bacteria | 1886 |
| 115 | Ga0265319_1000299 | 3300028563 | Bacteria | 36801 |
| 116 | Ga0265318_10000331 | 3300028577 | Bacteria | 37665 |
| 117 | Ga0265338_10004549 | 3300028800 | Bacteria | 18670 |
| 118 | Ga0265338_10053884 | 3300028800 | Unclassified | 3593 |
| 119 | Ga0265762_1010181 | 3300030760 | Bacteria | 1679 |
| 120 | Ga0265770_1000923 | 3300030878 | Bacteria | 4072 |
| 121 | Ga0265760_10014725 | 3300031090 | Unclassified | 2242 |
| 122 | Ga0265760_10039924 | 3300031090 | Unclassified | 1397 |
| 123 | Ga0265332_10051601 | 3300031238 | Archaea | 1766 |
| 124 | Ga0265320_10000031 | 3300031240 | Bacteria | 147045 |
| 125 | Ga0265320_10065847 | 3300031240 | Bacteria | 1719 |
| 126 | Ga0265325_10002286 | 3300031241 | Bacteria | 12998 |
| 127 | Ga0265325_10015806 | 3300031241 | Bacteria | 4234 |
| 128 | Ga0265325_10059979 | 3300031241 | Bacteria | 1934 |
| 129 | Ga0265325_10159024 | 3300031241 | Bacteria | 1064 |
| 130 | Ga0265329_10001565 | 3300031242 | Bacteria | 10951 |
| 131 | Ga0265339_10043761 | 3300031249 | Archaea | 2473 |
| 132 | Ga0265331_10000039 | 3300031250 | Bacteria | 194439 |
| 133 | Ga0265331_10013984 | 3300031250 | Bacteria | 4293 |
| 134 | Ga0265316_10003135 | 3300031344 | Bacteria | 16834 |
| 135 | Ga0265316_10012684 | 3300031344 | Bacteria | 7544 |
| 136 | Ga0265342_10002916 | 3300031712 | Bacteria | 14429 |
| 137 | Ga0316212_1004873 | 3300033547 | Unclassified | 1949 |
| 138 | Ga0373926_0020387 | 3300035083 | Unclassified | 2290 |
| 139 | Ga0373934_0001094 | 3300035086 | Bacteria | 9815 |
| 140 | Ga0373953_0012343 | 3300035117 | Unclassified | 3023 |
| 141 | Ga0373954_0000248 | 3300035118 | Bacteria | 19693 |
| 142 | Ga0373956_0005782 | 3300035119 | Unclassified | 4942 |
| 143 | Ga0373946_0021428 | 3300035171 | Bacteria | 2506 |
| 144 | Ga0373955_0004686 | 3300035172 | Bacteria | 6074 |
| 145 | Ga0373955_0027278 | 3300035172 | Unclassified | 2950 |
| 146 | Ga0373931_0042248 | 3300035691 | Unclassified | 2397 |
| 147 | Ga0373935_0010407 | 3300035692 | Bacteria | 5576 |
| 148 | Ga0373927_0005734 | 3300035695 | Bacteria | 8530 |
| 149 | Ga0373927_0009247 | 3300035695 | Bacteria | 6610 |
| 150 | Ga0373933_0001757 | 3300035724 | Bacteria | 12573 |
| 151 | Ga0373937_0000694 | 3300036401 | Bacteria | 29354 |
| 152 | Ga0373937_0045270 | 3300036401 | Bacteria | 4021 |
| 153 | Ga0373925_0001091 | 3300037068 | Bacteria | 24341 |
| 154 | Ga0373925_0520922 | 3300037068 | Archaea | 977 |
| 155 | Ga0451577_0058333 | 3300042876 | Bacteria | 3441 |
| 156 | Ga0451577_0076173 | 3300042876 | Bacteria | 2991 |
| 157 | Ga0451577_0108887 | 3300042876 | Unclassified | 2477 |
| 158 | Ga0453683_0017679 | 3300044673 | Bacteria | 4589 |
| 159 | Ga0453683_0057559 | 3300044673 | Bacteria | 2431 |
| 160 | Ga0453684_0022563 | 3300044712 | Bacteria | 9329 |
| 161 | Ga0453684_0516627 | 3300044712 | Bacteria | 1320 |
| 162 | Ga0451576_0047943 | 3300045051 | Bacteria | 4490 |
| 163 | Ga0495592_0022289 | 3300046454 | Unclassified | 4819 |
| 164 | Ga0495592_0099026 | 3300046454 | Unclassified | 2080 |
| 165 | Ga0495603_0013138 | 3300046455 | Bacteria | 5005 |
| 166 | Ga0495651_0000149 | 3300046462 | Bacteria | 51195 |
| 167 | Ga0495651_0006899 | 3300046462 | Bacteria | 8680 |
| 168 | Ga0495651_0048182 | 3300046462 | Bacteria | 3292 |
| 169 | Ga0495653_0007083 | 3300046463 | Bacteria | 9196 |
| 170 | Ga0495653_0234430 | 3300046463 | Unclassified | 1227 |
| 171 | Ga0495580_0005030 | 3300046472 | Bacteria | 11022 |
| 172 | Ga0495580_0018093 | 3300046472 | Bacteria | 5252 |
| 173 | Ga0495580_0028483 | 3300046472 | Unclassified | 4060 |
| 174 | Ga0495580_0043258 | 3300046472 | Unclassified | 3206 |
| 175 | Ga0495580_0141691 | 3300046472 | Bacteria | 1666 |
| 176 | Ga0495582_0000069 | 3300046473 | Bacteria | 52545 |
| 177 | Ga0495582_0013621 | 3300046473 | Unclassified | 4477 |
| 178 | Ga0495639_0012314 | 3300046475 | Unclassified | 3689 |
| 179 | Ga0495664_0046650 | 3300046477 | Unclassified | 2571 |
| 180 | Ga0495664_0088507 | 3300046477 | Bacteria | 1861 |
| 181 | Ga0495594_0024181 | 3300046499 | Unclassified | 3260 |
| 182 | Ga0495608_0015836 | 3300046511 | Bacteria | 5218 |
| 183 | Ga0495608_0024148 | 3300046511 | Bacteria | 4159 |
| 184 | Ga0495608_0032196 | 3300046511 | Bacteria | 3544 |
| 185 | Ga0495608_0059627 | 3300046511 | Bacteria | 2514 |
| 186 | Ga0495628_0019449 | 3300046516 | Bacteria | 5614 |
| 187 | Ga0495628_0058883 | 3300046516 | Unclassified | 3018 |
| 188 | Ga0495630_0021521 | 3300046517 | Bacteria | 4761 |
| 189 | Ga0495630_0041975 | 3300046517 | Bacteria | 3416 |
| 190 | Ga0495630_0049760 | 3300046517 | Unclassified | 3136 |
| 191 | Ga0495630_0145711 | 3300046517 | Unclassified | 1801 |
| 192 | Ga0495666_0021496 | 3300046526 | Unclassified | 3194 |
| 193 | Ga0495652_0011015 | 3300046529 | Bacteria | 8194 |
| 194 | Ga0495652_0323249 | 3300046529 | Unclassified | 1114 |
| 195 | Ga0495665_0084659 | 3300046531 | Unclassified | 1666 |
| 196 | Ga0495640_0039510 | 3300046533 | Unclassified | 3310 |
| 197 | Ga0495640_0068895 | 3300046533 | Unclassified | 2380 |
| 198 | Ga0495586_0017382 | 3300046535 | Unclassified | 3823 |
| 199 | Ga0495586_0109609 | 3300046535 | Bacteria | 1536 |
| 200 | Ga0495587_0001079 | 3300046536 | Bacteria | 17903 |
| 201 | Ga0495587_0008502 | 3300046536 | Bacteria | 6598 |
| 202 | Ga0495587_0064210 | 3300046536 | Unclassified | 2145 |
| 203 | Ga0495587_0252181 | 3300046536 | Unclassified | 992 |
| 204 | Ga0495645_0054578 | 3300046543 | Bacteria | 2903 |
| 205 | Ga0495645_0057556 | 3300046543 | Bacteria | 2821 |
| 206 | Ga0495645_0116862 | 3300046543 | Unclassified | 1882 |
| 207 | Ga0495622_0032137 | 3300046557 | Unclassified | 2451 |
| 208 | Ga0495622_0132829 | 3300046557 | Unclassified | 1133 |
| 209 | Ga0495667_0001402 | 3300046559 | Bacteria | 15879 |
| 210 | Ga0495667_0003042 | 3300046559 | Bacteria | 11251 |
| 211 | Ga0495667_0064393 | 3300046559 | Unclassified | 2398 |
| 212 | Ga0495667_0116354 | 3300046559 | Unclassified | 1727 |
| 213 | Ga0495634_0072909 | 3300046642 | Unclassified | 2258 |
| 214 | Ga0495634_0107081 | 3300046642 | Bacteria | 1801 |
| 215 | Ga0495635_0022817 | 3300046663 | Unclassified | 4363 |
| 216 | Ga0495657_0006733 | 3300046675 | Bacteria | 8961 |
| 217 | Ga0495657_0053515 | 3300046675 | Unclassified | 2700 |
| 218 | Ga0495599_0002147 | 3300046678 | Bacteria | 11464 |
| 219 | Ga0495623_0007314 | 3300046679 | Bacteria | 7165 |
| 220 | Ga0495623_0071649 | 3300046679 | Bacteria | 2156 |
| 221 | Ga0495646_0003308 | 3300046680 | Bacteria | 10025 |
| 222 | Ga0495647_0013849 | 3300046681 | Unclassified | 2802 |
| 223 | Ga0495658_0033555 | 3300046683 | Unclassified | 2812 |
| 224 | Ga0495613_0016683 | 3300046689 | Bacteria | 5468 |
| 225 | Ga0495624_0031858 | 3300046690 | Unclassified | 3423 |
| 226 | Ga0495624_0058034 | 3300046690 | Unclassified | 2432 |
| 227 | Ga0495600_0076467 | 3300046809 | Bacteria | 2186 |
| 228 | Ga0495600_0099814 | 3300046809 | Bacteria | 1892 |
| 229 | Ga0495581_0136775 | 3300047315 | Unclassified | 1428 |
| 230 | Ga0495604_0000240 | 3300047317 | Bacteria | 49111 |
| 231 | Ga0495604_0284671 | 3300047317 | Unclassified | 1115 |
| 232 | Ga0495674_0003091 | 3300047319 | Bacteria | 16177 |
| 233 | Ga0495674_0028892 | 3300047319 | Bacteria | 5051 |
| 234 | Ga0495674_0072346 | 3300047319 | Unclassified | 2974 |
| 235 | Ga0495674_0081799 | 3300047319 | Unclassified | 2769 |
| 236 | Ga0495674_0091367 | 3300047319 | Unclassified | 2600 |
| 237 | Ga0495674_0149803 | 3300047319 | Bacteria | 1957 |
| 238 | Ga0495680_0000912 | 3300047322 | Bacteria | 32793 |
| 239 | Ga0495680_0011542 | 3300047322 | Bacteria | 7816 |
| 240 | Ga0495680_0036623 | 3300047322 | Unclassified | 3938 |
| 241 | Ga0495680_0058070 | 3300047322 | Bacteria | 2991 |
| 242 | Ga0495675_0001129 | 3300047444 | Bacteria | 16229 |
| 243 | Ga0495675_0004677 | 3300047444 | Bacteria | 8313 |
| 244 | Ga0495675_0034405 | 3300047444 | Bacteria | 3235 |
| 245 | Ga0495684_0002915 | 3300047471 | Bacteria | 13470 |
| 246 | Ga0495684_0005011 | 3300047471 | Bacteria | 10331 |
| 247 | Ga0495684_0010457 | 3300047471 | Bacteria | 7176 |
| 248 | Ga0495684_0184483 | 3300047471 | Unclassified | 1545 |
| 249 | Ga0495684_0200819 | 3300047471 | Bacteria | 1470 |
| 250 | Ga0495593_0008270 | 3300047673 | Bacteria | 6055 |
| 251 | Ga0495593_0039399 | 3300047673 | Unclassified | 2548 |
| 252 | Ga0495602_0019717 | 3300048088 | Bacteria | 6684 |
| 253 | Ga0495602_0072066 | 3300048088 | Unclassified | 2948 |
| 254 | Ga0495602_0360062 | 3300048088 | Unclassified | 1047 |
| 255 | Ga0496100_0131033 | 3300048903 | Bacteria | 1766 |
| 256 | Ga0496112_0189361 | 3300048915 | Unclassified | 2020 |
| 257 | Ga0496114_0028475 | 3300048917 | Bacteria | 4585 |
| 258 | Ga0496115_0030057 | 3300048918 | Bacteria | 4271 |
| 259 | nmdc:mga0n895_10958_c1 | 3300050512 | Bacteria | 8057 |
| 260 | nmdc:mga0n895_13237_c1 | 3300050512 | Bacteria | 7434 |
| 261 | nmdc:mga08x19_199_c1 | 3300050514 | Bacteria | 46271 |
| 262 | nmdc:mga08x19_28634_c1 | 3300050514 | Bacteria | 3490 |
| 263 | nmdc:mga08x19_6618_c1 | 3300050514 | Bacteria | 6871 |
| 264 | Ga0495612_0002200 | 3300053078 | Bacteria | 8019 |
| 265 | Ga0495619_0051824 | 3300053085 | Bacteria | 2713 |
| 266 | Ga0099794_10211319 | |||
| 267 | Ga0070703_10001067 | |||
| 268 | Ga0070709_10009226 | |||
| 269 | Ga0070709_10132159 | |||
| 270 | Ga0070714_100212457 | |||
| 271 | Ga0070713_100097557 | |||
| 272 | Ga0070710_10212215 | |||
| 273 | Ga0070711_100025596 | |||
| 274 | Ga0070711_100056495 | |||
| 275 | Ga0070711_100122965 | |||
| 276 | Ga0070711_100308348 | |||
| 277 | Ga0070705_100004414 | |||
| 278 | Ga0070694_100008720 | |||
| 279 | Ga0070708_100006712 | |||
| 280 | Ga0070708_100008450 | |||
| 281 | Ga0070708_100111875 | |||
| 282 | Ga0070708_100126444 | |||
| 283 | Ga0070708_100492254 | |||
| 284 | Ga0070706_100011102 | |||
| 285 | Ga0070706_100034350 | |||
| 286 | Ga0070707_100000355 | |||
| 287 | Ga0070707_100001301 | |||
| 288 | Ga0070707_100136497 | |||
| 289 | Ga0070707_100388796 | |||
| 290 | Ga0070698_100000499 | |||
| 291 | Ga0070698_100031148 | |||
| 292 | Ga0070698_100052978 | |||
| 293 | Ga0070698_100236596 | |||
| 294 | Ga0070699_100142576 | |||
| 295 | Ga0070699_100464507 | |||
| 296 | Ga0070697_100000780 | |||
| 297 | Ga0070697_100061744 | |||
| 298 | Ga0070697_100162420 | |||
| 299 | Ga0070697_100272741 | |||
| 300 | Ga0070695_100015162 | |||
| 301 | Ga0070695_100123828 | |||
| 302 | Ga0070695_100206461 | |||
| 303 | Ga0070696_100001229 | |||
| 304 | Ga0070693_100000056 | |||
| 305 | Ga0070704_100023293 | |||
| 306 | Ga0068859_100130885 | |||
| 307 | Ga0068863_100002559 | |||
| 308 | Ga0070717_10138173 | |||
| 309 | Ga0070716_100001156 | |||
| 310 | Ga0070716_100006010 | |||
| 311 | Ga0070716_100085722 | |||
| 312 | Ga0070712_100023316 | |||
| 313 | Ga0070712_100117573 | |||
| 314 | Ga0097621_100004419 | |||
| 315 | Ga0068871_100001378 | |||
| 316 | Ga0075433_10477794 | |||
| 317 | Ga0075434_100014215 | |||
| 318 | Ga0075434_100167875 | |||
| 319 | Ga0068865_100076562 | |||
| 320 | Ga0075436_100000904 | |||
| 321 | Ga0075436_100002915 | |||
| 322 | Ga0075436_100036246 | |||
| 323 | Ga0097620_100130886 | |||
| 324 | Ga0099794_10001567 | |||
| 325 | Ga0099794_10002519 | |||
| 326 | Ga0099794_10009325 | |||
| 327 | Ga0099794_10023719 | |||
| 328 | Ga0099794_10026195 | |||
| 329 | Ga0099794_10028064 | |||
| 330 | Ga0099794_10039177 | |||
| 331 | Ga0099794_10101145 | |||
| 332 | Ga0099794_10124672 | |||
| 333 | Ga0099794_10145779 | |||
| 334 | Ga0105240_10030367 | |||
| 335 | Ga0105240_10078348 | |||
| 336 | Ga0105240_10279208 | |||
| 337 | Ga0105245_10334157 | |||
| 338 | Ga0105242_10032004 | |||
| 339 | Ga0105237_10253729 | |||
| 340 | Ga0099796_10022421 | |||
| 341 | Ga0157378_10006324 | |||
| 342 | Ga0157378_10242675 | |||
| 343 | Ga0157378_10405213 | |||
| 344 | Ga0163163_10759133 | |||
| 345 | Ga0157376_10000065 | |||
| 346 | Ga0157376_10002628 | |||
| 347 | Ga0228598_1008332 | |||
| 348 | Ga0207685_10031017 | |||
| 349 | Ga0207699_10019807 | |||
| 350 | Ga0207684_10027283 | |||
| 351 | Ga0207684_10161372 | |||
| 352 | Ga0207684_10262162 | |||
| 353 | Ga0207695_10028829 | |||
| 354 | Ga0207695_10167575 | |||
| 355 | Ga0207695_10230353 | |||
| 356 | Ga0207671_10129294 | |||
| 357 | Ga0207693_10007765 | |||
| 358 | Ga0207693_10073916 | |||
| 359 | Ga0207693_10147686 | |||
| 360 | Ga0207663_10028176 | |||
| 361 | Ga0207646_10000019 | |||
| 362 | Ga0207646_10001138 | |||
| 363 | Ga0207646_10002323 | |||
| 364 | Ga0207646_10048409 | |||
| 365 | Ga0207646_10077974 | |||
| 366 | Ga0207700_10010704 | |||
| 367 | Ga0207700_10077680 | |||
| 368 | Ga0207700_10315960 | |||
| 369 | Ga0207665_10000807 | |||
| 370 | Ga0207665_10001199 | |||
| 371 | Ga0207665_10009276 | |||
| 372 | Ga0207665_10040825 | |||
| 373 | Ga0207665_10208609 | |||
| 374 | Ga0207641_10008001 | |||
| 375 | Ga0209179_1021897 | |||
| 376 | Ga0209588_1008225 | |||
| 377 | Ga0265354_1000545 | |||
| 378 | Ga0268266_10001200 | |||
| 379 | Ga0268264_10186871 | |||
| 380 | Ga0265319_1000299 | |||
| 381 | Ga0265318_10000331 | |||
| 382 | Ga0265338_10004549 | |||
| 383 | Ga0265338_10053884 | |||
| 384 | Ga0265762_1010181 | |||
| 385 | Ga0265770_1000923 | |||
| 386 | Ga0265760_10014725 | |||
| 387 | Ga0265760_10039924 | |||
| 388 | Ga0265332_10051601 | |||
| 389 | Ga0265320_10000031 | |||
| 390 | Ga0265320_10065847 | |||
| 391 | Ga0265325_10002286 | |||
| 392 | Ga0265325_10015806 | |||
| 393 | Ga0265325_10059979 | |||
| 394 | Ga0265325_10159024 | |||
| 395 | Ga0265329_10001565 | |||
| 396 | Ga0265339_10043761 | |||
| 397 | Ga0265331_10000039 | |||
| 398 | Ga0265331_10013984 | |||
| 399 | Ga0265316_10003135 | |||
| 400 | Ga0265316_10012684 | |||
| 401 | Ga0265342_10002916 | |||
| 402 | Ga0316212_1004873 | |||
| 403 | Ga0373926_0020387 | |||
| 404 | Ga0373934_0001094 | |||
| 405 | Ga0373953_0012343 | |||
| 406 | Ga0373954_0000248 | |||
| 407 | Ga0373956_0005782 | |||
| 408 | Ga0373946_0021428 | |||
| 409 | Ga0373955_0004686 | |||
| 410 | Ga0373955_0027278 | |||
| 411 | Ga0373931_0042248 | |||
| 412 | Ga0373935_0010407 | |||
| 413 | Ga0373927_0005734 | |||
| 414 | Ga0373927_0009247 | |||
| 415 | Ga0373933_0001757 | |||
| 416 | Ga0373937_0000694 | |||
| 417 | Ga0373937_0045270 | |||
| 418 | Ga0373925_0001091 | |||
| 419 | Ga0373925_0520922 | |||
| 420 | Ga0451577_0058333 | |||
| 421 | Ga0451577_0076173 | |||
| 422 | Ga0451577_0108887 | |||
| 423 | Ga0453683_0017679 | |||
| 424 | Ga0453683_0057559 | |||
| 425 | Ga0453684_0022563 | |||
| 426 | Ga0453684_0516627 | |||
| 427 | Ga0451576_0047943 | |||
| 428 | Ga0495592_0022289 | |||
| 429 | Ga0495592_0099026 | |||
| 430 | Ga0495603_0013138 | |||
| 431 | Ga0495651_0000149 | |||
| 432 | Ga0495651_0006899 | |||
| 433 | Ga0495651_0048182 | |||
| 434 | Ga0495653_0007083 | |||
| 435 | Ga0495653_0234430 | |||
| 436 | Ga0495580_0005030 | |||
| 437 | Ga0495580_0018093 | |||
| 438 | Ga0495580_0028483 | |||
| 439 | Ga0495580_0043258 | |||
| 440 | Ga0495580_0141691 | |||
| 441 | Ga0495582_0000069 | |||
| 442 | Ga0495582_0013621 | |||
| 443 | Ga0495639_0012314 | |||
| 444 | Ga0495664_0046650 | |||
| 445 | Ga0495664_0088507 | |||
| 446 | Ga0495594_0024181 | |||
| 447 | Ga0495608_0015836 | |||
| 448 | Ga0495608_0024148 | |||
| 449 | Ga0495608_0032196 | |||
| 450 | Ga0495608_0059627 | |||
| 451 | Ga0495628_0019449 | |||
| 452 | Ga0495628_0058883 | |||
| 453 | Ga0495630_0021521 | |||
| 454 | Ga0495630_0041975 | |||
| 455 | Ga0495630_0049760 | |||
| 456 | Ga0495630_0145711 | |||
| 457 | Ga0495666_0021496 | |||
| 458 | Ga0495652_0011015 | |||
| 459 | Ga0495652_0323249 | |||
| 460 | Ga0495665_0084659 | |||
| 461 | Ga0495640_0039510 | |||
| 462 | Ga0495640_0068895 | |||
| 463 | Ga0495586_0017382 | |||
| 464 | Ga0495586_0109609 | |||
| 465 | Ga0495587_0001079 | |||
| 466 | Ga0495587_0008502 | |||
| 467 | Ga0495587_0064210 | |||
| 468 | Ga0495587_0252181 | |||
| 469 | Ga0495645_0054578 | |||
| 470 | Ga0495645_0057556 | |||
| 471 | Ga0495645_0116862 | |||
| 472 | Ga0495622_0032137 | |||
| 473 | Ga0495622_0132829 | |||
| 474 | Ga0495667_0001402 | |||
| 475 | Ga0495667_0003042 | |||
| 476 | Ga0495667_0064393 | |||
| 477 | Ga0495667_0116354 | |||
| 478 | Ga0495634_0072909 | |||
| 479 | Ga0495634_0107081 | |||
| 480 | Ga0495635_0022817 | |||
| 481 | Ga0495657_0006733 | |||
| 482 | Ga0495657_0053515 | |||
| 483 | Ga0495599_0002147 | |||
| 484 | Ga0495623_0007314 | |||
| 485 | Ga0495623_0071649 | |||
| 486 | Ga0495646_0003308 | |||
| 487 | Ga0495647_0013849 | |||
| 488 | Ga0495658_0033555 | |||
| 489 | Ga0495613_0016683 | |||
| 490 | Ga0495624_0031858 | |||
| 491 | Ga0495624_0058034 | |||
| 492 | Ga0495600_0076467 | |||
| 493 | Ga0495600_0099814 | |||
| 494 | Ga0495581_0136775 | |||
| 495 | Ga0495604_0000240 | |||
| 496 | Ga0495604_0284671 | |||
| 497 | Ga0495674_0003091 | |||
| 498 | Ga0495674_0028892 | |||
| 499 | Ga0495674_0072346 | |||
| 500 | Ga0495674_0081799 | |||
| 501 | Ga0495674_0091367 | |||
| 502 | Ga0495674_0149803 | |||
| 503 | Ga0495680_0000912 | |||
| 504 | Ga0495680_0011542 | |||
| 505 | Ga0495680_0036623 | |||
| 506 | Ga0495680_0058070 | |||
| 507 | Ga0495675_0001129 | |||
| 508 | Ga0495675_0004677 | |||
| 509 | Ga0495675_0034405 | |||
| 510 | Ga0495684_0002915 | |||
| 511 | Ga0495684_0005011 | |||
| 512 | Ga0495684_0010457 | |||
| 513 | Ga0495684_0184483 | |||
| 514 | Ga0495684_0200819 | |||
| 515 | Ga0495593_0008270 | |||
| 516 | Ga0495593_0039399 | |||
| 517 | Ga0495602_0019717 | |||
| 518 | Ga0495602_0072066 | |||
| 519 | Ga0495602_0360062 | |||
| 520 | Ga0496100_0131033 | |||
| 521 | Ga0496112_0189361 | |||
| 522 | Ga0496114_0028475 | |||
| 523 | Ga0496115_0030057 | |||
| 524 | nmdc:mga0n895_10958_c1 | |||
| 525 | nmdc:mga0n895_13237_c1 | |||
| 526 | nmdc:mga08x19_199_c1 | |||
| 527 | nmdc:mga08x19_28634_c1 | |||
| 528 | nmdc:mga08x19_6618_c1 | |||
| 529 | Ga0495612_0002200 | |||
| 530 | Ga0495619_0051824 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.7781 | 23 | 272 |
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.757 | 23 | 272 |
| 4mnd-assembly1.cif.gz_A-2 | crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein | 0.7167 | 20 | 210 |
| 5d92-assembly2.cif.gz_C | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.7002 | 32 | 210 |
| 4q7c-assembly1.cif.gz_B | structure of af2299, a cdp-alcohol phosphotransferase | 0.692 | 29 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F188_23_199_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8346 | 20 | 224 | 1.20.120.1760 |
| af_D3ZGY5_32_207_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8221 | 20 | 217 | 1.20.120.1760 |
| af_E7F188_23_199_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.805 | 20 | 224 | 1.20.120.1760 |
| af_P9WPG1_2_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8037 | 13 | 219 | 1.20.120.1760 |
| af_Q58609_4_200_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7963 | 23 | 272 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2ZR50-F1-model_v4 | deleted | 0.9295 | 20 | 273 |
|
| AF-A0A523D9M6-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9211 | 12 | 275 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-E6W6Q2-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9175 | 23 | 269 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-A0A7C6HN34-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9162 | 21 | 215 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |
| AF-A0A348HCE3-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) | 0.9146 | 26 | 274 |
GO:0003882
GO:0008654 GO:0012505 GO:0016020 |