F373252

General Info

Members Datasets Scaffolds Average Seq Length
265 136 530 276

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10211319|Ga0099794_102113191
Length 301
Sequence LAATRREFVRPSLVRSGGKAILSVAILDQQKVPYEGRRHRTQARLRRGVFLLPAAMTSANLLCGYYAVIASLMGTPDDFNHAAKAIGIAIVFDSLDGRIARMTGTNTEFGVQFDSLADVVSFGIAPAVLAYAWGVRSVSNLAPDALHQLGRFGWLCCLAFLICCAWRLARFNVQGMAPGGSKFFVGMPTPAAAGVIASIVHAFHAGGPLGDWRWSIPWLFLAVALAGLMTSTIRFYSFKDLPWGKKQPGVLILILLVFLAIVWNYSEISLLLIACSYAVAGVTLHIVRYARQHSASRTAAP

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
72 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.51
Rhizosphere 98.11
Stem 0
Stem Tuber 0
Unclassified 35.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10211319 3300007265 Bacteria 995
2 Ga0070703_10001067 3300005406 Bacteria 8540
3 Ga0070709_10009226 3300005434 Bacteria 5431
4 Ga0070709_10132159 3300005434 Unclassified 1705
5 Ga0070714_100212457 3300005435 Bacteria 1774
6 Ga0070713_100097557 3300005436 Unclassified 2540
7 Ga0070710_10212215 3300005437 Bacteria 1228
8 Ga0070711_100025596 3300005439 Unclassified 3862
9 Ga0070711_100056495 3300005439 Bacteria 2714
10 Ga0070711_100122965 3300005439 Unclassified 1922
11 Ga0070711_100308348 3300005439 Bacteria 1261
12 Ga0070705_100004414 3300005440 Bacteria 6852
13 Ga0070694_100008720 3300005444 Bacteria 6210
14 Ga0070708_100006712 3300005445 Bacteria 9164
15 Ga0070708_100008450 3300005445 Bacteria 8266
16 Ga0070708_100111875 3300005445 Bacteria 2511
17 Ga0070708_100126444 3300005445 Unclassified 2363
18 Ga0070708_100492254 3300005445 Unclassified 1157
19 Ga0070706_100011102 3300005467 Bacteria 8365
20 Ga0070706_100034350 3300005467 Bacteria 4684
21 Ga0070707_100000355 3300005468 Bacteria 45006
22 Ga0070707_100001301 3300005468 Bacteria 24512
23 Ga0070707_100136497 3300005468 Unclassified 2386
24 Ga0070707_100388796 3300005468 Unclassified 1355
25 Ga0070698_100000499 3300005471 Bacteria 41776
26 Ga0070698_100031148 3300005471 Bacteria 5530
27 Ga0070698_100052978 3300005471 Bacteria 4125
28 Ga0070698_100236596 3300005471 Bacteria 1759
29 Ga0070699_100142576 3300005518 Bacteria 2117
30 Ga0070699_100464507 3300005518 Bacteria 1148
31 Ga0070697_100000780 3300005536 Bacteria 23901
32 Ga0070697_100061744 3300005536 Bacteria 3057
33 Ga0070697_100162420 3300005536 Bacteria 1887
34 Ga0070697_100272741 3300005536 Unclassified 1450
35 Ga0070695_100015162 3300005545 Unclassified 4652
36 Ga0070695_100123828 3300005545 Bacteria 1773
37 Ga0070695_100206461 3300005545 Bacteria 1407
38 Ga0070696_100001229 3300005546 Bacteria 16617
39 Ga0070693_100000056 3300005547 Bacteria 43765
40 Ga0070704_100023293 3300005549 Unclassified 4041
41 Ga0068859_100130885 3300005617 Unclassified 2581
42 Ga0068863_100002559 3300005841 Bacteria 18054
43 Ga0070717_10138173 3300006028 Unclassified 2100
44 Ga0070716_100001156 3300006173 Bacteria 11636
45 Ga0070716_100006010 3300006173 Bacteria 5912
46 Ga0070716_100085722 3300006173 Unclassified 1893
47 Ga0070712_100023316 3300006175 Bacteria 4087
48 Ga0070712_100117573 3300006175 Unclassified 1995
49 Ga0097621_100004419 3300006237 Bacteria 9786
50 Ga0068871_100001378 3300006358 Bacteria 16262
51 Ga0075433_10477794 3300006852 Unclassified 1098
52 Ga0075434_100014215 3300006871 Bacteria 7604
53 Ga0075434_100167875 3300006871 Bacteria 2214
54 Ga0068865_100076562 3300006881 Unclassified 2388
55 Ga0075436_100000904 3300006914 Bacteria 19720
56 Ga0075436_100002915 3300006914 Bacteria 11731
57 Ga0075436_100036246 3300006914 Bacteria 3404
58 Ga0097620_100130886 3300006931 Unclassified 2581
59 Ga0099794_10001567 3300007265 Bacteria 8053
60 Ga0099794_10002519 3300007265 Bacteria 6770
61 Ga0099794_10009325 3300007265 Unclassified 4121
62 Ga0099794_10023719 3300007265 Unclassified 2810
63 Ga0099794_10026195 3300007265 Bacteria 2694
64 Ga0099794_10028064 3300007265 Bacteria 2615
65 Ga0099794_10039177 3300007265 Unclassified 2248
66 Ga0099794_10101145 3300007265 Unclassified 1439
67 Ga0099794_10124672 3300007265 Unclassified 1298
68 Ga0099794_10145779 3300007265 Unclassified 1200
69 Ga0105240_10030367 3300009093 Bacteria 7024
70 Ga0105240_10078348 3300009093 Bacteria 4070
71 Ga0105240_10279208 3300009093 Bacteria 1920
72 Ga0105245_10334157 3300009098 Unclassified 1496
73 Ga0105242_10032004 3300009176 Unclassified 4204
74 Ga0105237_10253729 3300009545 Unclassified 1761
75 Ga0099796_10022421 3300010159 Unclassified 1958
76 Ga0157378_10006324 3300013297 Bacteria 10375
77 Ga0157378_10242675 3300013297 Bacteria 1722
78 Ga0157378_10405213 3300013297 Bacteria 1345
79 Ga0163163_10759133 3300014325 Unclassified 1033
80 Ga0157376_10000065 3300014969 Bacteria 86390
81 Ga0157376_10002628 3300014969 Bacteria 12219
82 Ga0228598_1008332 3300024227 Unclassified 2096
83 Ga0207685_10031017 3300025905 Unclassified 1910
84 Ga0207699_10019807 3300025906 Unclassified 3596
85 Ga0207684_10027283 3300025910 Unclassified 4868
86 Ga0207684_10161372 3300025910 Bacteria 1930
87 Ga0207684_10262162 3300025910 Bacteria 1491
88 Ga0207695_10028829 3300025913 Bacteria 6145
89 Ga0207695_10167575 3300025913 Bacteria 2124
90 Ga0207695_10230353 3300025913 Bacteria 1757
91 Ga0207671_10129294 3300025914 Bacteria 1937
92 Ga0207693_10007765 3300025915 Bacteria 8801
93 Ga0207693_10073916 3300025915 Unclassified 2669
94 Ga0207693_10147686 3300025915 Unclassified 1849
95 Ga0207663_10028176 3300025916 Unclassified 3285
96 Ga0207646_10000019 3300025922 Bacteria 282855
97 Ga0207646_10001138 3300025922 Bacteria 33952
98 Ga0207646_10002323 3300025922 Bacteria 22527
99 Ga0207646_10048409 3300025922 Bacteria 3810
100 Ga0207646_10077974 3300025922 Unclassified 2961
101 Ga0207700_10010704 3300025928 Bacteria 5806
102 Ga0207700_10077680 3300025928 Unclassified 2580
103 Ga0207700_10315960 3300025928 Bacteria 1352
104 Ga0207665_10000807 3300025939 Bacteria 21194
105 Ga0207665_10001199 3300025939 Bacteria 17472
106 Ga0207665_10009276 3300025939 Bacteria 6460
107 Ga0207665_10040825 3300025939 Bacteria 3097
108 Ga0207665_10208609 3300025939 Unclassified 1426
109 Ga0207641_10008001 3300026088 Bacteria 8763
110 Ga0209179_1021897 3300027512 Unclassified 1251
111 Ga0209588_1008225 3300027671 Bacteria 3086
112 Ga0265354_1000545 3300028016 Bacteria 6449
113 Ga0268266_10001200 3300028379 Bacteria 31990
114 Ga0268264_10186871 3300028381 Bacteria 1886
115 Ga0265319_1000299 3300028563 Bacteria 36801
116 Ga0265318_10000331 3300028577 Bacteria 37665
117 Ga0265338_10004549 3300028800 Bacteria 18670
118 Ga0265338_10053884 3300028800 Unclassified 3593
119 Ga0265762_1010181 3300030760 Bacteria 1679
120 Ga0265770_1000923 3300030878 Bacteria 4072
121 Ga0265760_10014725 3300031090 Unclassified 2242
122 Ga0265760_10039924 3300031090 Unclassified 1397
123 Ga0265332_10051601 3300031238 Archaea 1766
124 Ga0265320_10000031 3300031240 Bacteria 147045
125 Ga0265320_10065847 3300031240 Bacteria 1719
126 Ga0265325_10002286 3300031241 Bacteria 12998
127 Ga0265325_10015806 3300031241 Bacteria 4234
128 Ga0265325_10059979 3300031241 Bacteria 1934
129 Ga0265325_10159024 3300031241 Bacteria 1064
130 Ga0265329_10001565 3300031242 Bacteria 10951
131 Ga0265339_10043761 3300031249 Archaea 2473
132 Ga0265331_10000039 3300031250 Bacteria 194439
133 Ga0265331_10013984 3300031250 Bacteria 4293
134 Ga0265316_10003135 3300031344 Bacteria 16834
135 Ga0265316_10012684 3300031344 Bacteria 7544
136 Ga0265342_10002916 3300031712 Bacteria 14429
137 Ga0316212_1004873 3300033547 Unclassified 1949
138 Ga0373926_0020387 3300035083 Unclassified 2290
139 Ga0373934_0001094 3300035086 Bacteria 9815
140 Ga0373953_0012343 3300035117 Unclassified 3023
141 Ga0373954_0000248 3300035118 Bacteria 19693
142 Ga0373956_0005782 3300035119 Unclassified 4942
143 Ga0373946_0021428 3300035171 Bacteria 2506
144 Ga0373955_0004686 3300035172 Bacteria 6074
145 Ga0373955_0027278 3300035172 Unclassified 2950
146 Ga0373931_0042248 3300035691 Unclassified 2397
147 Ga0373935_0010407 3300035692 Bacteria 5576
148 Ga0373927_0005734 3300035695 Bacteria 8530
149 Ga0373927_0009247 3300035695 Bacteria 6610
150 Ga0373933_0001757 3300035724 Bacteria 12573
151 Ga0373937_0000694 3300036401 Bacteria 29354
152 Ga0373937_0045270 3300036401 Bacteria 4021
153 Ga0373925_0001091 3300037068 Bacteria 24341
154 Ga0373925_0520922 3300037068 Archaea 977
155 Ga0451577_0058333 3300042876 Bacteria 3441
156 Ga0451577_0076173 3300042876 Bacteria 2991
157 Ga0451577_0108887 3300042876 Unclassified 2477
158 Ga0453683_0017679 3300044673 Bacteria 4589
159 Ga0453683_0057559 3300044673 Bacteria 2431
160 Ga0453684_0022563 3300044712 Bacteria 9329
161 Ga0453684_0516627 3300044712 Bacteria 1320
162 Ga0451576_0047943 3300045051 Bacteria 4490
163 Ga0495592_0022289 3300046454 Unclassified 4819
164 Ga0495592_0099026 3300046454 Unclassified 2080
165 Ga0495603_0013138 3300046455 Bacteria 5005
166 Ga0495651_0000149 3300046462 Bacteria 51195
167 Ga0495651_0006899 3300046462 Bacteria 8680
168 Ga0495651_0048182 3300046462 Bacteria 3292
169 Ga0495653_0007083 3300046463 Bacteria 9196
170 Ga0495653_0234430 3300046463 Unclassified 1227
171 Ga0495580_0005030 3300046472 Bacteria 11022
172 Ga0495580_0018093 3300046472 Bacteria 5252
173 Ga0495580_0028483 3300046472 Unclassified 4060
174 Ga0495580_0043258 3300046472 Unclassified 3206
175 Ga0495580_0141691 3300046472 Bacteria 1666
176 Ga0495582_0000069 3300046473 Bacteria 52545
177 Ga0495582_0013621 3300046473 Unclassified 4477
178 Ga0495639_0012314 3300046475 Unclassified 3689
179 Ga0495664_0046650 3300046477 Unclassified 2571
180 Ga0495664_0088507 3300046477 Bacteria 1861
181 Ga0495594_0024181 3300046499 Unclassified 3260
182 Ga0495608_0015836 3300046511 Bacteria 5218
183 Ga0495608_0024148 3300046511 Bacteria 4159
184 Ga0495608_0032196 3300046511 Bacteria 3544
185 Ga0495608_0059627 3300046511 Bacteria 2514
186 Ga0495628_0019449 3300046516 Bacteria 5614
187 Ga0495628_0058883 3300046516 Unclassified 3018
188 Ga0495630_0021521 3300046517 Bacteria 4761
189 Ga0495630_0041975 3300046517 Bacteria 3416
190 Ga0495630_0049760 3300046517 Unclassified 3136
191 Ga0495630_0145711 3300046517 Unclassified 1801
192 Ga0495666_0021496 3300046526 Unclassified 3194
193 Ga0495652_0011015 3300046529 Bacteria 8194
194 Ga0495652_0323249 3300046529 Unclassified 1114
195 Ga0495665_0084659 3300046531 Unclassified 1666
196 Ga0495640_0039510 3300046533 Unclassified 3310
197 Ga0495640_0068895 3300046533 Unclassified 2380
198 Ga0495586_0017382 3300046535 Unclassified 3823
199 Ga0495586_0109609 3300046535 Bacteria 1536
200 Ga0495587_0001079 3300046536 Bacteria 17903
201 Ga0495587_0008502 3300046536 Bacteria 6598
202 Ga0495587_0064210 3300046536 Unclassified 2145
203 Ga0495587_0252181 3300046536 Unclassified 992
204 Ga0495645_0054578 3300046543 Bacteria 2903
205 Ga0495645_0057556 3300046543 Bacteria 2821
206 Ga0495645_0116862 3300046543 Unclassified 1882
207 Ga0495622_0032137 3300046557 Unclassified 2451
208 Ga0495622_0132829 3300046557 Unclassified 1133
209 Ga0495667_0001402 3300046559 Bacteria 15879
210 Ga0495667_0003042 3300046559 Bacteria 11251
211 Ga0495667_0064393 3300046559 Unclassified 2398
212 Ga0495667_0116354 3300046559 Unclassified 1727
213 Ga0495634_0072909 3300046642 Unclassified 2258
214 Ga0495634_0107081 3300046642 Bacteria 1801
215 Ga0495635_0022817 3300046663 Unclassified 4363
216 Ga0495657_0006733 3300046675 Bacteria 8961
217 Ga0495657_0053515 3300046675 Unclassified 2700
218 Ga0495599_0002147 3300046678 Bacteria 11464
219 Ga0495623_0007314 3300046679 Bacteria 7165
220 Ga0495623_0071649 3300046679 Bacteria 2156
221 Ga0495646_0003308 3300046680 Bacteria 10025
222 Ga0495647_0013849 3300046681 Unclassified 2802
223 Ga0495658_0033555 3300046683 Unclassified 2812
224 Ga0495613_0016683 3300046689 Bacteria 5468
225 Ga0495624_0031858 3300046690 Unclassified 3423
226 Ga0495624_0058034 3300046690 Unclassified 2432
227 Ga0495600_0076467 3300046809 Bacteria 2186
228 Ga0495600_0099814 3300046809 Bacteria 1892
229 Ga0495581_0136775 3300047315 Unclassified 1428
230 Ga0495604_0000240 3300047317 Bacteria 49111
231 Ga0495604_0284671 3300047317 Unclassified 1115
232 Ga0495674_0003091 3300047319 Bacteria 16177
233 Ga0495674_0028892 3300047319 Bacteria 5051
234 Ga0495674_0072346 3300047319 Unclassified 2974
235 Ga0495674_0081799 3300047319 Unclassified 2769
236 Ga0495674_0091367 3300047319 Unclassified 2600
237 Ga0495674_0149803 3300047319 Bacteria 1957
238 Ga0495680_0000912 3300047322 Bacteria 32793
239 Ga0495680_0011542 3300047322 Bacteria 7816
240 Ga0495680_0036623 3300047322 Unclassified 3938
241 Ga0495680_0058070 3300047322 Bacteria 2991
242 Ga0495675_0001129 3300047444 Bacteria 16229
243 Ga0495675_0004677 3300047444 Bacteria 8313
244 Ga0495675_0034405 3300047444 Bacteria 3235
245 Ga0495684_0002915 3300047471 Bacteria 13470
246 Ga0495684_0005011 3300047471 Bacteria 10331
247 Ga0495684_0010457 3300047471 Bacteria 7176
248 Ga0495684_0184483 3300047471 Unclassified 1545
249 Ga0495684_0200819 3300047471 Bacteria 1470
250 Ga0495593_0008270 3300047673 Bacteria 6055
251 Ga0495593_0039399 3300047673 Unclassified 2548
252 Ga0495602_0019717 3300048088 Bacteria 6684
253 Ga0495602_0072066 3300048088 Unclassified 2948
254 Ga0495602_0360062 3300048088 Unclassified 1047
255 Ga0496100_0131033 3300048903 Bacteria 1766
256 Ga0496112_0189361 3300048915 Unclassified 2020
257 Ga0496114_0028475 3300048917 Bacteria 4585
258 Ga0496115_0030057 3300048918 Bacteria 4271
259 nmdc:mga0n895_10958_c1 3300050512 Bacteria 8057
260 nmdc:mga0n895_13237_c1 3300050512 Bacteria 7434
261 nmdc:mga08x19_199_c1 3300050514 Bacteria 46271
262 nmdc:mga08x19_28634_c1 3300050514 Bacteria 3490
263 nmdc:mga08x19_6618_c1 3300050514 Bacteria 6871
264 Ga0495612_0002200 3300053078 Bacteria 8019
265 Ga0495619_0051824 3300053085 Bacteria 2713
266 Ga0099794_10211319
267 Ga0070703_10001067
268 Ga0070709_10009226
269 Ga0070709_10132159
270 Ga0070714_100212457
271 Ga0070713_100097557
272 Ga0070710_10212215
273 Ga0070711_100025596
274 Ga0070711_100056495
275 Ga0070711_100122965
276 Ga0070711_100308348
277 Ga0070705_100004414
278 Ga0070694_100008720
279 Ga0070708_100006712
280 Ga0070708_100008450
281 Ga0070708_100111875
282 Ga0070708_100126444
283 Ga0070708_100492254
284 Ga0070706_100011102
285 Ga0070706_100034350
286 Ga0070707_100000355
287 Ga0070707_100001301
288 Ga0070707_100136497
289 Ga0070707_100388796
290 Ga0070698_100000499
291 Ga0070698_100031148
292 Ga0070698_100052978
293 Ga0070698_100236596
294 Ga0070699_100142576
295 Ga0070699_100464507
296 Ga0070697_100000780
297 Ga0070697_100061744
298 Ga0070697_100162420
299 Ga0070697_100272741
300 Ga0070695_100015162
301 Ga0070695_100123828
302 Ga0070695_100206461
303 Ga0070696_100001229
304 Ga0070693_100000056
305 Ga0070704_100023293
306 Ga0068859_100130885
307 Ga0068863_100002559
308 Ga0070717_10138173
309 Ga0070716_100001156
310 Ga0070716_100006010
311 Ga0070716_100085722
312 Ga0070712_100023316
313 Ga0070712_100117573
314 Ga0097621_100004419
315 Ga0068871_100001378
316 Ga0075433_10477794
317 Ga0075434_100014215
318 Ga0075434_100167875
319 Ga0068865_100076562
320 Ga0075436_100000904
321 Ga0075436_100002915
322 Ga0075436_100036246
323 Ga0097620_100130886
324 Ga0099794_10001567
325 Ga0099794_10002519
326 Ga0099794_10009325
327 Ga0099794_10023719
328 Ga0099794_10026195
329 Ga0099794_10028064
330 Ga0099794_10039177
331 Ga0099794_10101145
332 Ga0099794_10124672
333 Ga0099794_10145779
334 Ga0105240_10030367
335 Ga0105240_10078348
336 Ga0105240_10279208
337 Ga0105245_10334157
338 Ga0105242_10032004
339 Ga0105237_10253729
340 Ga0099796_10022421
341 Ga0157378_10006324
342 Ga0157378_10242675
343 Ga0157378_10405213
344 Ga0163163_10759133
345 Ga0157376_10000065
346 Ga0157376_10002628
347 Ga0228598_1008332
348 Ga0207685_10031017
349 Ga0207699_10019807
350 Ga0207684_10027283
351 Ga0207684_10161372
352 Ga0207684_10262162
353 Ga0207695_10028829
354 Ga0207695_10167575
355 Ga0207695_10230353
356 Ga0207671_10129294
357 Ga0207693_10007765
358 Ga0207693_10073916
359 Ga0207693_10147686
360 Ga0207663_10028176
361 Ga0207646_10000019
362 Ga0207646_10001138
363 Ga0207646_10002323
364 Ga0207646_10048409
365 Ga0207646_10077974
366 Ga0207700_10010704
367 Ga0207700_10077680
368 Ga0207700_10315960
369 Ga0207665_10000807
370 Ga0207665_10001199
371 Ga0207665_10009276
372 Ga0207665_10040825
373 Ga0207665_10208609
374 Ga0207641_10008001
375 Ga0209179_1021897
376 Ga0209588_1008225
377 Ga0265354_1000545
378 Ga0268266_10001200
379 Ga0268264_10186871
380 Ga0265319_1000299
381 Ga0265318_10000331
382 Ga0265338_10004549
383 Ga0265338_10053884
384 Ga0265762_1010181
385 Ga0265770_1000923
386 Ga0265760_10014725
387 Ga0265760_10039924
388 Ga0265332_10051601
389 Ga0265320_10000031
390 Ga0265320_10065847
391 Ga0265325_10002286
392 Ga0265325_10015806
393 Ga0265325_10059979
394 Ga0265325_10159024
395 Ga0265329_10001565
396 Ga0265339_10043761
397 Ga0265331_10000039
398 Ga0265331_10013984
399 Ga0265316_10003135
400 Ga0265316_10012684
401 Ga0265342_10002916
402 Ga0316212_1004873
403 Ga0373926_0020387
404 Ga0373934_0001094
405 Ga0373953_0012343
406 Ga0373954_0000248
407 Ga0373956_0005782
408 Ga0373946_0021428
409 Ga0373955_0004686
410 Ga0373955_0027278
411 Ga0373931_0042248
412 Ga0373935_0010407
413 Ga0373927_0005734
414 Ga0373927_0009247
415 Ga0373933_0001757
416 Ga0373937_0000694
417 Ga0373937_0045270
418 Ga0373925_0001091
419 Ga0373925_0520922
420 Ga0451577_0058333
421 Ga0451577_0076173
422 Ga0451577_0108887
423 Ga0453683_0017679
424 Ga0453683_0057559
425 Ga0453684_0022563
426 Ga0453684_0516627
427 Ga0451576_0047943
428 Ga0495592_0022289
429 Ga0495592_0099026
430 Ga0495603_0013138
431 Ga0495651_0000149
432 Ga0495651_0006899
433 Ga0495651_0048182
434 Ga0495653_0007083
435 Ga0495653_0234430
436 Ga0495580_0005030
437 Ga0495580_0018093
438 Ga0495580_0028483
439 Ga0495580_0043258
440 Ga0495580_0141691
441 Ga0495582_0000069
442 Ga0495582_0013621
443 Ga0495639_0012314
444 Ga0495664_0046650
445 Ga0495664_0088507
446 Ga0495594_0024181
447 Ga0495608_0015836
448 Ga0495608_0024148
449 Ga0495608_0032196
450 Ga0495608_0059627
451 Ga0495628_0019449
452 Ga0495628_0058883
453 Ga0495630_0021521
454 Ga0495630_0041975
455 Ga0495630_0049760
456 Ga0495630_0145711
457 Ga0495666_0021496
458 Ga0495652_0011015
459 Ga0495652_0323249
460 Ga0495665_0084659
461 Ga0495640_0039510
462 Ga0495640_0068895
463 Ga0495586_0017382
464 Ga0495586_0109609
465 Ga0495587_0001079
466 Ga0495587_0008502
467 Ga0495587_0064210
468 Ga0495587_0252181
469 Ga0495645_0054578
470 Ga0495645_0057556
471 Ga0495645_0116862
472 Ga0495622_0032137
473 Ga0495622_0132829
474 Ga0495667_0001402
475 Ga0495667_0003042
476 Ga0495667_0064393
477 Ga0495667_0116354
478 Ga0495634_0072909
479 Ga0495634_0107081
480 Ga0495635_0022817
481 Ga0495657_0006733
482 Ga0495657_0053515
483 Ga0495599_0002147
484 Ga0495623_0007314
485 Ga0495623_0071649
486 Ga0495646_0003308
487 Ga0495647_0013849
488 Ga0495658_0033555
489 Ga0495613_0016683
490 Ga0495624_0031858
491 Ga0495624_0058034
492 Ga0495600_0076467
493 Ga0495600_0099814
494 Ga0495581_0136775
495 Ga0495604_0000240
496 Ga0495604_0284671
497 Ga0495674_0003091
498 Ga0495674_0028892
499 Ga0495674_0072346
500 Ga0495674_0081799
501 Ga0495674_0091367
502 Ga0495674_0149803
503 Ga0495680_0000912
504 Ga0495680_0011542
505 Ga0495680_0036623
506 Ga0495680_0058070
507 Ga0495675_0001129
508 Ga0495675_0004677
509 Ga0495675_0034405
510 Ga0495684_0002915
511 Ga0495684_0005011
512 Ga0495684_0010457
513 Ga0495684_0184483
514 Ga0495684_0200819
515 Ga0495593_0008270
516 Ga0495593_0039399
517 Ga0495602_0019717
518 Ga0495602_0072066
519 Ga0495602_0360062
520 Ga0496100_0131033
521 Ga0496112_0189361
522 Ga0496114_0028475
523 Ga0496115_0030057
524 nmdc:mga0n895_10958_c1
525 nmdc:mga0n895_13237_c1
526 nmdc:mga08x19_199_c1
527 nmdc:mga08x19_28634_c1
528 nmdc:mga08x19_6618_c1
529 Ga0495612_0002200
530 Ga0495619_0051824

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

50

226

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7781 23 272
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.757 23 272
4mnd-assembly1.cif.gz_A-2 crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein 0.7167 20 210
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7002 32 210
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.692 29 210
ID Description Score Start End Superfamily
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8346 20 224 1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8221 20 217 1.20.120.1760
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.805 20 224 1.20.120.1760
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8037 13 219 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7963 23 272 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7C2ZR50-F1-model_v4 deleted 0.9295 20 273
AF-A0A523D9M6-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9211 12 275 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-E6W6Q2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9175 23 269 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A7C6HN34-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9162 21 215 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A348HCE3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9146 26 274 GO:0003882
GO:0008654
GO:0012505
GO:0016020

Map