F373146

General Info

Members Datasets Scaffolds Average Seq Length
265 170 530 549

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100018424|Ga0070694_1000184242
Length 523
Sequence MVDISAMQLWIAAALIVIAFASAALVSLGVWVIAANQSGLVVKRFGPPLASGRIVASNGEAGYQARLLPPGWHFGLWRVRPGEIALVVAADGAPIPSERVLAKAVDADNFQDAEAFLRNGGERGRQSAFLTAGTYRINPALFEVVTTESAPKYGMAPKDLHVYQMPPDRVGIVTVLDGRPIPSGDLAGPSVSGHESFQRPQAFMAAGGCRGLQEDVLLSGSWNLNPWFAHVEPVPLVEVPIGYVGGREHLDVSGEAFTHGDLVERGRKGVWVEPLLPGKHPLNTRVMKVELVPTTNIVLNWAQRTEAHHYDERLSSILVRSKDGFSFSLDVSQIIHIGMRNAPRVISRVGSMQNLVDHVLQPTVGNYFRNSAQEVTVLEFLSARSARQKHAFAAIKTAIEAYDVECIDTLIGDIAPPSELMKTQTDRKIAEELERTQSXVVRRVAQQNALATAETARGELGIEAVGAPGYTAMQIATIVGENKVKVVPDIAVSGDGSSGLVNVMIGRMLASTMARSSEPPTTS

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
117 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
118 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
119 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
120 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
121 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 0
Rhizoplane 5.66
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100018424 3300005444 Bacteria 4431
2 Ga0065712_10069093 3300005290 Bacteria 8039
3 Ga0065712_10070744 3300005290 Bacteria 5747
4 Ga0065715_10000353 3300005293 Bacteria 19855
5 Ga0070658_10001833 3300005327 Bacteria 17890
6 Ga0070676_10001818 3300005328 Bacteria 10848
7 Ga0070683_100017616 3300005329 Bacteria 6313
8 Ga0070683_100047573 3300005329 Bacteria 3963
9 Ga0070670_100003669 3300005331 Bacteria 12797
10 Ga0070670_100003701 3300005331 Bacteria 12741
11 Ga0070670_100012676 3300005331 Bacteria 7218
12 Ga0068869_100038317 3300005334 Bacteria 3416
13 Ga0070666_10013361 3300005335 Bacteria 5206
14 Ga0070691_10005770 3300005341 Bacteria 5647
15 Ga0070691_10039074 3300005341 Bacteria 2242
16 Ga0070687_100011528 3300005343 Bacteria 3869
17 Ga0070687_100027719 3300005343 Bacteria 2740
18 Ga0070661_100046626 3300005344 Bacteria 3171
19 Ga0070692_10012020 3300005345 Bacteria 3994
20 Ga0070692_10012740 3300005345 Bacteria 3904
21 Ga0070668_100039380 3300005347 Bacteria 3615
22 Ga0070675_100005217 3300005354 Bacteria 9914
23 Ga0070671_100057839 3300005355 Bacteria 3227
24 Ga0070671_100140674 3300005355 Unclassified 2036
25 Ga0070667_100028358 3300005367 Bacteria 4661
26 Ga0070701_10003867 3300005438 Bacteria 5981
27 Ga0070701_10008650 3300005438 Bacteria 4415
28 Ga0070705_100010796 3300005440 Bacteria 4584
29 Ga0070700_100001818 3300005441 Bacteria 10763
30 Ga0070700_100007627 3300005441 Bacteria 5855
31 Ga0070694_100015339 3300005444 Bacteria 4811
32 Ga0070708_100033621 3300005445 Bacteria 4455
33 Ga0070663_100027063 3300005455 Bacteria 3890
34 Ga0070663_100033939 3300005455 Bacteria 3529
35 Ga0070662_100030548 3300005457 Bacteria 3772
36 Ga0070662_100109957 3300005457 Bacteria 2098
37 Ga0068867_100005813 3300005459 Bacteria 8751
38 Ga0068867_100042585 3300005459 Bacteria 3322
39 Ga0070706_100014763 3300005467 Bacteria 7217
40 Ga0070707_100022043 3300005468 Bacteria 6022
41 Ga0070707_100039752 3300005468 Bacteria 4498
42 Ga0070698_100006825 3300005471 Bacteria 12372
43 Ga0070699_100031178 3300005518 Bacteria 4602
44 Ga0070684_100000118 3300005535 Bacteria 51534
45 Ga0070697_100048584 3300005536 Bacteria 3441
46 Ga0070686_100056620 3300005544 Bacteria 2515
47 Ga0070695_100000110 3300005545 Bacteria 36348
48 Ga0070695_100000245 3300005545 Bacteria 27029
49 Ga0070695_100007997 3300005545 Bacteria 6265
50 Ga0070696_100001049 3300005546 Bacteria 17874
51 Ga0070696_100043591 3300005546 Bacteria 3104
52 Ga0070704_100005961 3300005549 Bacteria 7145
53 Ga0068855_100000172 3300005563 Bacteria 82970
54 Ga0070664_100003076 3300005564 Bacteria 13480
55 Ga0070664_100062974 3300005564 Bacteria 3162
56 Ga0068857_100016320 3300005577 Bacteria 6507
57 Ga0068854_100017793 3300005578 Bacteria 4762
58 Ga0068854_100039214 3300005578 Bacteria 3336
59 Ga0070702_100066278 3300005615 Unclassified 2117
60 Ga0068859_100000023 3300005617 Bacteria 221914
61 Ga0068859_100020988 3300005617 Bacteria 6557
62 Ga0068864_100009239 3300005618 Bacteria 8129
63 Ga0068864_100013926 3300005618 Bacteria 6667
64 Ga0068864_100020224 3300005618 Bacteria 5569
65 Ga0068851_10024401 3300005834 Bacteria 2960
66 Ga0068863_100000424 3300005841 Bacteria 42794
67 Ga0068863_100158162 3300005841 Bacteria 2170
68 Ga0068858_100174349 3300005842 Bacteria 2029
69 Ga0068860_100004096 3300005843 Bacteria 14942
70 Ga0068860_100086339 3300005843 Bacteria 2986
71 Ga0068862_100167253 3300005844 Bacteria 1966
72 Ga0081540_1000339 3300005983 Bacteria 47999
73 Ga0081540_1001117 3300005983 Bacteria 23757
74 Ga0075365_10010174 3300006038 Bacteria 5463
75 Ga0075368_10009809 3300006042 Bacteria 3452
76 Ga0075363_100022121 3300006048 Bacteria 3212
77 Ga0075364_10018435 3300006051 Bacteria 4369
78 Ga0075364_10027935 3300006051 Bacteria 3608
79 Ga0075362_10001371 3300006177 Bacteria 7725
80 Ga0075367_10009080 3300006178 Bacteria 5179
81 Ga0075367_10048168 3300006178 Bacteria 2509
82 Ga0075366_10007222 3300006195 Bacteria 6122
83 Ga0075366_10027091 3300006195 Bacteria 3362
84 Ga0097621_100022224 3300006237 Bacteria 4921
85 Ga0097621_100134257 3300006237 Bacteria 2109
86 Ga0068871_100003281 3300006358 Bacteria 11104
87 Ga0075428_100014693 3300006844 Bacteria 8696
88 Ga0075428_100033320 3300006844 Bacteria 5689
89 Ga0075430_100057690 3300006846 Bacteria 3265
90 Ga0075431_100000893 3300006847 Bacteria 26334
91 Ga0075431_100016403 3300006847 Bacteria 7516
92 Ga0075431_100034390 3300006847 Bacteria 5221
93 Ga0075431_100080941 3300006847 Bacteria 3353
94 Ga0075433_10003042 3300006852 Bacteria 12888
95 Ga0075433_10046353 3300006852 Bacteria 3781
96 Ga0075433_10054456 3300006852 Bacteria 3490
97 Ga0075433_10083795 3300006852 Bacteria 2814
98 Ga0075434_100000081 3300006871 Bacteria 51958
99 Ga0075434_100013805 3300006871 Bacteria 7702
100 Ga0075434_100210220 3300006871 Bacteria 1966
101 Ga0075429_100011547 3300006880 Bacteria 7660
102 Ga0075429_100014232 3300006880 Bacteria 6897
103 Ga0068865_100010105 3300006881 Bacteria 5873
104 Ga0075436_100070318 3300006914 Bacteria 2420
105 Ga0097620_100000023 3300006931 Bacteria 221914
106 Ga0097620_100020990 3300006931 Bacteria 6557
107 Ga0075435_100001315 3300007076 Bacteria 15963
108 Ga0075435_100029160 3300007076 Bacteria 4330
109 Ga0105240_10037244 3300009093 Bacteria 6252
110 Ga0111539_10002239 3300009094 Bacteria 25817
111 Ga0111539_10013320 3300009094 Bacteria 10277
112 Ga0111539_10025433 3300009094 Bacteria 7258
113 Ga0111539_10128366 3300009094 Bacteria 2970
114 Ga0114129_10000207 3300009147 Bacteria 65630
115 Ga0114129_10000560 3300009147 Bacteria 45696
116 Ga0114129_10009698 3300009147 Bacteria 13741
117 Ga0114129_10014457 3300009147 Bacteria 11247
118 Ga0114129_10022783 3300009147 Bacteria 8880
119 Ga0114129_10034996 3300009147 Bacteria 7095
120 Ga0105243_10006550 3300009148 Bacteria 8996
121 Ga0105241_10000861 3300009174 Bacteria 23026
122 Ga0105242_10004132 3300009176 Bacteria 11297
123 Ga0105242_10027065 3300009176 Bacteria 4549
124 Ga0105242_10048862 3300009176 Bacteria 3440
125 Ga0105248_10052939 3300009177 Bacteria 4555
126 Ga0105237_10001750 3300009545 Bacteria 28065
127 Ga0105249_10006651 3300009553 Bacteria 10062
128 Ga0105249_10137346 3300009553 Bacteria 2341
129 Ga0105239_10048214 3300010375 Bacteria 4671
130 Ga0157370_10007393 3300013104 Bacteria 11963
131 Ga0157374_10012876 3300013296 Bacteria 7286
132 Ga0157374_10197450 3300013296 Bacteria 1969
133 Ga0163162_10000373 3300013306 Bacteria 40682
134 Ga0157379_10097359 3300014968 Bacteria 2641
135 Ga0157376_10011972 3300014969 Bacteria 6415
136 Ga0157376_10044118 3300014969 Bacteria 3663
137 Ga0157376_10059221 3300014969 Bacteria 3211
138 Ga0207680_10005210 3300025903 Bacteria 6202
139 Ga0207680_10021637 3300025903 Bacteria 3482
140 Ga0207645_10001600 3300025907 Bacteria 18457
141 Ga0207645_10008393 3300025907 Bacteria 7205
142 Ga0207705_10001253 3300025909 Bacteria 20415
143 Ga0207684_10008231 3300025910 Bacteria 9286
144 Ga0207654_10034399 3300025911 Bacteria 2815
145 Ga0207695_10060995 3300025913 Bacteria 3900
146 Ga0207671_10001864 3300025914 Bacteria 23482
147 Ga0207662_10015059 3300025918 Bacteria 4345
148 Ga0207649_10011063 3300025920 Bacteria 4966
149 Ga0207646_10024597 3300025922 Bacteria 5516
150 Ga0207646_10027512 3300025922 Bacteria 5186
151 Ga0207681_10002940 3300025923 Bacteria 10751
152 Ga0207650_10002776 3300025925 Bacteria 12093
153 Ga0207650_10019760 3300025925 Bacteria 4738
154 Ga0207650_10024693 3300025925 Bacteria 4276
155 Ga0207644_10022316 3300025931 Bacteria 4324
156 Ga0207706_10041026 3300025933 Bacteria 4103
157 Ga0207704_10018987 3300025938 Bacteria 3601
158 Ga0207691_10009082 3300025940 Bacteria 9542
159 Ga0207689_10015927 3300025942 Bacteria 6365
160 Ga0207689_10064688 3300025942 Bacteria 3009
161 Ga0207661_10019999 3300025944 Bacteria 4998
162 Ga0207661_10046874 3300025944 Unclassified 3428
163 Ga0207679_10032685 3300025945 Bacteria 3656
164 Ga0207667_10000288 3300025949 Bacteria 69604
165 Ga0207658_10016295 3300025986 Bacteria 5112
166 Ga0207677_10007439 3300026023 Bacteria 6059
167 Ga0207703_10028645 3300026035 Bacteria 4393
168 Ga0207703_10040384 3300026035 Bacteria 3733
169 Ga0207678_10004205 3300026067 Bacteria 12920
170 Ga0207678_10021210 3300026067 Bacteria 5695
171 Ga0207708_10012177 3300026075 Bacteria 6416
172 Ga0207641_10000250 3300026088 Bacteria 68774
173 Ga0207641_10152568 3300026088 Bacteria 2093
174 Ga0207648_10019707 3300026089 Bacteria 6087
175 Ga0207648_10030259 3300026089 Bacteria 4796
176 Ga0207676_10006802 3300026095 Bacteria 8094
177 Ga0207676_10008824 3300026095 Bacteria 7177
178 Ga0207675_100028129 3300026118 Bacteria 5234
179 Ga0207683_10015712 3300026121 Bacteria 6443
180 Ga0207698_10003306 3300026142 Bacteria 9690
181 Ga0268266_10006975 3300028379 Bacteria 10270
182 Ga0268266_10092753 3300028379 Bacteria 2650
183 Ga0268265_10063448 3300028380 Bacteria 2842
184 Ga0268264_10001580 3300028381 Bacteria 21079
185 Ga0268264_10006841 3300028381 Bacteria 9575
186 Ga0268264_10012746 3300028381 Bacteria 6918
187 Ga0373930_0000599 3300034816 Bacteria 4996
188 Ga0373950_0001368 3300034818 Bacteria 3167
189 Ga0373938_0000879 3300034957 Bacteria 4832
190 Ga0373928_0007038 3300035084 Bacteria 2168
191 Ga0373929_0000931 3300035085 Bacteria 5695
192 Ga0373940_0002551 3300035088 Bacteria 3560
193 Ga0373949_0000874 3300035090 Bacteria 9518
194 Ga0373951_0002924 3300035091 Bacteria 4244
195 Ga0373952_0000786 3300035092 Bacteria 5708
196 Ga0373939_0001395 3300035114 Bacteria 5848
197 Ga0373941_0007385 3300035115 Bacteria 2686
198 Ga0373946_0001093 3300035171 Bacteria 9369
199 Ga0373955_0015778 3300035172 Bacteria 3706
200 Ga0373955_0034834 3300035172 Bacteria 2663
201 Ga0373942_0000529 3300035207 Bacteria 10704
202 Ga0373961_0001418 3300035241 Bacteria 7125
203 Ga0373962_0002869 3300035242 Bacteria 4128
204 Ga0373924_0003496 3300035410 Bacteria 5410
205 Ga0373931_0002946 3300035691 Bacteria 7596
206 Ga0373947_0004804 3300035725 Bacteria 7910
207 Ga0373937_0030778 3300036401 Bacteria 4861
208 Ga0373925_0002391 3300037068 Bacteria 15049
209 Ga0395905_0003703 3300037471 Bacteria 16187
210 Ga0436365_1749879 3300039437 Bacteria 9805
211 Ga0451576_0014551 3300045051 Bacteria 8747
212 Ga0495592_0013628 3300046454 Bacteria 6182
213 Ga0495669_0001066 3300046684 Bacteria 11426
214 Ga0495672_0022028 3300047320 Bacteria 4148
215 Ga0495684_0083966 3300047471 Bacteria 2416
216 Ga0495686_0053559 3300047472 Bacteria 2529
217 Ga0496102_0019241 3300048905 Bacteria 6015
218 Ga0496104_0007114 3300048907 Bacteria 9866
219 Ga0496105_0049954 3300048908 Bacteria 3455
220 Ga0496108_0001370 3300048911 Bacteria 19169
221 Ga0496108_0033831 3300048911 Bacteria 4245
222 Ga0496109_0009078 3300048912 Bacteria 8463
223 Ga0496109_0018168 3300048912 Bacteria 6174
224 Ga0496110_0003485 3300048913 Bacteria 12069
225 Ga0496110_0005898 3300048913 Bacteria 9642
226 Ga0496111_0006649 3300048914 Bacteria 7522
227 Ga0496111_0058879 3300048914 Bacteria 2782
228 Ga0496112_0013905 3300048915 Bacteria 7446
229 Ga0496113_0036772 3300048916 Bacteria 3589
230 Ga0496114_0000086 3300048917 Bacteria 65543
231 Ga0496114_0006003 3300048917 Bacteria 9556
232 Ga0501073_0004616 3300049589 Bacteria 10351
233 nmdc:mga0k408_43758_c2 3300050493 Bacteria 1984
234 nmdc:mga06z11_53205_c1 3300050494 Unclassified 2081
235 nmdc:mga07m45_25516_c1 3300050496 Bacteria 3242
236 nmdc:mga05p37_170862_c1 3300050507 Bacteria 2651
237 nmdc:mga05p37_19150_c1 3300050507 Bacteria 8279
238 nmdc:mga05p37_2369_c2 3300050507 Bacteria 10210
239 nmdc:mga05p37_27680_c1 3300050507 Bacteria 6905
240 nmdc:mga05p37_410_c1 3300050507 Bacteria 46265
241 nmdc:mga05p37_5519_c1 3300050507 Bacteria 14855
242 nmdc:mga05p37_82711_c1 3300050507 Bacteria 3956
243 nmdc:mga05p37_93565_c1 3300050507 Bacteria 3704
244 nmdc:mga09592_21855_c1 3300050508 Bacteria 5276
245 nmdc:mga09592_9890_c1 3300050508 Bacteria 7757
246 nmdc:mga0qj67_136800_c1 3300050509 Bacteria 1985
247 nmdc:mga06r32_21136_c1 3300050510 Bacteria 6006
248 nmdc:mga06r32_2224_c1 3300050510 Bacteria 17373
249 nmdc:mga06r32_40151_c1 3300050510 Bacteria 4441
250 nmdc:mga06r32_65469_c1 3300050510 Bacteria 3505
251 nmdc:mga08y16_17748_c1 3300050511 Bacteria 7494
252 nmdc:mga08y16_30214_c1 3300050511 Bacteria 5704
253 nmdc:mga08y16_4415_c1 3300050511 Bacteria 14702
254 nmdc:mga08y16_54164_c1 3300050511 Bacteria 4192
255 nmdc:mga0n895_105533_c1 3300050512 Bacteria 2830
256 nmdc:mga0n895_14661_c1 3300050512 Bacteria 7128
257 nmdc:mga0rr50_369_c1 3300050513 Bacteria 24573
258 nmdc:mga0rr50_3908_c1 3300050513 Bacteria 8669
259 nmdc:mga0a205_21815_c1 3300050515 Bacteria 6057
260 nmdc:mga0a205_5328_c1 3300050515 Bacteria 11591
261 nmdc:mga0a205_78560_c1 3300050515 Bacteria 3188
262 Ga0500555_000309 3300053103 Bacteria 21054
263 Ga0500568_0002752 3300053139 Bacteria 10176
264 Ga0500616_0000500 3300053153 Bacteria 50312
265 Ga0500645_000137 3300053730 Bacteria 57733
266 Ga0070694_100018424
267 Ga0065712_10069093
268 Ga0065712_10070744
269 Ga0065715_10000353
270 Ga0070658_10001833
271 Ga0070676_10001818
272 Ga0070683_100017616
273 Ga0070683_100047573
274 Ga0070670_100003669
275 Ga0070670_100003701
276 Ga0070670_100012676
277 Ga0068869_100038317
278 Ga0070666_10013361
279 Ga0070691_10005770
280 Ga0070691_10039074
281 Ga0070687_100011528
282 Ga0070687_100027719
283 Ga0070661_100046626
284 Ga0070692_10012020
285 Ga0070692_10012740
286 Ga0070668_100039380
287 Ga0070675_100005217
288 Ga0070671_100057839
289 Ga0070671_100140674
290 Ga0070667_100028358
291 Ga0070701_10003867
292 Ga0070701_10008650
293 Ga0070705_100010796
294 Ga0070700_100001818
295 Ga0070700_100007627
296 Ga0070694_100015339
297 Ga0070708_100033621
298 Ga0070663_100027063
299 Ga0070663_100033939
300 Ga0070662_100030548
301 Ga0070662_100109957
302 Ga0068867_100005813
303 Ga0068867_100042585
304 Ga0070706_100014763
305 Ga0070707_100022043
306 Ga0070707_100039752
307 Ga0070698_100006825
308 Ga0070699_100031178
309 Ga0070684_100000118
310 Ga0070697_100048584
311 Ga0070686_100056620
312 Ga0070695_100000110
313 Ga0070695_100000245
314 Ga0070695_100007997
315 Ga0070696_100001049
316 Ga0070696_100043591
317 Ga0070704_100005961
318 Ga0068855_100000172
319 Ga0070664_100003076
320 Ga0070664_100062974
321 Ga0068857_100016320
322 Ga0068854_100017793
323 Ga0068854_100039214
324 Ga0070702_100066278
325 Ga0068859_100000023
326 Ga0068859_100020988
327 Ga0068864_100009239
328 Ga0068864_100013926
329 Ga0068864_100020224
330 Ga0068851_10024401
331 Ga0068863_100000424
332 Ga0068863_100158162
333 Ga0068858_100174349
334 Ga0068860_100004096
335 Ga0068860_100086339
336 Ga0068862_100167253
337 Ga0081540_1000339
338 Ga0081540_1001117
339 Ga0075365_10010174
340 Ga0075368_10009809
341 Ga0075363_100022121
342 Ga0075364_10018435
343 Ga0075364_10027935
344 Ga0075362_10001371
345 Ga0075367_10009080
346 Ga0075367_10048168
347 Ga0075366_10007222
348 Ga0075366_10027091
349 Ga0097621_100022224
350 Ga0097621_100134257
351 Ga0068871_100003281
352 Ga0075428_100014693
353 Ga0075428_100033320
354 Ga0075430_100057690
355 Ga0075431_100000893
356 Ga0075431_100016403
357 Ga0075431_100034390
358 Ga0075431_100080941
359 Ga0075433_10003042
360 Ga0075433_10046353
361 Ga0075433_10054456
362 Ga0075433_10083795
363 Ga0075434_100000081
364 Ga0075434_100013805
365 Ga0075434_100210220
366 Ga0075429_100011547
367 Ga0075429_100014232
368 Ga0068865_100010105
369 Ga0075436_100070318
370 Ga0097620_100000023
371 Ga0097620_100020990
372 Ga0075435_100001315
373 Ga0075435_100029160
374 Ga0105240_10037244
375 Ga0111539_10002239
376 Ga0111539_10013320
377 Ga0111539_10025433
378 Ga0111539_10128366
379 Ga0114129_10000207
380 Ga0114129_10000560
381 Ga0114129_10009698
382 Ga0114129_10014457
383 Ga0114129_10022783
384 Ga0114129_10034996
385 Ga0105243_10006550
386 Ga0105241_10000861
387 Ga0105242_10004132
388 Ga0105242_10027065
389 Ga0105242_10048862
390 Ga0105248_10052939
391 Ga0105237_10001750
392 Ga0105249_10006651
393 Ga0105249_10137346
394 Ga0105239_10048214
395 Ga0157370_10007393
396 Ga0157374_10012876
397 Ga0157374_10197450
398 Ga0163162_10000373
399 Ga0157379_10097359
400 Ga0157376_10011972
401 Ga0157376_10044118
402 Ga0157376_10059221
403 Ga0207680_10005210
404 Ga0207680_10021637
405 Ga0207645_10001600
406 Ga0207645_10008393
407 Ga0207705_10001253
408 Ga0207684_10008231
409 Ga0207654_10034399
410 Ga0207695_10060995
411 Ga0207671_10001864
412 Ga0207662_10015059
413 Ga0207649_10011063
414 Ga0207646_10024597
415 Ga0207646_10027512
416 Ga0207681_10002940
417 Ga0207650_10002776
418 Ga0207650_10019760
419 Ga0207650_10024693
420 Ga0207644_10022316
421 Ga0207706_10041026
422 Ga0207704_10018987
423 Ga0207691_10009082
424 Ga0207689_10015927
425 Ga0207689_10064688
426 Ga0207661_10019999
427 Ga0207661_10046874
428 Ga0207679_10032685
429 Ga0207667_10000288
430 Ga0207658_10016295
431 Ga0207677_10007439
432 Ga0207703_10028645
433 Ga0207703_10040384
434 Ga0207678_10004205
435 Ga0207678_10021210
436 Ga0207708_10012177
437 Ga0207641_10000250
438 Ga0207641_10152568
439 Ga0207648_10019707
440 Ga0207648_10030259
441 Ga0207676_10006802
442 Ga0207676_10008824
443 Ga0207675_100028129
444 Ga0207683_10015712
445 Ga0207698_10003306
446 Ga0268266_10006975
447 Ga0268266_10092753
448 Ga0268265_10063448
449 Ga0268264_10001580
450 Ga0268264_10006841
451 Ga0268264_10012746
452 Ga0373930_0000599
453 Ga0373950_0001368
454 Ga0373938_0000879
455 Ga0373928_0007038
456 Ga0373929_0000931
457 Ga0373940_0002551
458 Ga0373949_0000874
459 Ga0373951_0002924
460 Ga0373952_0000786
461 Ga0373939_0001395
462 Ga0373941_0007385
463 Ga0373946_0001093
464 Ga0373955_0015778
465 Ga0373955_0034834
466 Ga0373942_0000529
467 Ga0373961_0001418
468 Ga0373962_0002869
469 Ga0373924_0003496
470 Ga0373931_0002946
471 Ga0373947_0004804
472 Ga0373937_0030778
473 Ga0373925_0002391
474 Ga0395905_0003703
475 Ga0436365_1749879
476 Ga0451576_0014551
477 Ga0495592_0013628
478 Ga0495669_0001066
479 Ga0495672_0022028
480 Ga0495684_0083966
481 Ga0495686_0053559
482 Ga0496102_0019241
483 Ga0496104_0007114
484 Ga0496105_0049954
485 Ga0496108_0001370
486 Ga0496108_0033831
487 Ga0496109_0009078
488 Ga0496109_0018168
489 Ga0496110_0003485
490 Ga0496110_0005898
491 Ga0496111_0006649
492 Ga0496111_0058879
493 Ga0496112_0013905
494 Ga0496113_0036772
495 Ga0496114_0000086
496 Ga0496114_0006003
497 Ga0501073_0004616
498 nmdc:mga0k408_43758_c2
499 nmdc:mga06z11_53205_c1
500 nmdc:mga07m45_25516_c1
501 nmdc:mga05p37_170862_c1
502 nmdc:mga05p37_19150_c1
503 nmdc:mga05p37_2369_c2
504 nmdc:mga05p37_27680_c1
505 nmdc:mga05p37_410_c1
506 nmdc:mga05p37_5519_c1
507 nmdc:mga05p37_82711_c1
508 nmdc:mga05p37_93565_c1
509 nmdc:mga09592_21855_c1
510 nmdc:mga09592_9890_c1
511 nmdc:mga0qj67_136800_c1
512 nmdc:mga06r32_21136_c1
513 nmdc:mga06r32_2224_c1
514 nmdc:mga06r32_40151_c1
515 nmdc:mga06r32_65469_c1
516 nmdc:mga08y16_17748_c1
517 nmdc:mga08y16_30214_c1
518 nmdc:mga08y16_4415_c1
519 nmdc:mga08y16_54164_c1
520 nmdc:mga0n895_105533_c1
521 nmdc:mga0n895_14661_c1
522 nmdc:mga0rr50_369_c1
523 nmdc:mga0rr50_3908_c1
524 nmdc:mga0a205_21815_c1
525 nmdc:mga0a205_5328_c1
526 nmdc:mga0a205_78560_c1
527 Ga0500555_000309
528 Ga0500568_0002752
529 Ga0500616_0000500
530 Ga0500645_000137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

256

459

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.8843 314 440
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.835 314 440
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.8293 338 439
7wh3-assembly1.cif.gz_A solution structure of human stomatin spfh domain in a phosphate buffer 0.7776 314 440
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.7543 338 439
ID Description Score Start End Superfamily
af_O49460_91_184_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8901 343 438 3.30.479.30
af_K7M2L3_66_170_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8895 347 445 3.30.479.30
af_Q6K550_45_154_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8835 316 438 3.30.479.30
af_A4HYE6_38_161_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.883 338 450 3.30.479.30
af_O49460_91_184_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.8816 343 438 3.30.479.30
ID Description Score Start End GO Terms
AF-A0A6L9ZCS3-F1-model_v4 Flotillin family protein 0.9671 33 161
AF-A0A6P0JN02-F1-model_v4 deleted 0.9636 33 161
AF-A0A6P0ZII2-F1-model_v4 deleted 0.9565 29 304
AF-A0A6P0ZII2-F1-model_v4 deleted 0.9496 29 304
AF-A0A519LUU4-F1-model_v4 Flotillin family protein 0.9187 72 450

Map