F372612

General Info

Members Datasets Scaffolds Average Seq Length
264 199 528 231

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10327774|Ga0157374_103277741
Length 277
Sequence MTSSEVAETPPIAPTRLLHPAEVREMFATAEQPSDLFQGMNSLKDKVAIITGAVGNLGTATARAFQQAGAKTVLVDRSPDRMTSLFAGLSRSNDHLLAGGVNLSDPDSLGLLIDQTLGRFGRVDVLVNTVGAFRGGKPLHDADPADWDFLFNANVRTTLLCCRAVIPQMLKQRGGKIINVSSREGLEAHAGYAAYSASKSAVLRLTESLAAELKISDINVNCILPSVIDTPQNRTAMPNADFTKWVAPEAIADVISFLASDASRAINGAALPVYGKS

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0.38
Rhizoplane 4.17
Rhizosphere 90.53
Stem 0
Stem Tuber 0
Unclassified 6.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10327774 3300013296 Bacteria 1518
2 JGI25150J39212_1001792 3300002774 Bacteria 5718
3 JGI25151J46595_10053608 3300003187 Bacteria 1345
4 Ga0055526_1010071 3300003771 Bacteria 4447
5 Ga0070676_10007070 3300005328 Bacteria 6009
6 Ga0070676_10013425 3300005328 Bacteria 4490
7 Ga0070690_100098029 3300005330 Bacteria 1940
8 Ga0070690_100344317 3300005330 Bacteria 1080
9 Ga0070670_100008541 3300005331 Bacteria 8737
10 Ga0068869_100000447 3300005334 Bacteria 22613
11 Ga0068869_100013927 3300005334 Bacteria 5362
12 Ga0070680_100354991 3300005336 Bacteria 1247
13 Ga0070680_100579001 3300005336 Bacteria 963
14 Ga0068868_100011396 3300005338 Bacteria 6474
15 Ga0070660_100033792 3300005339 Bacteria 3858
16 Ga0070689_100009929 3300005340 Bacteria 6771
17 Ga0070689_100147564 3300005340 Bacteria 1895
18 Ga0070661_100135740 3300005344 Bacteria 1851
19 Ga0070668_100000854 3300005347 Bacteria 21147
20 Ga0070673_100007927 3300005364 Bacteria 7042
21 Ga0070688_100299442 3300005365 Unclassified 1162
22 Ga0070667_100031668 3300005367 Bacteria 4409
23 Ga0070667_100411726 3300005367 Bacteria 1232
24 Ga0070714_100979572 3300005435 Bacteria 822
25 Ga0070710_10020794 3300005437 Bacteria 3411
26 Ga0070711_100067879 3300005439 Bacteria 2503
27 Ga0070700_100041061 3300005441 Bacteria 2835
28 Ga0070694_100520218 3300005444 Bacteria 949
29 Ga0070663_100288383 3300005455 Bacteria 1310
30 Ga0070678_100233463 3300005456 Unclassified 1535
31 Ga0070681_10009848 3300005458 Bacteria 9415
32 Ga0068867_100002655 3300005459 Bacteria 12620
33 Ga0070706_100192999 3300005467 Bacteria 1903
34 Ga0070706_100209937 3300005467 Bacteria 1818
35 Ga0070707_100097328 3300005468 Bacteria 2850
36 Ga0070707_100472705 3300005468 Bacteria 1215
37 Ga0070698_100553188 3300005471 Bacteria 1090
38 Ga0070699_100093482 3300005518 Bacteria 2631
39 Ga0070699_100099421 3300005518 Bacteria 2549
40 Ga0070679_100096090 3300005530 Bacteria 2951
41 Ga0070679_100266225 3300005530 Bacteria 1669
42 Ga0070697_100155819 3300005536 Bacteria 1928
43 Ga0070696_100004996 3300005546 Bacteria 8860
44 Ga0070696_100128631 3300005546 Bacteria 1840
45 Ga0070696_100471431 3300005546 Bacteria 994
46 Ga0070704_100181906 3300005549 Bacteria 1682
47 Ga0068855_100120064 3300005563 Bacteria 3009
48 Ga0068855_100652112 3300005563 Bacteria 1130
49 Ga0068855_100774811 3300005563 Bacteria 1021
50 Ga0070664_100044522 3300005564 Unclassified 3748
51 Ga0070664_100782963 3300005564 Bacteria 891
52 Ga0068857_100008028 3300005577 Bacteria 9103
53 Ga0068857_100013601 3300005577 Bacteria 7089
54 Ga0068854_100172045 3300005578 Bacteria 1686
55 Ga0068856_100134570 3300005614 Bacteria 2477
56 Ga0068859_100002546 3300005617 Bacteria 18510
57 Ga0068864_100002924 3300005618 Bacteria 14129
58 Ga0068861_100047198 3300005719 Bacteria 3250
59 Ga0068870_10003757 3300005840 Bacteria 6459
60 Ga0068863_100010895 3300005841 Bacteria 8815
61 Ga0068863_100206046 3300005841 Bacteria 1893
62 Ga0068858_100003539 3300005842 Bacteria 15466
63 Ga0068860_100041601 3300005843 Bacteria 4389
64 Ga0068862_100005405 3300005844 Bacteria 10674
65 Ga0070716_100016639 3300006173 Bacteria 3800
66 Ga0075366_10000484 3300006195 Bacteria 18424
67 Ga0097621_100021956 3300006237 Bacteria 4946
68 Ga0097621_100167403 3300006237 Bacteria 1893
69 Ga0075428_100001481 3300006844 Bacteria 25115
70 Ga0075428_100389801 3300006844 Bacteria 1493
71 Ga0075430_100023702 3300006846 Bacteria 5226
72 Ga0075431_100215768 3300006847 Bacteria 1958
73 Ga0075431_100305516 3300006847 Bacteria 1607
74 Ga0075434_100273887 3300006871 Bacteria 1707
75 Ga0075429_100001015 3300006880 Bacteria 22370
76 Ga0075429_100109528 3300006880 Bacteria 2414
77 Ga0097620_100002546 3300006931 Bacteria 18510
78 Ga0099826_10191370 3300006948 Bacteria 1128
79 Ga0099794_10006720 3300007265 Bacteria 4673
80 Ga0099794_10025438 3300007265 Bacteria 2727
81 Ga0099794_10029469 3300007265 Bacteria 2557
82 Ga0105240_10035370 3300009093 Bacteria 6439
83 Ga0105240_10862572 3300009093 Bacteria 976
84 Ga0105247_10003423 3300009101 Bacteria 10360
85 Ga0114129_10000697 3300009147 Bacteria 42351
86 Ga0114129_10309308 3300009147 Bacteria 2104
87 Ga0105243_10722428 3300009148 Bacteria 974
88 Ga0105242_10016920 3300009176 Bacteria 5675
89 Ga0105248_10001649 3300009177 Bacteria 24825
90 Ga0099796_10020470 3300010159 Bacteria 2022
91 Ga0105239_10140391 3300010375 Bacteria 2692
92 Ga0105239_10712028 3300010375 Bacteria 1148
93 Ga0157373_10102655 3300013100 Bacteria 2012
94 Ga0157370_10022974 3300013104 Bacteria 6198
95 Ga0157370_10497182 3300013104 Unclassified 1120
96 Ga0157369_10211967 3300013105 Bacteria 2030
97 Ga0157369_10294859 3300013105 Bacteria 1688
98 Ga0157372_10133009 3300013307 Bacteria 2863
99 Ga0157372_10542996 3300013307 Bacteria 1355
100 Ga0157375_10455045 3300013308 Bacteria 1445
101 Ga0163163_10001321 3300014325 Bacteria 20933
102 Ga0163163_10163669 3300014325 Bacteria 2270
103 Ga0163163_10315712 3300014325 Bacteria 1616
104 Ga0157379_10000172 3300014968 Bacteria 48686
105 Ga0163161_10156231 3300017792 Unclassified 1737
106 Ga0209565_1008416 3300025263 Bacteria 2698
107 Ga0209025_1079155 3300025294 Bacteria 1125
108 Ga0209564_1000662 3300025295 Bacteria 50934
109 Ga0209256_1047669 3300025299 Bacteria 1053
110 Ga0207692_10323019 3300025898 Bacteria 945
111 Ga0207680_10045327 3300025903 Bacteria 2592
112 Ga0207643_10009648 3300025908 Bacteria 5182
113 Ga0207707_10105712 3300025912 Bacteria 2460
114 Ga0207695_10051095 3300025913 Bacteria 4343
115 Ga0207663_10069216 3300025916 Bacteria 2269
116 Ga0207657_10264434 3300025919 Bacteria 1368
117 Ga0207649_10150157 3300025920 Bacteria 1604
118 Ga0207652_10027348 3300025921 Bacteria 4752
119 Ga0207646_10014108 3300025922 Bacteria 7598
120 Ga0207694_10414949 3300025924 Bacteria 1121
121 Ga0207650_10036715 3300025925 Bacteria 3566
122 Ga0207650_10040064 3300025925 Bacteria 3426
123 Ga0207700_10008948 3300025928 Bacteria 6233
124 Ga0207664_10182311 3300025929 Bacteria 1803
125 Ga0207709_10325651 3300025935 Bacteria 1152
126 Ga0207670_10001515 3300025936 Bacteria 12207
127 Ga0207665_10019636 3300025939 Bacteria 4444
128 Ga0207689_10001457 3300025942 Bacteria 22643
129 Ga0207679_10089701 3300025945 Unclassified 2374
130 Ga0207667_10099877 3300025949 Bacteria 2994
131 Ga0207667_10169478 3300025949 Bacteria 2244
132 Ga0207668_10000941 3300025972 Bacteria 17535
133 Ga0207658_10026232 3300025986 Bacteria 4084
134 Ga0207658_10328069 3300025986 Bacteria 1327
135 Ga0207677_10030761 3300026023 Bacteria 3431
136 Ga0207703_10010856 3300026035 Bacteria 7102
137 Ga0207703_10098912 3300026035 Bacteria 2468
138 Ga0207702_10041149 3300026078 Bacteria 3874
139 Ga0207702_10041229 3300026078 Unclassified 3871
140 Ga0207641_10073785 3300026088 Bacteria 2941
141 Ga0207648_10011680 3300026089 Bacteria 8265
142 Ga0207676_10004655 3300026095 Bacteria 9716
143 Ga0207674_10005461 3300026116 Bacteria 15097
144 Ga0207674_10012019 3300026116 Bacteria 9699
145 Ga0207675_100005178 3300026118 Bacteria 12551
146 Ga0209588_1007148 3300027671 Bacteria 3273
147 Ga0209588_1051554 3300027671 Bacteria 1331
148 Ga0207428_10001519 3300027907 Bacteria 24220
149 Ga0268266_10161641 3300028379 Bacteria 2027
150 Ga0268265_10026899 3300028380 Bacteria 4098
151 Ga0268264_10007073 3300028381 Bacteria 9403
152 Ga0268264_10085405 3300028381 Bacteria 2709
153 Ga0265338_10038092 3300028800 Bacteria 4562
154 Ga0265320_10012179 3300031240 Bacteria 5020
155 Ga0265339_10098488 3300031249 Bacteria 1525
156 Ga0265327_10002761 3300031251 Bacteria 17824
157 Ga0316576_10146250 3300031727 Bacteria 1780
158 Ga0316576_10391998 3300031727 Unclassified 1030
159 Ga0316577_10005719 3300031733 Bacteria 6529
160 Ga0307406_10009745 3300031901 Bacteria 5401
161 Ga0316585_10017586 3300032137 Bacteria 2163
162 Ga0307510_10027038 3300033180 Bacteria 6581
163 Ga0373950_0031120 3300034818 Bacteria 988
164 Ga0373944_0019622 3300035089 Bacteria 1941
165 Ga0373936_0013646 3300035113 Bacteria 3101
166 Ga0373945_0102736 3300035116 Bacteria 1120
167 Ga0373953_0068738 3300035117 Bacteria 1458
168 Ga0373943_0069028 3300035170 Bacteria 1785
169 Ga0316574_0013165 3300035398 Bacteria 4751
170 Ga0373935_0167170 3300035692 Bacteria 1502
171 Ga0373947_0022168 3300035725 Bacteria 3680
172 Ga0373937_0048521 3300036401 Bacteria 3887
173 Ga0316582_0016259 3300036647 Bacteria 4276
174 Ga0316582_0296222 3300036647 Bacteria 1111
175 Ga0316584_0000381 3300036712 Bacteria 22913
176 Ga0316584_0028734 3300036712 Bacteria 4103
177 Ga0373925_0230748 3300037068 Bacteria 1480
178 Ga0395899_0000878 3300037312 Bacteria 28579
179 Ga0395905_0034588 3300037471 Bacteria 4745
180 Ga0316581_0005347 3300037588 Bacteria 3339
181 Ga0439452_052981 3300042010 Bacteria 925
182 Ga0450910_031391 3300042147 Bacteria 835
183 Ga0439434_0129530 3300042435 Bacteria 827
184 Ga0450893_0008141 3300042532 Bacteria 1706
185 Ga0451577_0365144 3300042876 Bacteria 1310
186 Ga0466969_0126423 3300044656 Bacteria 1187
187 Ga0466965_0051506 3300044683 Bacteria 2042
188 Ga0466966_0012674 3300044684 Bacteria 5587
189 Ga0466961_0004643 3300044693 Bacteria 8624
190 Ga0466959_0012981 3300045049 Bacteria 6032
191 Ga0451576_0223396 3300045051 Bacteria 1967
192 Ga0451576_0333151 3300045051 Bacteria 1588
193 Ga0495592_0000027 3300046454 Bacteria 132938
194 Ga0495603_0003437 3300046455 Bacteria 9416
195 Ga0495580_0006733 3300046472 Bacteria 9329
196 Ga0495639_0053660 3300046475 Bacteria 1837
197 Ga0495639_0192911 3300046475 Unclassified 995
198 Ga0495662_0007001 3300046476 Bacteria 5602
199 Ga0495662_0074788 3300046476 Bacteria 1644
200 Ga0495664_0038086 3300046477 Bacteria 2838
201 Ga0495664_0201099 3300046477 Unclassified 1207
202 Ga0495618_0105109 3300046514 Bacteria 1808
203 Ga0495628_0001206 3300046516 Bacteria 23631
204 Ga0495628_0248320 3300046516 Bacteria 1329
205 Ga0495630_0030864 3300046517 Bacteria 3989
206 Ga0495642_0003736 3300046528 Bacteria 5963
207 Ga0495640_0015176 3300046533 Bacteria 5802
208 Ga0495640_0073390 3300046533 Bacteria 2291
209 Ga0495640_0175526 3300046533 Bacteria 1368
210 Ga0495586_0000822 3300046535 Bacteria 17837
211 Ga0495586_0013468 3300046535 Bacteria 4338
212 Ga0495598_0141799 3300046537 Unclassified 832
213 Ga0495597_0034031 3300046542 Bacteria 2303
214 Ga0495645_0007344 3300046543 Bacteria 7667
215 Ga0495645_0022331 3300046543 Bacteria 4577
216 Ga0495645_0136267 3300046543 Bacteria 1717
217 Ga0495622_0008800 3300046557 Bacteria 4676
218 Ga0495667_0165843 3300046559 Unclassified 1420
219 Ga0495668_0020009 3300046616 Bacteria 3850
220 Ga0495634_0139098 3300046642 Unclassified 1543
221 Ga0495625_0377555 3300046660 Unclassified 890
222 Ga0495661_0007336 3300046665 Bacteria 7685
223 Ga0495588_0009183 3300046674 Bacteria 4564
224 Ga0495588_0301021 3300046674 Unclassified 844
225 Ga0495657_0253585 3300046675 Bacteria 1059
226 Ga0495599_0012008 3300046678 Bacteria 5329
227 Ga0495599_0157254 3300046678 Bacteria 1406
228 Ga0495647_0013984 3300046681 Bacteria 2790
229 Ga0495647_0034319 3300046681 Bacteria 1900
230 Ga0495647_0046506 3300046681 Unclassified 1672
231 Ga0495658_0036466 3300046683 Bacteria 2713
232 Ga0495658_0095099 3300046683 Bacteria 1770
233 Ga0495624_0086268 3300046690 Bacteria 1939
234 Ga0495674_0016165 3300047319 Bacteria 6962
235 Ga0495676_0060053 3300047321 Bacteria 2982
236 Ga0495676_0278653 3300047321 Bacteria 1133
237 Ga0495614_0171102 3300048089 Bacteria 975
238 Ga0496101_0061941 3300048904 Plasmid 2719
239 Ga0496102_0034555 3300048905 Bacteria 4547
240 Ga0496102_0060447 3300048905 Bacteria 3465
241 Ga0496104_0866714 3300048907 Bacteria 808
242 Ga0496108_0037714 3300048911 Plasmid 4027
243 Ga0496109_0083237 3300048912 Plasmid 2950
244 Ga0496109_0101978 3300048912 Bacteria 2664
245 Ga0496110_0013698 3300048913 Bacteria 6718
246 Ga0496111_0162931 3300048914 Bacteria 1656
247 Ga0496114_0371036 3300048917 Bacteria 1267
248 Ga0496115_0320032 3300048918 Bacteria 1269
249 nmdc:mga05p37_1776_c1 3300050507 Bacteria 25179
250 nmdc:mga05p37_751891_c1 3300050507 Bacteria 1074
251 nmdc:mga09592_36735_c1 3300050508 Bacteria 4105
252 nmdc:mga09592_9426_c1 3300050508 Bacteria 7932
253 nmdc:mga0qj67_24427_c1 3300050509 Bacteria 4658
254 nmdc:mga0qj67_7269_c1 3300050509 Bacteria 8182
255 nmdc:mga06r32_105997_c1 3300050510 Bacteria 2762
256 nmdc:mga06r32_114001_c1 3300050510 Bacteria 2661
257 nmdc:mga06r32_293935_c1 3300050510 Bacteria 1611
258 nmdc:mga08y16_13671_c1 3300050511 Bacteria 8547
259 nmdc:mga0n895_107418_c1 3300050512 Bacteria 2804
260 Ga0500591_055534 3300053115 Bacteria 1842
261 Ga0500594_0044473 3300053118 Bacteria 1228
262 Ga0500559_0000095 3300053136 Bacteria 71223
263 Ga0500573_0001417 3300053140 Bacteria 11469
264 Ga0590075_004739 3300059424 Bacteria 3218
265 Ga0157374_10327774
266 JGI25150J39212_1001792
267 JGI25151J46595_10053608
268 Ga0055526_1010071
269 Ga0070676_10007070
270 Ga0070676_10013425
271 Ga0070690_100098029
272 Ga0070690_100344317
273 Ga0070670_100008541
274 Ga0068869_100000447
275 Ga0068869_100013927
276 Ga0070680_100354991
277 Ga0070680_100579001
278 Ga0068868_100011396
279 Ga0070660_100033792
280 Ga0070689_100009929
281 Ga0070689_100147564
282 Ga0070661_100135740
283 Ga0070668_100000854
284 Ga0070673_100007927
285 Ga0070688_100299442
286 Ga0070667_100031668
287 Ga0070667_100411726
288 Ga0070714_100979572
289 Ga0070710_10020794
290 Ga0070711_100067879
291 Ga0070700_100041061
292 Ga0070694_100520218
293 Ga0070663_100288383
294 Ga0070678_100233463
295 Ga0070681_10009848
296 Ga0068867_100002655
297 Ga0070706_100192999
298 Ga0070706_100209937
299 Ga0070707_100097328
300 Ga0070707_100472705
301 Ga0070698_100553188
302 Ga0070699_100093482
303 Ga0070699_100099421
304 Ga0070679_100096090
305 Ga0070679_100266225
306 Ga0070697_100155819
307 Ga0070696_100004996
308 Ga0070696_100128631
309 Ga0070696_100471431
310 Ga0070704_100181906
311 Ga0068855_100120064
312 Ga0068855_100652112
313 Ga0068855_100774811
314 Ga0070664_100044522
315 Ga0070664_100782963
316 Ga0068857_100008028
317 Ga0068857_100013601
318 Ga0068854_100172045
319 Ga0068856_100134570
320 Ga0068859_100002546
321 Ga0068864_100002924
322 Ga0068861_100047198
323 Ga0068870_10003757
324 Ga0068863_100010895
325 Ga0068863_100206046
326 Ga0068858_100003539
327 Ga0068860_100041601
328 Ga0068862_100005405
329 Ga0070716_100016639
330 Ga0075366_10000484
331 Ga0097621_100021956
332 Ga0097621_100167403
333 Ga0075428_100001481
334 Ga0075428_100389801
335 Ga0075430_100023702
336 Ga0075431_100215768
337 Ga0075431_100305516
338 Ga0075434_100273887
339 Ga0075429_100001015
340 Ga0075429_100109528
341 Ga0097620_100002546
342 Ga0099826_10191370
343 Ga0099794_10006720
344 Ga0099794_10025438
345 Ga0099794_10029469
346 Ga0105240_10035370
347 Ga0105240_10862572
348 Ga0105247_10003423
349 Ga0114129_10000697
350 Ga0114129_10309308
351 Ga0105243_10722428
352 Ga0105242_10016920
353 Ga0105248_10001649
354 Ga0099796_10020470
355 Ga0105239_10140391
356 Ga0105239_10712028
357 Ga0157373_10102655
358 Ga0157370_10022974
359 Ga0157370_10497182
360 Ga0157369_10211967
361 Ga0157369_10294859
362 Ga0157372_10133009
363 Ga0157372_10542996
364 Ga0157375_10455045
365 Ga0163163_10001321
366 Ga0163163_10163669
367 Ga0163163_10315712
368 Ga0157379_10000172
369 Ga0163161_10156231
370 Ga0209565_1008416
371 Ga0209025_1079155
372 Ga0209564_1000662
373 Ga0209256_1047669
374 Ga0207692_10323019
375 Ga0207680_10045327
376 Ga0207643_10009648
377 Ga0207707_10105712
378 Ga0207695_10051095
379 Ga0207663_10069216
380 Ga0207657_10264434
381 Ga0207649_10150157
382 Ga0207652_10027348
383 Ga0207646_10014108
384 Ga0207694_10414949
385 Ga0207650_10036715
386 Ga0207650_10040064
387 Ga0207700_10008948
388 Ga0207664_10182311
389 Ga0207709_10325651
390 Ga0207670_10001515
391 Ga0207665_10019636
392 Ga0207689_10001457
393 Ga0207679_10089701
394 Ga0207667_10099877
395 Ga0207667_10169478
396 Ga0207668_10000941
397 Ga0207658_10026232
398 Ga0207658_10328069
399 Ga0207677_10030761
400 Ga0207703_10010856
401 Ga0207703_10098912
402 Ga0207702_10041149
403 Ga0207702_10041229
404 Ga0207641_10073785
405 Ga0207648_10011680
406 Ga0207676_10004655
407 Ga0207674_10005461
408 Ga0207674_10012019
409 Ga0207675_100005178
410 Ga0209588_1007148
411 Ga0209588_1051554
412 Ga0207428_10001519
413 Ga0268266_10161641
414 Ga0268265_10026899
415 Ga0268264_10007073
416 Ga0268264_10085405
417 Ga0265338_10038092
418 Ga0265320_10012179
419 Ga0265339_10098488
420 Ga0265327_10002761
421 Ga0316576_10146250
422 Ga0316576_10391998
423 Ga0316577_10005719
424 Ga0307406_10009745
425 Ga0316585_10017586
426 Ga0307510_10027038
427 Ga0373950_0031120
428 Ga0373944_0019622
429 Ga0373936_0013646
430 Ga0373945_0102736
431 Ga0373953_0068738
432 Ga0373943_0069028
433 Ga0316574_0013165
434 Ga0373935_0167170
435 Ga0373947_0022168
436 Ga0373937_0048521
437 Ga0316582_0016259
438 Ga0316582_0296222
439 Ga0316584_0000381
440 Ga0316584_0028734
441 Ga0373925_0230748
442 Ga0395899_0000878
443 Ga0395905_0034588
444 Ga0316581_0005347
445 Ga0439452_052981
446 Ga0450910_031391
447 Ga0439434_0129530
448 Ga0450893_0008141
449 Ga0451577_0365144
450 Ga0466969_0126423
451 Ga0466965_0051506
452 Ga0466966_0012674
453 Ga0466961_0004643
454 Ga0466959_0012981
455 Ga0451576_0223396
456 Ga0451576_0333151
457 Ga0495592_0000027
458 Ga0495603_0003437
459 Ga0495580_0006733
460 Ga0495639_0053660
461 Ga0495639_0192911
462 Ga0495662_0007001
463 Ga0495662_0074788
464 Ga0495664_0038086
465 Ga0495664_0201099
466 Ga0495618_0105109
467 Ga0495628_0001206
468 Ga0495628_0248320
469 Ga0495630_0030864
470 Ga0495642_0003736
471 Ga0495640_0015176
472 Ga0495640_0073390
473 Ga0495640_0175526
474 Ga0495586_0000822
475 Ga0495586_0013468
476 Ga0495598_0141799
477 Ga0495597_0034031
478 Ga0495645_0007344
479 Ga0495645_0022331
480 Ga0495645_0136267
481 Ga0495622_0008800
482 Ga0495667_0165843
483 Ga0495668_0020009
484 Ga0495634_0139098
485 Ga0495625_0377555
486 Ga0495661_0007336
487 Ga0495588_0009183
488 Ga0495588_0301021
489 Ga0495657_0253585
490 Ga0495599_0012008
491 Ga0495599_0157254
492 Ga0495647_0013984
493 Ga0495647_0034319
494 Ga0495647_0046506
495 Ga0495658_0036466
496 Ga0495658_0095099
497 Ga0495624_0086268
498 Ga0495674_0016165
499 Ga0495676_0060053
500 Ga0495676_0278653
501 Ga0495614_0171102
502 Ga0496101_0061941
503 Ga0496102_0034555
504 Ga0496102_0060447
505 Ga0496104_0866714
506 Ga0496108_0037714
507 Ga0496109_0083237
508 Ga0496109_0101978
509 Ga0496110_0013698
510 Ga0496111_0162931
511 Ga0496114_0371036
512 Ga0496115_0320032
513 nmdc:mga05p37_1776_c1
514 nmdc:mga05p37_751891_c1
515 nmdc:mga09592_36735_c1
516 nmdc:mga09592_9426_c1
517 nmdc:mga0qj67_24427_c1
518 nmdc:mga0qj67_7269_c1
519 nmdc:mga06r32_105997_c1
520 nmdc:mga06r32_114001_c1
521 nmdc:mga06r32_293935_c1
522 nmdc:mga08y16_13671_c1
523 nmdc:mga0n895_107418_c1
524 Ga0500591_055534
525 Ga0500594_0044473
526 Ga0500559_0000095
527 Ga0500573_0001417
528 Ga0590075_004739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

241

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

275

0.92

PF08659

KR

KR domain

47

223

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dqx-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9424 1 232
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9422 3 232
3svt-assembly1.cif.gz_B structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans 0.9419 1 230
4dqx-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9407 1 232
6pej-assembly1.cif.gz_B structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol 0.9392 3 229
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9547 6 179 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 86 188 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9438 3 166 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 3 232 3.40.50.720
af_Q62730_83_351_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 6 183 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A536WXW6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9946 10 234 GO:0016616
AF-A0A2S5TLT3-F1-model_v4 3-oxoacyl-ACP reductase 0.9923 1 234 GO:0016491
AF-L2EHJ2-F1-model_v4 deleted 0.9903 1 234
AF-A0A4R3LLZ8-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9897 10 234 GO:0016491
AF-A0A4Q5VQ43-F1-model_v4 deleted 0.9897 55 234

Map