F372486
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 264 | 208 | 526 | 641 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100000001|Ga0068856_100000001412 |
| Length | 665 |
| Sequence | MIQLMGGLLGRLSWQSFPHDAITGGGAVMIVLIGVLTVIALTYFKKWGWLYREWLSTTNHKRIGIMYIVVAVLMLLRGLADALLMRAQQATSVGASHGIIDANHFQQVFSAHGTIMIFFVAMGLMFGLINLVLPQQLGARDVAFPFLNAVSFWLFAAGMLLINASLVIGEFSAAGWLAYPPLSELKFSPGVGVDYWIWSLQIAGIGSLMSGINFMTTILKLRAVGMTMMKLPMFAWSVLGSMTLVAFAFPILTVTLTLLYLDRALGMHFFTADGGGNPMMYVNLIWSWGHPEVYILVLPAFGVFSEIVPTFSRKRLFGYASMVWAIWAIVFLSFVVWLHHFFTMGAGANVNAFFGIMTMAIAVPTGVKLFNWIFTMYRGRVRFTSPMIWFLGFVFLFTTGGVTGVMMAVPAIDFQVHNSLFLVAHFHTMIISGVVFGFMAGLTYWFPKIFGFTLHEGLGKLAAWCWIVGFVLAFGPLYVLGLMGATRRLDHYDASLGWQQLFIVAAVGVVIICIGVGLQVLQLAYSIWKRDKMRDTTGDPWDARTLEWATASPPAEYNFAILPEVDDRDAFWAAKHSKDAKATPKYEDIMVPKNTPVPLIIAACAFAAGFGFIWHIWFLVIASLFGLVVTVLVRTLSEAESERLIPASEVAAIEASWQKTRRQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 24 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 26 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 27 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 28 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 74 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 76 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 77 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 96 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 97 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 98 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 99 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 100 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 101 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 102 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 103 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 104 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 105 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 106 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 107 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 108 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 123 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 124 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 125 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 126 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 127 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 128 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 129 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 130 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 131 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 132 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 133 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 134 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 135 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 136 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 137 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 138 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 139 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 140 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 141 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 142 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 143 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 144 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 145 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 146 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 147 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 148 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 149 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 150 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 151 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 152 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 153 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 154 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 155 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 156 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 157 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 158 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 159 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 160 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 161 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 162 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 163 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 164 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 165 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 166 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 167 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 168 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 169 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 170 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 171 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 172 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 173 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 174 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 175 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 176 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 177 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 178 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 179 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 180 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 181 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 182 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 183 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 184 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 185 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 186 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 187 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 188 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 189 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 190 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 191 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 192 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 193 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 194 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 195 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 196 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 197 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 198 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 199 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 200 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 201 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 202 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 203 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 204 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 205 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 206 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 207 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 208 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.97 |
| Metatranscriptomes | 0.76 |
| Isolates | 27.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.05 |
| Nodule | 0 |
| Rhizoplane | 3.79 |
| Rhizosphere | 62.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068856_100000001 | 3300005614 | Bacteria | 565602 |
| 2 | JGI24741J21665_1000514 | 3300001915 | Bacteria | 11779 |
| 3 | JGI25151J46595_10000061 | 3300003187 | Bacteria | 146828 |
| 4 | JGI25151J46595_10023521 | 3300003187 | Bacteria | 2537 |
| 5 | rootH1_10002936 | 3300003316 | Bacteria | 45055 |
| 6 | rootH1_10005816 | 3300003316 | Bacteria | 7615 |
| 7 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 8 | rootL2_10015917 | 3300003322 | Bacteria | 9916 |
| 9 | rootL2_10038513 | 3300003322 | Bacteria | 18689 |
| 10 | Ga0006562J51391_1001615 | 3300003578 | Bacteria | 34890 |
| 11 | Ga0006562J51391_1004137 | 3300003578 | Bacteria | 6740 |
| 12 | Ga0055538_1000230 | 3300003751 | Bacteria | 31225 |
| 13 | Ga0055532_1000004 | 3300003758 | Bacteria | 471824 |
| 14 | Ga0055532_1000062 | 3300003758 | Bacteria | 148330 |
| 15 | Ga0055528_1001314 | 3300003790 | Bacteria | 15551 |
| 16 | Ga0065715_10098742 | 3300005293 | Bacteria | 3504 |
| 17 | Ga0070658_10000133 | 3300005327 | Bacteria | 65613 |
| 18 | Ga0070658_10004678 | 3300005327 | Bacteria | 11127 |
| 19 | Ga0070683_100000112 | 3300005329 | Bacteria | 53123 |
| 20 | Ga0070683_100000505 | 3300005329 | Bacteria | 27371 |
| 21 | Ga0070680_100010777 | 3300005336 | Bacteria | 7056 |
| 22 | Ga0070682_100001074 | 3300005337 | Bacteria | 15750 |
| 23 | Ga0070682_100002842 | 3300005337 | Bacteria | 9591 |
| 24 | Ga0070660_100000837 | 3300005339 | Bacteria | 20454 |
| 25 | Ga0070659_100034090 | 3300005366 | Bacteria | 3959 |
| 26 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 27 | Ga0070679_100000257 | 3300005530 | Bacteria | 44414 |
| 28 | Ga0070679_100006394 | 3300005530 | Bacteria | 10972 |
| 29 | Ga0070684_100000049 | 3300005535 | Bacteria | 79768 |
| 30 | Ga0070684_100043297 | 3300005535 | Bacteria | 3887 |
| 31 | Ga0068855_100001288 | 3300005563 | Bacteria | 31095 |
| 32 | Ga0068855_100003266 | 3300005563 | Bacteria | 19846 |
| 33 | Ga0068856_100041933 | 3300005614 | Bacteria | 4500 |
| 34 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 35 | Ga0068860_100006387 | 3300005843 | Bacteria | 11833 |
| 36 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 37 | Ga0081455_10000003 | 3300005937 | Bacteria | 367763 |
| 38 | Ga0075365_10000001 | 3300006038 | Bacteria | 371589 |
| 39 | Ga0075365_10019896 | 3300006038 | Bacteria | 4153 |
| 40 | Ga0075364_10000342 | 3300006051 | Bacteria | 23182 |
| 41 | Ga0075369_10000020 | 3300006186 | Bacteria | 45510 |
| 42 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 43 | Ga0097621_100000082 | 3300006237 | Bacteria | 50678 |
| 44 | Ga0068871_100000177 | 3300006358 | Bacteria | 43038 |
| 45 | Ga0105251_10013402 | 3300009011 | Bacteria | 4589 |
| 46 | Ga0105244_10006746 | 3300009036 | Bacteria | 7384 |
| 47 | Ga0105240_10002332 | 3300009093 | Bacteria | 30702 |
| 48 | Ga0105240_10013030 | 3300009093 | Bacteria | 11448 |
| 49 | Ga0105240_10015410 | 3300009093 | Bacteria | 10392 |
| 50 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 51 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 52 | Ga0105243_10002865 | 3300009148 | Bacteria | 14301 |
| 53 | Ga0105241_10000225 | 3300009174 | Bacteria | 42642 |
| 54 | Ga0105241_10005401 | 3300009174 | Bacteria | 9448 |
| 55 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 56 | Ga0105237_10001685 | 3300009545 | Bacteria | 28614 |
| 57 | Ga0105238_10024889 | 3300009551 | Bacteria | 6100 |
| 58 | Ga0105249_10007441 | 3300009553 | Bacteria | 9553 |
| 59 | Ga0105028_100019 | 3300009993 | Bacteria | 20066 |
| 60 | Ga0105028_101421 | 3300009993 | Bacteria | 2529 |
| 61 | Ga0105239_10016668 | 3300010375 | Bacteria | 8122 |
| 62 | Ga0105246_10038406 | 3300011119 | Bacteria | 3219 |
| 63 | Ga0157373_10000061 | 3300013100 | Bacteria | 95718 |
| 64 | Ga0157373_10028193 | 3300013100 | Bacteria | 4051 |
| 65 | Ga0157371_10000176 | 3300013102 | Bacteria | 93047 |
| 66 | Ga0157371_10000389 | 3300013102 | Bacteria | 55195 |
| 67 | Ga0157369_10000063 | 3300013105 | Bacteria | 147327 |
| 68 | Ga0157369_10000413 | 3300013105 | Bacteria | 56589 |
| 69 | Ga0157374_10000018 | 3300013296 | Bacteria | 286683 |
| 70 | Ga0157378_10006379 | 3300013297 | Bacteria | 10312 |
| 71 | Ga0157372_10018029 | 3300013307 | Bacteria | 7589 |
| 72 | Ga0157372_10101441 | 3300013307 | Bacteria | 3285 |
| 73 | Ga0209784_100089 | 3300025224 | Bacteria | 119510 |
| 74 | Ga0209147_100010 | 3300025229 | Bacteria | 741391 |
| 75 | Ga0209147_100993 | 3300025229 | Bacteria | 12315 |
| 76 | Ga0209147_103014 | 3300025229 | Bacteria | 3585 |
| 77 | Ga0209130_1000293 | 3300025284 | Bacteria | 60879 |
| 78 | Ga0209676_1000561 | 3300025292 | Bacteria | 56143 |
| 79 | Ga0209025_1000011 | 3300025294 | Bacteria | 976387 |
| 80 | Ga0209025_1004577 | 3300025294 | Bacteria | 11878 |
| 81 | Ga0209025_1005601 | 3300025294 | Bacteria | 10144 |
| 82 | Ga0207426_1007106 | 3300025302 | Bacteria | 4735 |
| 83 | Ga0207655_1000836 | 3300025728 | Bacteria | 33126 |
| 84 | Ga0207713_1022818 | 3300025735 | Bacteria | 2960 |
| 85 | Ga0207713_1023406 | 3300025735 | Bacteria | 2907 |
| 86 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 87 | Ga0207705_10079470 | 3300025909 | Bacteria | 2388 |
| 88 | Ga0207654_10002921 | 3300025911 | Bacteria | 8666 |
| 89 | Ga0207654_10004346 | 3300025911 | Bacteria | 7140 |
| 90 | Ga0207695_10021060 | 3300025913 | Bacteria | 7448 |
| 91 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 92 | Ga0207671_10000014 | 3300025914 | Bacteria | 461481 |
| 93 | Ga0207660_10001981 | 3300025917 | Bacteria | 13653 |
| 94 | Ga0207657_10002660 | 3300025919 | Bacteria | 19285 |
| 95 | Ga0207652_10000322 | 3300025921 | Bacteria | 49586 |
| 96 | Ga0207652_10010483 | 3300025921 | Bacteria | 7459 |
| 97 | Ga0207652_10011316 | 3300025921 | Bacteria | 7189 |
| 98 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 99 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 100 | Ga0207661_10000077 | 3300025944 | Bacteria | 67190 |
| 101 | Ga0207661_10000129 | 3300025944 | Bacteria | 47940 |
| 102 | Ga0207667_10021980 | 3300025949 | Bacteria | 7059 |
| 103 | Ga0207667_10069023 | 3300025949 | Bacteria | 3679 |
| 104 | Ga0207712_10000432 | 3300025961 | Bacteria | 35770 |
| 105 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 106 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 107 | Ga0207674_10008133 | 3300026116 | Bacteria | 12159 |
| 108 | Ga0207674_10021774 | 3300026116 | Bacteria | 6898 |
| 109 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 110 | Ga0268264_10002058 | 3300028381 | Bacteria | 17945 |
| 111 | Ga0265327_10000025 | 3300031251 | Bacteria | 380054 |
| 112 | Ga0265314_10032595 | 3300031711 | Bacteria | 3831 |
| 113 | Ga0307406_10000002 | 3300031901 | Bacteria | 255753 |
| 114 | Ga0307416_100014937 | 3300032002 | Bacteria | 5343 |
| 115 | Ga0495627_000107 | 3300046453 | Bacteria | 102518 |
| 116 | Ga0495629_0050726 | 3300046459 | Bacteria | 2906 |
| 117 | Ga0495653_0000453 | 3300046463 | Bacteria | 31916 |
| 118 | Ga0495585_0002044 | 3300046492 | Bacteria | 14882 |
| 119 | Ga0495607_0003770 | 3300046501 | Bacteria | 11462 |
| 120 | Ga0495607_0014189 | 3300046501 | Bacteria | 5198 |
| 121 | Ga0495606_0002764 | 3300046507 | Bacteria | 19666 |
| 122 | Ga0495654_0000536 | 3300046530 | Bacteria | 30653 |
| 123 | Ga0495622_0000105 | 3300046557 | Bacteria | 73195 |
| 124 | Ga0495661_0000167 | 3300046665 | Bacteria | 78075 |
| 125 | Ga0495588_0000235 | 3300046674 | Bacteria | 48543 |
| 126 | Ga0495658_0000546 | 3300046683 | Bacteria | 20551 |
| 127 | Ga0495671_0006978 | 3300046692 | Bacteria | 6477 |
| 128 | Ga0495649_0001296 | 3300046694 | Bacteria | 19122 |
| 129 | Ga0495649_0001968 | 3300046694 | Bacteria | 14897 |
| 130 | Ga0495600_0011021 | 3300046809 | Bacteria | 5625 |
| 131 | Ga0495672_0000016 | 3300047320 | Bacteria | 500601 |
| 132 | Ga0495676_0003236 | 3300047321 | Bacteria | 14726 |
| 133 | Ga0495683_0000134 | 3300047323 | Bacteria | 72364 |
| 134 | Ga0495683_0008666 | 3300047323 | Bacteria | 5430 |
| 135 | Ga0496100_0006063 | 3300048903 | Bacteria | 6566 |
| 136 | Ga0496104_0000838 | 3300048907 | Bacteria | 26515 |
| 137 | Ga0496106_0008177 | 3300048909 | Bacteria | 7728 |
| 138 | Ga0496107_0014062 | 3300048910 | Bacteria | 5602 |
| 139 | Ga0496110_0003880 | 3300048913 | Bacteria | 11508 |
| 140 | Ga0496111_0015018 | 3300048914 | Bacteria | 5305 |
| 141 | Ga0496112_0004581 | 3300048915 | Bacteria | 11752 |
| 142 | Ga0496113_0071193 | 3300048916 | Bacteria | 2645 |
| 143 | Ga0496115_0000007 | 3300048918 | Bacteria | 244991 |
| 144 | Ga0496117_0016480 | 3300048920 | Bacteria | 6237 |
| 145 | Ga0496119_0003511 | 3300048922 | Bacteria | 16206 |
| 146 | Ga0496122_0004202 | 3300048925 | Bacteria | 18111 |
| 147 | Ga0496123_0029991 | 3300048926 | Bacteria | 3991 |
| 148 | Ga0496126_0010969 | 3300048929 | Bacteria | 9434 |
| 149 | Ga0501031_0000276 | 3300049568 | Bacteria | 29045 |
| 150 | Ga0501031_0011085 | 3300049568 | Bacteria | 5875 |
| 151 | Ga0501032_0002206 | 3300049569 | Bacteria | 15326 |
| 152 | Ga0501032_0016460 | 3300049569 | Bacteria | 5201 |
| 153 | Ga0501034_0046856 | 3300049571 | Bacteria | 4368 |
| 154 | Ga0501037_0000037 | 3300049573 | Bacteria | 124097 |
| 155 | Ga0501037_0000113 | 3300049573 | Bacteria | 75610 |
| 156 | Ga0501037_0004473 | 3300049573 | Bacteria | 10159 |
| 157 | Ga0501038_0085437 | 3300049574 | Bacteria | 2653 |
| 158 | Ga0501039_0000032 | 3300049575 | Bacteria | 129624 |
| 159 | Ga0501040_0032744 | 3300049576 | Bacteria | 3518 |
| 160 | Ga0501043_0000001 | 3300049579 | Bacteria | 479879 |
| 161 | Ga0501043_0000205 | 3300049579 | Bacteria | 54247 |
| 162 | Ga0501046_0000038 | 3300049580 | Bacteria | 159193 |
| 163 | Ga0501046_0029051 | 3300049580 | Bacteria | 4498 |
| 164 | Ga0501047_0000355 | 3300049581 | Bacteria | 51922 |
| 165 | Ga0501048_0001019 | 3300049582 | Bacteria | 20937 |
| 166 | Ga0501073_0068439 | 3300049589 | Bacteria | 2474 |
| 167 | Ga0501035_0001763 | 3300049822 | Bacteria | 21851 |
| 168 | Ga0501044_0008259 | 3300049823 | Bacteria | 11415 |
| 169 | nmdc:mga00v17_3382_c1 | 3300050491 | Bacteria | 8234 |
| 170 | nmdc:mga0yw44_14828_c1 | 3300050492 | Bacteria | 4153 |
| 171 | nmdc:mga0yw44_1_c1 | 3300050492 | Bacteria | 702221 |
| 172 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 173 | nmdc:mga0sz30_7258_c1 | 3300050516 | Bacteria | 4153 |
| 174 | nmdc:mga0sz30_8_c1 | 3300050516 | Bacteria | 107909 |
| 175 | Ga0500643_000010 | 3300053087 | Bacteria | 408084 |
| 176 | Ga0500643_000133 | 3300053087 | Bacteria | 75773 |
| 177 | Ga0500643_001206 | 3300053087 | Bacteria | 15437 |
| 178 | Ga0500644_0001442 | 3300053088 | Bacteria | 6285 |
| 179 | Ga0500583_0002826 | 3300053092 | Bacteria | 5323 |
| 180 | Ga0500583_0003118 | 3300053092 | Bacteria | 5137 |
| 181 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 182 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 183 | Ga0500555_000006 | 3300053103 | Bacteria | 304416 |
| 184 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 185 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 186 | Ga0500614_006936 | 3300053123 | Bacteria | 2381 |
| 187 | Ga0500577_0000489 | 3300053142 | Bacteria | 10181 |
| 188 | Ga0500579_000595 | 3300053143 | Bacteria | 20855 |
| 189 | Ga0500616_0000055 | 3300053153 | Bacteria | 289080 |
| 190 | Ga0500649_000010 | 3300053722 | Bacteria | 91784 |
| 191 | Ga0500611_000620 | 3300053727 | Bacteria | 3618 |
| 192 | 2511701540 | 2511231119 | Bacteria | 4019861 |
| 193 | 2540608740 | 2540341094 | Bacteria | 4061186 |
| 194 | 2545557737 | 2545555800 | Bacteria | 4222588 |
| 195 | 2553394114 | 2551306519 | Bacteria | 5465154 |
| 196 | 2555468699 | 2554235283 | Bacteria | 3683090 |
| 197 | 2578932128 | 2576861599 | Bacteria | 4217202 |
| 198 | 2595088923 | 2593339131 | Bacteria | 5116855 |
| 199 | 2631983285 | 2630968484 | Bacteria | 3876276 |
| 200 | 2644708276 | 2643221729 | Bacteria | 6621700 |
| 201 | 2644714874 | 2643221730 | Bacteria | 6523787 |
| 202 | 2644738512 | 2643221735 | Bacteria | 3676263 |
| 203 | 2651531141 | 2648501850 | Bacteria | 3975476 |
| 204 | 2674421522 | 2671180844 | Bacteria | 4164150 |
| 205 | 2685148619 | 2684622632 | Bacteria | 5380049 |
| 206 | 2686998834 | 2684623153 | Bacteria | 3878815 |
| 207 | 2687500130 | 2687453109 | Bacteria | 3860091 |
| 208 | 2695629497 | 2695420354 | Bacteria | 3922431 |
| 209 | 2698324553 | 2695420987 | Bacteria | 6152737 |
| 210 | 2705992549 | 2703719227 | Bacteria | 5631989 |
| 211 | 2717914807 | 2716884898 | Bacteria | 3928789 |
| 212 | 2721503997 | 2718218445 | Bacteria | 5113413 |
| 213 | 2739158226 | 2738541358 | Bacteria | 5932299 |
| 214 | 2739211363 | 2738543006 | Bacteria | 5904091 |
| 215 | 2739268711 | 2738543017 | Bacteria | 4271950 |
| 216 | 2757564664 | 2757320391 | Bacteria | 4746095 |
| 217 | 2777763117 | 2775507177 | Bacteria | 4384303 |
| 218 | 2809053881 | 2808606399 | Bacteria | 4021018 |
| 219 | 2812314023 | 2811994870 | Bacteria | 3776934 |
| 220 | 2819583420 | 2818991443 | Bacteria | 6598732 |
| 221 | 2819723039 | 2818991468 | Bacteria | 3723169 |
| 222 | 2823530071 | 2823526263 | Bacteria | 3765752 |
| 223 | 2860841559 | 2860837431 | Bacteria | 4202080 |
| 224 | 2877772424 | 2877768649 | Bacteria | 3957164 |
| 225 | 2880173273 | 2880169592 | Bacteria | 3900066 |
| 226 | 2897113542 | 2897109615 | Bacteria | 4009619 |
| 227 | 2904563136 | 2904560550 | Bacteria | 4029838 |
| 228 | 2908667301 | 2908665501 | Bacteria | 3678115 |
| 229 | 2916974696 | 2916971899 | Bacteria | 4250608 |
| 230 | 2919094684 | 2919093281 | Bacteria | 3660974 |
| 231 | 2919417519 | 2919414237 | Bacteria | 5429133 |
| 232 | 2919418442 | 2919414237 | Bacteria | 5429133 |
| 233 | 2919727243 | 2919726948 | Bacteria | 3696050 |
| 234 | 2929233867 | 2929233124 | Bacteria | 5948380 |
| 235 | 2936344143 | 2936340661 | Bacteria | 5139038 |
| 236 | 2936366000 | 2936361878 | Bacteria | 5632809 |
| 237 | 2936366030 | 2936361878 | Bacteria | 5632809 |
| 238 | 2938918036 | 2938917290 | Bacteria | 5914775 |
| 239 | 2947427361 | 2947426588 | Bacteria | 5357194 |
| 240 | 2954776521 | 2954773129 | Bacteria | 3741715 |
| 241 | 2956898851 | 2956897341 | Bacteria | 5447711 |
| 242 | 2962294799 | 2962290636 | Bacteria | 4072939 |
| 243 | 2965761928 | 2965761152 | Bacteria | 5806513 |
| 244 | 2969140717 | 2969136845 | Bacteria | 3923176 |
| 245 | 2969144996 | 2969141011 | Bacteria | 4118468 |
| 246 | 2969770043 | 2969765954 | Bacteria | 4216713 |
| 247 | 2969770803 | 2969770375 | Bacteria | 4271280 |
| 248 | 2971897119 | 2971893375 | Bacteria | 3929648 |
| 249 | 2979084355 | 2979083700 | Bacteria | 5894929 |
| 250 | 2980496565 | 2980492589 | Bacteria | 4072961 |
| 251 | 3005716020 | 3005710791 | Bacteria | 7622528 |
| 252 | 3006883261 | 3006879489 | Bacteria | 4064221 |
| 253 | 3006977426 | 3006973921 | Bacteria | 4423788 |
| 254 | 8022621807 | 8022621104 | Bacteria | 5241040 |
| 255 | 8022632644 | 8022630665 | Bacteria | 3886130 |
| 256 | 8022655516 | 8022653035 | Bacteria | 4035078 |
| 257 | 8022796091 | 8022792930 | Bacteria | 5693794 |
| 258 | 8023438800 | 8023438354 | Bacteria | 5779374 |
| 259 | 8023450486 | 8023444577 | Bacteria | 5661597 |
| 260 | 8051953966 | 8051952484 | Bacteria | 3926774 |
| 261 | 8052175975 | 8052174270 | Bacteria | 3881265 |
| 262 | 8054931721 | 8054929484 | Bacteria | 5599761 |
| 263 | 8057583427 | 8057582654 | Bacteria | 5218944 |
| 264 | Ga0068856_100000001 | |||
| 265 | JGI24741J21665_1000514 | |||
| 266 | JGI25151J46595_10000061 | |||
| 267 | JGI25151J46595_10023521 | |||
| 268 | rootH1_10002936 | |||
| 269 | rootH1_10005816 | |||
| 270 | rootH2_10000244 | |||
| 271 | rootL2_10015917 | |||
| 272 | rootL2_10038513 | |||
| 273 | Ga0006562J51391_1001615 | |||
| 274 | Ga0006562J51391_1004137 | |||
| 275 | Ga0055538_1000230 | |||
| 276 | Ga0055532_1000004 | |||
| 277 | Ga0055532_1000062 | |||
| 278 | Ga0055528_1001314 | |||
| 279 | Ga0065715_10098742 | |||
| 280 | Ga0070658_10000133 | |||
| 281 | Ga0070658_10004678 | |||
| 282 | Ga0070683_100000112 | |||
| 283 | Ga0070683_100000505 | |||
| 284 | Ga0070680_100010777 | |||
| 285 | Ga0070682_100001074 | |||
| 286 | Ga0070682_100002842 | |||
| 287 | Ga0070660_100000837 | |||
| 288 | Ga0070659_100034090 | |||
| 289 | Ga0070667_100000001 | |||
| 290 | Ga0070679_100000257 | |||
| 291 | Ga0070679_100006394 | |||
| 292 | Ga0070684_100000049 | |||
| 293 | Ga0070684_100043297 | |||
| 294 | Ga0068855_100001288 | |||
| 295 | Ga0068855_100003266 | |||
| 296 | Ga0068856_100041933 | |||
| 297 | Ga0068852_100000001 | |||
| 298 | Ga0068860_100006387 | |||
| 299 | Ga0081455_10000001 | |||
| 300 | Ga0081455_10000003 | |||
| 301 | Ga0075365_10000001 | |||
| 302 | Ga0075365_10019896 | |||
| 303 | Ga0075364_10000342 | |||
| 304 | Ga0075369_10000020 | |||
| 305 | Ga0075366_10000001 | |||
| 306 | Ga0097621_100000082 | |||
| 307 | Ga0068871_100000177 | |||
| 308 | Ga0105251_10013402 | |||
| 309 | Ga0105244_10006746 | |||
| 310 | Ga0105240_10002332 | |||
| 311 | Ga0105240_10013030 | |||
| 312 | Ga0105240_10015410 | |||
| 313 | Ga0105245_10000001 | |||
| 314 | Ga0105245_10000002 | |||
| 315 | Ga0105243_10002865 | |||
| 316 | Ga0105241_10000225 | |||
| 317 | Ga0105241_10005401 | |||
| 318 | Ga0105237_10000002 | |||
| 319 | Ga0105237_10001685 | |||
| 320 | Ga0105238_10024889 | |||
| 321 | Ga0105249_10007441 | |||
| 322 | Ga0105028_100019 | |||
| 323 | Ga0105028_101421 | |||
| 324 | Ga0105239_10016668 | |||
| 325 | Ga0105246_10038406 | |||
| 326 | Ga0157373_10000061 | |||
| 327 | Ga0157373_10028193 | |||
| 328 | Ga0157371_10000176 | |||
| 329 | Ga0157371_10000389 | |||
| 330 | Ga0157369_10000063 | |||
| 331 | Ga0157369_10000413 | |||
| 332 | Ga0157374_10000018 | |||
| 333 | Ga0157378_10006379 | |||
| 334 | Ga0157372_10018029 | |||
| 335 | Ga0157372_10101441 | |||
| 336 | Ga0209784_100089 | |||
| 337 | Ga0209147_100010 | |||
| 338 | Ga0209147_100993 | |||
| 339 | Ga0209147_103014 | |||
| 340 | Ga0209130_1000293 | |||
| 341 | Ga0209676_1000561 | |||
| 342 | Ga0209025_1000011 | |||
| 343 | Ga0209025_1004577 | |||
| 344 | Ga0209025_1005601 | |||
| 345 | Ga0207426_1007106 | |||
| 346 | Ga0207655_1000836 | |||
| 347 | Ga0207713_1022818 | |||
| 348 | Ga0207713_1023406 | |||
| 349 | Ga0207705_10000011 | |||
| 350 | Ga0207705_10079470 | |||
| 351 | Ga0207654_10002921 | |||
| 352 | Ga0207654_10004346 | |||
| 353 | Ga0207695_10021060 | |||
| 354 | Ga0207671_10000008 | |||
| 355 | Ga0207671_10000014 | |||
| 356 | Ga0207660_10001981 | |||
| 357 | Ga0207657_10002660 | |||
| 358 | Ga0207652_10000322 | |||
| 359 | Ga0207652_10010483 | |||
| 360 | Ga0207652_10011316 | |||
| 361 | Ga0207687_10000001 | |||
| 362 | Ga0207687_10000004 | |||
| 363 | Ga0207661_10000077 | |||
| 364 | Ga0207661_10000129 | |||
| 365 | Ga0207667_10021980 | |||
| 366 | Ga0207667_10069023 | |||
| 367 | Ga0207712_10000432 | |||
| 368 | Ga0207658_10000003 | |||
| 369 | Ga0207702_10000001 | |||
| 370 | Ga0207674_10008133 | |||
| 371 | Ga0207674_10021774 | |||
| 372 | Ga0207698_10000001 | |||
| 373 | Ga0268264_10002058 | |||
| 374 | Ga0265327_10000025 | |||
| 375 | Ga0265314_10032595 | |||
| 376 | Ga0307406_10000002 | |||
| 377 | Ga0307416_100014937 | |||
| 378 | Ga0495627_000107 | |||
| 379 | Ga0495629_0050726 | |||
| 380 | Ga0495653_0000453 | |||
| 381 | Ga0495585_0002044 | |||
| 382 | Ga0495607_0003770 | |||
| 383 | Ga0495607_0014189 | |||
| 384 | Ga0495606_0002764 | |||
| 385 | Ga0495654_0000536 | |||
| 386 | Ga0495622_0000105 | |||
| 387 | Ga0495661_0000167 | |||
| 388 | Ga0495588_0000235 | |||
| 389 | Ga0495658_0000546 | |||
| 390 | Ga0495671_0006978 | |||
| 391 | Ga0495649_0001296 | |||
| 392 | Ga0495649_0001968 | |||
| 393 | Ga0495600_0011021 | |||
| 394 | Ga0495672_0000016 | |||
| 395 | Ga0495676_0003236 | |||
| 396 | Ga0495683_0000134 | |||
| 397 | Ga0495683_0008666 | |||
| 398 | Ga0496100_0006063 | |||
| 399 | Ga0496104_0000838 | |||
| 400 | Ga0496106_0008177 | |||
| 401 | Ga0496107_0014062 | |||
| 402 | Ga0496110_0003880 | |||
| 403 | Ga0496111_0015018 | |||
| 404 | Ga0496112_0004581 | |||
| 405 | Ga0496113_0071193 | |||
| 406 | Ga0496115_0000007 | |||
| 407 | Ga0496117_0016480 | |||
| 408 | Ga0496119_0003511 | |||
| 409 | Ga0496122_0004202 | |||
| 410 | Ga0496123_0029991 | |||
| 411 | Ga0496126_0010969 | |||
| 412 | Ga0501031_0000276 | |||
| 413 | Ga0501031_0011085 | |||
| 414 | Ga0501032_0002206 | |||
| 415 | Ga0501032_0016460 | |||
| 416 | Ga0501034_0046856 | |||
| 417 | Ga0501037_0000037 | |||
| 418 | Ga0501037_0000113 | |||
| 419 | Ga0501037_0004473 | |||
| 420 | Ga0501038_0085437 | |||
| 421 | Ga0501039_0000032 | |||
| 422 | Ga0501040_0032744 | |||
| 423 | Ga0501043_0000001 | |||
| 424 | Ga0501043_0000205 | |||
| 425 | Ga0501046_0000038 | |||
| 426 | Ga0501046_0029051 | |||
| 427 | Ga0501047_0000355 | |||
| 428 | Ga0501048_0001019 | |||
| 429 | Ga0501073_0068439 | |||
| 430 | Ga0501035_0001763 | |||
| 431 | Ga0501044_0008259 | |||
| 432 | nmdc:mga00v17_3382_c1 | |||
| 433 | nmdc:mga0yw44_14828_c1 | |||
| 434 | nmdc:mga0yw44_1_c1 | |||
| 435 | nmdc:mga0k408_1_c1 | |||
| 436 | nmdc:mga0sz30_7258_c1 | |||
| 437 | nmdc:mga0sz30_8_c1 | |||
| 438 | Ga0500643_000010 | |||
| 439 | Ga0500643_000133 | |||
| 440 | Ga0500643_001206 | |||
| 441 | Ga0500644_0001442 | |||
| 442 | Ga0500583_0002826 | |||
| 443 | Ga0500583_0003118 | |||
| 444 | Ga0500566_0000001 | |||
| 445 | Ga0500650_0000001 | |||
| 446 | Ga0500555_000006 | |||
| 447 | Ga0500594_0000001 | |||
| 448 | Ga0500614_000001 | |||
| 449 | Ga0500614_006936 | |||
| 450 | Ga0500577_0000489 | |||
| 451 | Ga0500579_000595 | |||
| 452 | Ga0500616_0000055 | |||
| 453 | Ga0500649_000010 | |||
| 454 | Ga0500611_000620 | |||
| 455 | 2511701540 | |||
| 456 | 2540608740 | |||
| 457 | 2545557737 | |||
| 458 | 2553394114 | |||
| 459 | 2555468699 | |||
| 460 | 2578932128 | |||
| 461 | 2595088923 | |||
| 462 | 2631983285 | |||
| 463 | 2644708276 | |||
| 464 | 2644714874 | |||
| 465 | 2644738512 | |||
| 466 | 2651531141 | |||
| 467 | 2674421522 | |||
| 468 | 2685148619 | |||
| 469 | 2686998834 | |||
| 470 | 2687500130 | |||
| 471 | 2695629497 | |||
| 472 | 2698324553 | |||
| 473 | 2705992549 | |||
| 474 | 2717914807 | |||
| 475 | 2721503997 | |||
| 476 | 2739158226 | |||
| 477 | 2739211363 | |||
| 478 | 2739268711 | |||
| 479 | 2757564664 | |||
| 480 | 2777763117 | |||
| 481 | 2809053881 | |||
| 482 | 2812314023 | |||
| 483 | 2819583420 | |||
| 484 | 2819723039 | |||
| 485 | 2823530071 | |||
| 486 | 2860841559 | |||
| 487 | 2877772424 | |||
| 488 | 2880173273 | |||
| 489 | 2897113542 | |||
| 490 | 2904563136 | |||
| 491 | 2908667301 | |||
| 492 | 2916974696 | |||
| 493 | 2919094684 | |||
| 494 | 2919417519 | |||
| 495 | 2919418442 | |||
| 496 | 2919727243 | |||
| 497 | 2929233867 | |||
| 498 | 2936344143 | |||
| 499 | 2936366000 | |||
| 500 | 2936366030 | |||
| 501 | 2938918036 | |||
| 502 | 2947427361 | |||
| 503 | 2954776521 | |||
| 504 | 2956898851 | |||
| 505 | 2962294799 | |||
| 506 | 2965761928 | |||
| 507 | 2969140717 | |||
| 508 | 2969144996 | |||
| 509 | 2969770043 | |||
| 510 | 2969770803 | |||
| 511 | 2971897119 | |||
| 512 | 2979084355 | |||
| 513 | 2980496565 | |||
| 514 | 3005716020 | |||
| 515 | 3006883261 | |||
| 516 | 3006977426 | |||
| 517 | 8022621807 | |||
| 518 | 8022632644 | |||
| 519 | 8022655516 | |||
| 520 | 8022796091 | |||
| 521 | 8023438800 | |||
| 522 | 8023450486 | |||
| 523 | 8051953966 | |||
| 524 | 8052175975 | |||
| 525 | 8054931721 | |||
| 526 | 8057583427 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8f68-assembly1.cif.gz_A | e. coli cytochrome bo3 ubiquinol oxidase monomer | 0.9782 | 2 | 629 |
| 8f68-assembly1.cif.gz_A | e. coli cytochrome bo3 ubiquinol oxidase monomer | 0.966 | 2 | 629 |
| 7o3e-assembly1.cif.gz_a | murine supercomplex ciii2civ in the intermediate locked conformation | 0.9609 | 24 | 530 |
| 7vuw-assembly2.cif.gz_N | bovine heart cytochrome c oxidase in the cyanide-bound fully oxidized state at 50 k | 0.9607 | 24 | 538 |
| 1fft-assembly2.cif.gz_F | the structure of ubiquinol oxidase from escherichia coli | 0.9599 | 30 | 530 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZK0_30_556_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9693 | 9 | 534 | 1.20.210.10 |
| af_P9WP71_20_544_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9665 | 26 | 543 | 1.20.210.10 |
| 2yevD01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9616 | 18 | 544 | 1.20.210.10 |
| af_Q2FZK0_30_556_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9602 | 9 | 534 | 1.20.210.10 |
| 2yevD01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9598 | 18 | 544 | 1.20.210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A379WEL2-F1-model_v4 | Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome o ubiquinol oxidase subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) | 0.9787 | 38 | 629 |
GO:0004129
GO:0005886 GO:0009060 GO:0009486 GO:0015990 GO:0016682 GO:0020037 GO:0022904 |
| AF-A0A895ZQP9-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.976 | 185 | 439 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |
| AF-A0A359KEF2-F1-model_v4 | Cytochrome o ubiquinol oxidase subunit I | 0.9749 | 17 | 256 |
GO:0004129
GO:0005886 GO:0009060 GO:0009486 GO:0015990 GO:0020037 GO:0022904 |
| AF-A0A446IY38-F1-model_v4 | deleted | 0.9749 | 192 | 441 |
|
| AF-A0A172UXP0-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9734 | 356 | 501 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |