F372486

General Info

Members Datasets Scaffolds Average Seq Length
264 208 526 641

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100000001|Ga0068856_100000001412
Length 665
Sequence MIQLMGGLLGRLSWQSFPHDAITGGGAVMIVLIGVLTVIALTYFKKWGWLYREWLSTTNHKRIGIMYIVVAVLMLLRGLADALLMRAQQATSVGASHGIIDANHFQQVFSAHGTIMIFFVAMGLMFGLINLVLPQQLGARDVAFPFLNAVSFWLFAAGMLLINASLVIGEFSAAGWLAYPPLSELKFSPGVGVDYWIWSLQIAGIGSLMSGINFMTTILKLRAVGMTMMKLPMFAWSVLGSMTLVAFAFPILTVTLTLLYLDRALGMHFFTADGGGNPMMYVNLIWSWGHPEVYILVLPAFGVFSEIVPTFSRKRLFGYASMVWAIWAIVFLSFVVWLHHFFTMGAGANVNAFFGIMTMAIAVPTGVKLFNWIFTMYRGRVRFTSPMIWFLGFVFLFTTGGVTGVMMAVPAIDFQVHNSLFLVAHFHTMIISGVVFGFMAGLTYWFPKIFGFTLHEGLGKLAAWCWIVGFVLAFGPLYVLGLMGATRRLDHYDASLGWQQLFIVAAVGVVIICIGVGLQVLQLAYSIWKRDKMRDTTGDPWDARTLEWATASPPAEYNFAILPEVDDRDAFWAAKHSKDAKATPKYEDIMVPKNTPVPLIIAACAFAAGFGFIWHIWFLVIASLFGLVVTVLVRTLSEAESERLIPASEVAAIEASWQKTRRQRA

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
88 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
130 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
131 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
132 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
133 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
134 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
135 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
138 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
139 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
140 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
141 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
142 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
143 2554235283 Bacillus safensis VK Isolate Rhizosphere
144 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
145 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
146 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
147 2643221729 Bacillus sp. Root11 Isolate Unclassified
148 2643221730 Bacillus sp. Root131 Isolate Unclassified
149 2643221735 Bacillus sp. Root920 Isolate Unclassified
150 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
151 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
152 2684622632 Bacillus cereus 905 Isolate Unclassified
153 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
154 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
155 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
156 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
157 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
158 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
159 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
160 2738541358 Bacillus sp. OV752 Isolate Unclassified
161 2738543006 Bacillus sp. OK077 Isolate Unclassified
162 2738543017 Bacillus sp. OV186 Isolate Unclassified
163 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
164 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
165 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
166 2811994870 Bacillus sp. JB4 Isolate Unclassified
167 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
168 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
169 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
170 2860837431 Bacillus sp. WR11 Isolate Unclassified
171 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
172 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
173 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
174 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
175 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
176 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
177 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
178 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
179 2919726948 Bacillus pumilus 4489 Isolate Unclassified
180 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
181 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
182 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
183 2938917290 Bacillus sp. CR71 Isolate Unclassified
184 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
185 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
186 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
187 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
188 2965761152 Bacillus sp. COPE52 Isolate Unclassified
189 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
190 2969141011 Bacillus velezensis MH25 Isolate Unclassified
191 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
192 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
193 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
194 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
195 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
196 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
197 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
198 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
199 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
200 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
201 8022653035 Bacillus sp. Rc4 Isolate Unclassified
202 8022792930 Bacillus sp. Xin Isolate Rhizosphere
203 8023438354 Bacillus sp. BH2 Isolate Unclassified
204 8023444577 Bacillus sp. BH32 Isolate Unclassified
205 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
206 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
207 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
208 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.97
Metatranscriptomes 0.76
Isolates 27.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.05
Nodule 0
Rhizoplane 3.79
Rhizosphere 62.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100000001 3300005614 Bacteria 565602
2 JGI24741J21665_1000514 3300001915 Bacteria 11779
3 JGI25151J46595_10000061 3300003187 Bacteria 146828
4 JGI25151J46595_10023521 3300003187 Bacteria 2537
5 rootH1_10002936 3300003316 Bacteria 45055
6 rootH1_10005816 3300003316 Bacteria 7615
7 rootH2_10000244 3300003320 Bacteria 697651
8 rootL2_10015917 3300003322 Bacteria 9916
9 rootL2_10038513 3300003322 Bacteria 18689
10 Ga0006562J51391_1001615 3300003578 Bacteria 34890
11 Ga0006562J51391_1004137 3300003578 Bacteria 6740
12 Ga0055538_1000230 3300003751 Bacteria 31225
13 Ga0055532_1000004 3300003758 Bacteria 471824
14 Ga0055532_1000062 3300003758 Bacteria 148330
15 Ga0055528_1001314 3300003790 Bacteria 15551
16 Ga0065715_10098742 3300005293 Bacteria 3504
17 Ga0070658_10000133 3300005327 Bacteria 65613
18 Ga0070658_10004678 3300005327 Bacteria 11127
19 Ga0070683_100000112 3300005329 Bacteria 53123
20 Ga0070683_100000505 3300005329 Bacteria 27371
21 Ga0070680_100010777 3300005336 Bacteria 7056
22 Ga0070682_100001074 3300005337 Bacteria 15750
23 Ga0070682_100002842 3300005337 Bacteria 9591
24 Ga0070660_100000837 3300005339 Bacteria 20454
25 Ga0070659_100034090 3300005366 Bacteria 3959
26 Ga0070667_100000001 3300005367 Bacteria 1108638
27 Ga0070679_100000257 3300005530 Bacteria 44414
28 Ga0070679_100006394 3300005530 Bacteria 10972
29 Ga0070684_100000049 3300005535 Bacteria 79768
30 Ga0070684_100043297 3300005535 Bacteria 3887
31 Ga0068855_100001288 3300005563 Bacteria 31095
32 Ga0068855_100003266 3300005563 Bacteria 19846
33 Ga0068856_100041933 3300005614 Bacteria 4500
34 Ga0068852_100000001 3300005616 Bacteria 716526
35 Ga0068860_100006387 3300005843 Bacteria 11833
36 Ga0081455_10000001 3300005937 Bacteria 603871
37 Ga0081455_10000003 3300005937 Bacteria 367763
38 Ga0075365_10000001 3300006038 Bacteria 371589
39 Ga0075365_10019896 3300006038 Bacteria 4153
40 Ga0075364_10000342 3300006051 Bacteria 23182
41 Ga0075369_10000020 3300006186 Bacteria 45510
42 Ga0075366_10000001 3300006195 Bacteria 569172
43 Ga0097621_100000082 3300006237 Bacteria 50678
44 Ga0068871_100000177 3300006358 Bacteria 43038
45 Ga0105251_10013402 3300009011 Bacteria 4589
46 Ga0105244_10006746 3300009036 Bacteria 7384
47 Ga0105240_10002332 3300009093 Bacteria 30702
48 Ga0105240_10013030 3300009093 Bacteria 11448
49 Ga0105240_10015410 3300009093 Bacteria 10392
50 Ga0105245_10000001 3300009098 Bacteria 939270
51 Ga0105245_10000002 3300009098 Bacteria 634374
52 Ga0105243_10002865 3300009148 Bacteria 14301
53 Ga0105241_10000225 3300009174 Bacteria 42642
54 Ga0105241_10005401 3300009174 Bacteria 9448
55 Ga0105237_10000002 3300009545 Bacteria 702357
56 Ga0105237_10001685 3300009545 Bacteria 28614
57 Ga0105238_10024889 3300009551 Bacteria 6100
58 Ga0105249_10007441 3300009553 Bacteria 9553
59 Ga0105028_100019 3300009993 Bacteria 20066
60 Ga0105028_101421 3300009993 Bacteria 2529
61 Ga0105239_10016668 3300010375 Bacteria 8122
62 Ga0105246_10038406 3300011119 Bacteria 3219
63 Ga0157373_10000061 3300013100 Bacteria 95718
64 Ga0157373_10028193 3300013100 Bacteria 4051
65 Ga0157371_10000176 3300013102 Bacteria 93047
66 Ga0157371_10000389 3300013102 Bacteria 55195
67 Ga0157369_10000063 3300013105 Bacteria 147327
68 Ga0157369_10000413 3300013105 Bacteria 56589
69 Ga0157374_10000018 3300013296 Bacteria 286683
70 Ga0157378_10006379 3300013297 Bacteria 10312
71 Ga0157372_10018029 3300013307 Bacteria 7589
72 Ga0157372_10101441 3300013307 Bacteria 3285
73 Ga0209784_100089 3300025224 Bacteria 119510
74 Ga0209147_100010 3300025229 Bacteria 741391
75 Ga0209147_100993 3300025229 Bacteria 12315
76 Ga0209147_103014 3300025229 Bacteria 3585
77 Ga0209130_1000293 3300025284 Bacteria 60879
78 Ga0209676_1000561 3300025292 Bacteria 56143
79 Ga0209025_1000011 3300025294 Bacteria 976387
80 Ga0209025_1004577 3300025294 Bacteria 11878
81 Ga0209025_1005601 3300025294 Bacteria 10144
82 Ga0207426_1007106 3300025302 Bacteria 4735
83 Ga0207655_1000836 3300025728 Bacteria 33126
84 Ga0207713_1022818 3300025735 Bacteria 2960
85 Ga0207713_1023406 3300025735 Bacteria 2907
86 Ga0207705_10000011 3300025909 Bacteria 517768
87 Ga0207705_10079470 3300025909 Bacteria 2388
88 Ga0207654_10002921 3300025911 Bacteria 8666
89 Ga0207654_10004346 3300025911 Bacteria 7140
90 Ga0207695_10021060 3300025913 Bacteria 7448
91 Ga0207671_10000008 3300025914 Bacteria 798229
92 Ga0207671_10000014 3300025914 Bacteria 461481
93 Ga0207660_10001981 3300025917 Bacteria 13653
94 Ga0207657_10002660 3300025919 Bacteria 19285
95 Ga0207652_10000322 3300025921 Bacteria 49586
96 Ga0207652_10010483 3300025921 Bacteria 7459
97 Ga0207652_10011316 3300025921 Bacteria 7189
98 Ga0207687_10000001 3300025927 Bacteria 1130810
99 Ga0207687_10000004 3300025927 Bacteria 841177
100 Ga0207661_10000077 3300025944 Bacteria 67190
101 Ga0207661_10000129 3300025944 Bacteria 47940
102 Ga0207667_10021980 3300025949 Bacteria 7059
103 Ga0207667_10069023 3300025949 Bacteria 3679
104 Ga0207712_10000432 3300025961 Bacteria 35770
105 Ga0207658_10000003 3300025986 Bacteria 1151934
106 Ga0207702_10000001 3300026078 Bacteria 895738
107 Ga0207674_10008133 3300026116 Bacteria 12159
108 Ga0207674_10021774 3300026116 Bacteria 6898
109 Ga0207698_10000001 3300026142 Bacteria 625389
110 Ga0268264_10002058 3300028381 Bacteria 17945
111 Ga0265327_10000025 3300031251 Bacteria 380054
112 Ga0265314_10032595 3300031711 Bacteria 3831
113 Ga0307406_10000002 3300031901 Bacteria 255753
114 Ga0307416_100014937 3300032002 Bacteria 5343
115 Ga0495627_000107 3300046453 Bacteria 102518
116 Ga0495629_0050726 3300046459 Bacteria 2906
117 Ga0495653_0000453 3300046463 Bacteria 31916
118 Ga0495585_0002044 3300046492 Bacteria 14882
119 Ga0495607_0003770 3300046501 Bacteria 11462
120 Ga0495607_0014189 3300046501 Bacteria 5198
121 Ga0495606_0002764 3300046507 Bacteria 19666
122 Ga0495654_0000536 3300046530 Bacteria 30653
123 Ga0495622_0000105 3300046557 Bacteria 73195
124 Ga0495661_0000167 3300046665 Bacteria 78075
125 Ga0495588_0000235 3300046674 Bacteria 48543
126 Ga0495658_0000546 3300046683 Bacteria 20551
127 Ga0495671_0006978 3300046692 Bacteria 6477
128 Ga0495649_0001296 3300046694 Bacteria 19122
129 Ga0495649_0001968 3300046694 Bacteria 14897
130 Ga0495600_0011021 3300046809 Bacteria 5625
131 Ga0495672_0000016 3300047320 Bacteria 500601
132 Ga0495676_0003236 3300047321 Bacteria 14726
133 Ga0495683_0000134 3300047323 Bacteria 72364
134 Ga0495683_0008666 3300047323 Bacteria 5430
135 Ga0496100_0006063 3300048903 Bacteria 6566
136 Ga0496104_0000838 3300048907 Bacteria 26515
137 Ga0496106_0008177 3300048909 Bacteria 7728
138 Ga0496107_0014062 3300048910 Bacteria 5602
139 Ga0496110_0003880 3300048913 Bacteria 11508
140 Ga0496111_0015018 3300048914 Bacteria 5305
141 Ga0496112_0004581 3300048915 Bacteria 11752
142 Ga0496113_0071193 3300048916 Bacteria 2645
143 Ga0496115_0000007 3300048918 Bacteria 244991
144 Ga0496117_0016480 3300048920 Bacteria 6237
145 Ga0496119_0003511 3300048922 Bacteria 16206
146 Ga0496122_0004202 3300048925 Bacteria 18111
147 Ga0496123_0029991 3300048926 Bacteria 3991
148 Ga0496126_0010969 3300048929 Bacteria 9434
149 Ga0501031_0000276 3300049568 Bacteria 29045
150 Ga0501031_0011085 3300049568 Bacteria 5875
151 Ga0501032_0002206 3300049569 Bacteria 15326
152 Ga0501032_0016460 3300049569 Bacteria 5201
153 Ga0501034_0046856 3300049571 Bacteria 4368
154 Ga0501037_0000037 3300049573 Bacteria 124097
155 Ga0501037_0000113 3300049573 Bacteria 75610
156 Ga0501037_0004473 3300049573 Bacteria 10159
157 Ga0501038_0085437 3300049574 Bacteria 2653
158 Ga0501039_0000032 3300049575 Bacteria 129624
159 Ga0501040_0032744 3300049576 Bacteria 3518
160 Ga0501043_0000001 3300049579 Bacteria 479879
161 Ga0501043_0000205 3300049579 Bacteria 54247
162 Ga0501046_0000038 3300049580 Bacteria 159193
163 Ga0501046_0029051 3300049580 Bacteria 4498
164 Ga0501047_0000355 3300049581 Bacteria 51922
165 Ga0501048_0001019 3300049582 Bacteria 20937
166 Ga0501073_0068439 3300049589 Bacteria 2474
167 Ga0501035_0001763 3300049822 Bacteria 21851
168 Ga0501044_0008259 3300049823 Bacteria 11415
169 nmdc:mga00v17_3382_c1 3300050491 Bacteria 8234
170 nmdc:mga0yw44_14828_c1 3300050492 Bacteria 4153
171 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
172 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
173 nmdc:mga0sz30_7258_c1 3300050516 Bacteria 4153
174 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
175 Ga0500643_000010 3300053087 Bacteria 408084
176 Ga0500643_000133 3300053087 Bacteria 75773
177 Ga0500643_001206 3300053087 Bacteria 15437
178 Ga0500644_0001442 3300053088 Bacteria 6285
179 Ga0500583_0002826 3300053092 Bacteria 5323
180 Ga0500583_0003118 3300053092 Bacteria 5137
181 Ga0500566_0000001 3300053094 Bacteria 1101031
182 Ga0500650_0000001 3300053098 Bacteria 818797
183 Ga0500555_000006 3300053103 Bacteria 304416
184 Ga0500594_0000001 3300053118 Bacteria 1178472
185 Ga0500614_000001 3300053123 Bacteria 1274484
186 Ga0500614_006936 3300053123 Bacteria 2381
187 Ga0500577_0000489 3300053142 Bacteria 10181
188 Ga0500579_000595 3300053143 Bacteria 20855
189 Ga0500616_0000055 3300053153 Bacteria 289080
190 Ga0500649_000010 3300053722 Bacteria 91784
191 Ga0500611_000620 3300053727 Bacteria 3618
192 2511701540 2511231119 Bacteria 4019861
193 2540608740 2540341094 Bacteria 4061186
194 2545557737 2545555800 Bacteria 4222588
195 2553394114 2551306519 Bacteria 5465154
196 2555468699 2554235283 Bacteria 3683090
197 2578932128 2576861599 Bacteria 4217202
198 2595088923 2593339131 Bacteria 5116855
199 2631983285 2630968484 Bacteria 3876276
200 2644708276 2643221729 Bacteria 6621700
201 2644714874 2643221730 Bacteria 6523787
202 2644738512 2643221735 Bacteria 3676263
203 2651531141 2648501850 Bacteria 3975476
204 2674421522 2671180844 Bacteria 4164150
205 2685148619 2684622632 Bacteria 5380049
206 2686998834 2684623153 Bacteria 3878815
207 2687500130 2687453109 Bacteria 3860091
208 2695629497 2695420354 Bacteria 3922431
209 2698324553 2695420987 Bacteria 6152737
210 2705992549 2703719227 Bacteria 5631989
211 2717914807 2716884898 Bacteria 3928789
212 2721503997 2718218445 Bacteria 5113413
213 2739158226 2738541358 Bacteria 5932299
214 2739211363 2738543006 Bacteria 5904091
215 2739268711 2738543017 Bacteria 4271950
216 2757564664 2757320391 Bacteria 4746095
217 2777763117 2775507177 Bacteria 4384303
218 2809053881 2808606399 Bacteria 4021018
219 2812314023 2811994870 Bacteria 3776934
220 2819583420 2818991443 Bacteria 6598732
221 2819723039 2818991468 Bacteria 3723169
222 2823530071 2823526263 Bacteria 3765752
223 2860841559 2860837431 Bacteria 4202080
224 2877772424 2877768649 Bacteria 3957164
225 2880173273 2880169592 Bacteria 3900066
226 2897113542 2897109615 Bacteria 4009619
227 2904563136 2904560550 Bacteria 4029838
228 2908667301 2908665501 Bacteria 3678115
229 2916974696 2916971899 Bacteria 4250608
230 2919094684 2919093281 Bacteria 3660974
231 2919417519 2919414237 Bacteria 5429133
232 2919418442 2919414237 Bacteria 5429133
233 2919727243 2919726948 Bacteria 3696050
234 2929233867 2929233124 Bacteria 5948380
235 2936344143 2936340661 Bacteria 5139038
236 2936366000 2936361878 Bacteria 5632809
237 2936366030 2936361878 Bacteria 5632809
238 2938918036 2938917290 Bacteria 5914775
239 2947427361 2947426588 Bacteria 5357194
240 2954776521 2954773129 Bacteria 3741715
241 2956898851 2956897341 Bacteria 5447711
242 2962294799 2962290636 Bacteria 4072939
243 2965761928 2965761152 Bacteria 5806513
244 2969140717 2969136845 Bacteria 3923176
245 2969144996 2969141011 Bacteria 4118468
246 2969770043 2969765954 Bacteria 4216713
247 2969770803 2969770375 Bacteria 4271280
248 2971897119 2971893375 Bacteria 3929648
249 2979084355 2979083700 Bacteria 5894929
250 2980496565 2980492589 Bacteria 4072961
251 3005716020 3005710791 Bacteria 7622528
252 3006883261 3006879489 Bacteria 4064221
253 3006977426 3006973921 Bacteria 4423788
254 8022621807 8022621104 Bacteria 5241040
255 8022632644 8022630665 Bacteria 3886130
256 8022655516 8022653035 Bacteria 4035078
257 8022796091 8022792930 Bacteria 5693794
258 8023438800 8023438354 Bacteria 5779374
259 8023450486 8023444577 Bacteria 5661597
260 8051953966 8051952484 Bacteria 3926774
261 8052175975 8052174270 Bacteria 3881265
262 8054931721 8054929484 Bacteria 5599761
263 8057583427 8057582654 Bacteria 5218944
264 Ga0068856_100000001
265 JGI24741J21665_1000514
266 JGI25151J46595_10000061
267 JGI25151J46595_10023521
268 rootH1_10002936
269 rootH1_10005816
270 rootH2_10000244
271 rootL2_10015917
272 rootL2_10038513
273 Ga0006562J51391_1001615
274 Ga0006562J51391_1004137
275 Ga0055538_1000230
276 Ga0055532_1000004
277 Ga0055532_1000062
278 Ga0055528_1001314
279 Ga0065715_10098742
280 Ga0070658_10000133
281 Ga0070658_10004678
282 Ga0070683_100000112
283 Ga0070683_100000505
284 Ga0070680_100010777
285 Ga0070682_100001074
286 Ga0070682_100002842
287 Ga0070660_100000837
288 Ga0070659_100034090
289 Ga0070667_100000001
290 Ga0070679_100000257
291 Ga0070679_100006394
292 Ga0070684_100000049
293 Ga0070684_100043297
294 Ga0068855_100001288
295 Ga0068855_100003266
296 Ga0068856_100041933
297 Ga0068852_100000001
298 Ga0068860_100006387
299 Ga0081455_10000001
300 Ga0081455_10000003
301 Ga0075365_10000001
302 Ga0075365_10019896
303 Ga0075364_10000342
304 Ga0075369_10000020
305 Ga0075366_10000001
306 Ga0097621_100000082
307 Ga0068871_100000177
308 Ga0105251_10013402
309 Ga0105244_10006746
310 Ga0105240_10002332
311 Ga0105240_10013030
312 Ga0105240_10015410
313 Ga0105245_10000001
314 Ga0105245_10000002
315 Ga0105243_10002865
316 Ga0105241_10000225
317 Ga0105241_10005401
318 Ga0105237_10000002
319 Ga0105237_10001685
320 Ga0105238_10024889
321 Ga0105249_10007441
322 Ga0105028_100019
323 Ga0105028_101421
324 Ga0105239_10016668
325 Ga0105246_10038406
326 Ga0157373_10000061
327 Ga0157373_10028193
328 Ga0157371_10000176
329 Ga0157371_10000389
330 Ga0157369_10000063
331 Ga0157369_10000413
332 Ga0157374_10000018
333 Ga0157378_10006379
334 Ga0157372_10018029
335 Ga0157372_10101441
336 Ga0209784_100089
337 Ga0209147_100010
338 Ga0209147_100993
339 Ga0209147_103014
340 Ga0209130_1000293
341 Ga0209676_1000561
342 Ga0209025_1000011
343 Ga0209025_1004577
344 Ga0209025_1005601
345 Ga0207426_1007106
346 Ga0207655_1000836
347 Ga0207713_1022818
348 Ga0207713_1023406
349 Ga0207705_10000011
350 Ga0207705_10079470
351 Ga0207654_10002921
352 Ga0207654_10004346
353 Ga0207695_10021060
354 Ga0207671_10000008
355 Ga0207671_10000014
356 Ga0207660_10001981
357 Ga0207657_10002660
358 Ga0207652_10000322
359 Ga0207652_10010483
360 Ga0207652_10011316
361 Ga0207687_10000001
362 Ga0207687_10000004
363 Ga0207661_10000077
364 Ga0207661_10000129
365 Ga0207667_10021980
366 Ga0207667_10069023
367 Ga0207712_10000432
368 Ga0207658_10000003
369 Ga0207702_10000001
370 Ga0207674_10008133
371 Ga0207674_10021774
372 Ga0207698_10000001
373 Ga0268264_10002058
374 Ga0265327_10000025
375 Ga0265314_10032595
376 Ga0307406_10000002
377 Ga0307416_100014937
378 Ga0495627_000107
379 Ga0495629_0050726
380 Ga0495653_0000453
381 Ga0495585_0002044
382 Ga0495607_0003770
383 Ga0495607_0014189
384 Ga0495606_0002764
385 Ga0495654_0000536
386 Ga0495622_0000105
387 Ga0495661_0000167
388 Ga0495588_0000235
389 Ga0495658_0000546
390 Ga0495671_0006978
391 Ga0495649_0001296
392 Ga0495649_0001968
393 Ga0495600_0011021
394 Ga0495672_0000016
395 Ga0495676_0003236
396 Ga0495683_0000134
397 Ga0495683_0008666
398 Ga0496100_0006063
399 Ga0496104_0000838
400 Ga0496106_0008177
401 Ga0496107_0014062
402 Ga0496110_0003880
403 Ga0496111_0015018
404 Ga0496112_0004581
405 Ga0496113_0071193
406 Ga0496115_0000007
407 Ga0496117_0016480
408 Ga0496119_0003511
409 Ga0496122_0004202
410 Ga0496123_0029991
411 Ga0496126_0010969
412 Ga0501031_0000276
413 Ga0501031_0011085
414 Ga0501032_0002206
415 Ga0501032_0016460
416 Ga0501034_0046856
417 Ga0501037_0000037
418 Ga0501037_0000113
419 Ga0501037_0004473
420 Ga0501038_0085437
421 Ga0501039_0000032
422 Ga0501040_0032744
423 Ga0501043_0000001
424 Ga0501043_0000205
425 Ga0501046_0000038
426 Ga0501046_0029051
427 Ga0501047_0000355
428 Ga0501048_0001019
429 Ga0501073_0068439
430 Ga0501035_0001763
431 Ga0501044_0008259
432 nmdc:mga00v17_3382_c1
433 nmdc:mga0yw44_14828_c1
434 nmdc:mga0yw44_1_c1
435 nmdc:mga0k408_1_c1
436 nmdc:mga0sz30_7258_c1
437 nmdc:mga0sz30_8_c1
438 Ga0500643_000010
439 Ga0500643_000133
440 Ga0500643_001206
441 Ga0500644_0001442
442 Ga0500583_0002826
443 Ga0500583_0003118
444 Ga0500566_0000001
445 Ga0500650_0000001
446 Ga0500555_000006
447 Ga0500594_0000001
448 Ga0500614_000001
449 Ga0500614_006936
450 Ga0500577_0000489
451 Ga0500579_000595
452 Ga0500616_0000055
453 Ga0500649_000010
454 Ga0500611_000620
455 2511701540
456 2540608740
457 2545557737
458 2553394114
459 2555468699
460 2578932128
461 2595088923
462 2631983285
463 2644708276
464 2644714874
465 2644738512
466 2651531141
467 2674421522
468 2685148619
469 2686998834
470 2687500130
471 2695629497
472 2698324553
473 2705992549
474 2717914807
475 2721503997
476 2739158226
477 2739211363
478 2739268711
479 2757564664
480 2777763117
481 2809053881
482 2812314023
483 2819583420
484 2819723039
485 2823530071
486 2860841559
487 2877772424
488 2880173273
489 2897113542
490 2904563136
491 2908667301
492 2916974696
493 2919094684
494 2919417519
495 2919418442
496 2919727243
497 2929233867
498 2936344143
499 2936366000
500 2936366030
501 2938918036
502 2947427361
503 2954776521
504 2956898851
505 2962294799
506 2965761928
507 2969140717
508 2969144996
509 2969770043
510 2969770803
511 2971897119
512 2979084355
513 2980496565
514 3005716020
515 3006883261
516 3006977426
517 8022621807
518 8022632644
519 8022655516
520 8022796091
521 8023438800
522 8023450486
523 8051953966
524 8052175975
525 8054931721
526 8057583427

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

62

511

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f68-assembly1.cif.gz_A e. coli cytochrome bo3 ubiquinol oxidase monomer 0.9782 2 629
8f68-assembly1.cif.gz_A e. coli cytochrome bo3 ubiquinol oxidase monomer 0.966 2 629
7o3e-assembly1.cif.gz_a murine supercomplex ciii2civ in the intermediate locked conformation 0.9609 24 530
7vuw-assembly2.cif.gz_N bovine heart cytochrome c oxidase in the cyanide-bound fully oxidized state at 50 k 0.9607 24 538
1fft-assembly2.cif.gz_F the structure of ubiquinol oxidase from escherichia coli 0.9599 30 530
ID Description Score Start End Superfamily
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9693 9 534 1.20.210.10
af_P9WP71_20_544_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9665 26 543 1.20.210.10
2yevD01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9616 18 544 1.20.210.10
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9602 9 534 1.20.210.10
2yevD01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9598 18 544 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A379WEL2-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 1 (EC 7.1.1.3) (Cytochrome o ubiquinol oxidase subunit 1) (Oxidase bo(3) subunit 1) (Ubiquinol oxidase polypeptide I) (Ubiquinol oxidase subunit 1) 0.9787 38 629 GO:0004129
GO:0005886
GO:0009060
GO:0009486
GO:0015990
GO:0016682
GO:0020037
GO:0022904
AF-A0A895ZQP9-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.976 185 439 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872
AF-A0A359KEF2-F1-model_v4 Cytochrome o ubiquinol oxidase subunit I 0.9749 17 256 GO:0004129
GO:0005886
GO:0009060
GO:0009486
GO:0015990
GO:0020037
GO:0022904
AF-A0A446IY38-F1-model_v4 deleted 0.9749 192 441
AF-A0A172UXP0-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9734 356 501 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872

Map