F372413

General Info

Members Datasets Scaffolds Average Seq Length
264 149 528 144

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10009358|Ga0070709_100093583
Length 146
Sequence VRAPILYRTASVLLLLFAIAHTLGFRQTNPEWQGTGALIASMQSINFDAGGFNRTYWDFFSAFGFYFSVFLVFAAVLAWQLGGLPAETVPRMRRIAWTLAISFVVVTALTWSYGFTIPLIFSALITVSLIAGAALLPKQVSMPPLQ

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.14
Rhizosphere 98.48
Stem 0
Stem Tuber 0
Unclassified 38.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10009358 3300005434 Bacteria 5402
2 rootH2_10232517 3300003320 Unclassified 1302
3 Ga0065715_10008002 3300005293 Bacteria 3421
4 Ga0065715_10029776 3300005293 Bacteria 1952
5 Ga0065715_10093209 3300005293 Bacteria 4766
6 Ga0065715_10145542 3300005293 Bacteria 1794
7 Ga0070683_100045095 3300005329 Unclassified 4070
8 Ga0070690_100604095 3300005330 Unclassified 833
9 Ga0068869_100035285 3300005334 Bacteria 3544
10 Ga0070666_10116665 3300005335 Bacteria 1849
11 Ga0070682_100638561 3300005337 Bacteria 846
12 Ga0068868_100280951 3300005338 Bacteria 1409
13 Ga0070689_100439061 3300005340 Bacteria 1109
14 Ga0070689_100705038 3300005340 Bacteria 881
15 Ga0070661_100313971 3300005344 Bacteria 1223
16 Ga0070692_10567142 3300005345 Unclassified 746
17 Ga0070669_100221311 3300005353 Unclassified 1497
18 Ga0070675_100088738 3300005354 Unclassified 2588
19 Ga0070674_100159568 3300005356 Unclassified 1710
20 Ga0070674_100657972 3300005356 Unclassified 891
21 Ga0070674_101504075 3300005356 Unclassified 605
22 Ga0070673_100110191 3300005364 Bacteria 2282
23 Ga0070673_100165911 3300005364 Bacteria 1882
24 Ga0070673_100319750 3300005364 Bacteria 1371
25 Ga0070688_100049294 3300005365 Bacteria 2620
26 Ga0070667_100693841 3300005367 Unclassified 942
27 Ga0070667_101701798 3300005367 Unclassified 593
28 Ga0070709_10130690 3300005434 Bacteria 1714
29 Ga0070709_10423006 3300005434 Bacteria 999
30 Ga0070709_10722277 3300005434 Bacteria 777
31 Ga0070709_11610892 3300005434 Unclassified 529
32 Ga0070714_100161107 3300005435 Unclassified 2030
33 Ga0070714_100187066 3300005435 Unclassified 1887
34 Ga0070714_100345032 3300005435 Bacteria 1397
35 Ga0070714_100511782 3300005435 Bacteria 1146
36 Ga0070713_100003973 3300005436 Bacteria 9836
37 Ga0070713_100245512 3300005436 Unclassified 1631
38 Ga0070713_100282495 3300005436 Bacteria 1523
39 Ga0070710_10154426 3300005437 Unclassified 1418
40 Ga0070701_10639693 3300005438 Bacteria 709
41 Ga0070701_11198031 3300005438 Unclassified 539
42 Ga0070711_100000042 3300005439 Bacteria 84000
43 Ga0070711_100040392 3300005439 Unclassified 3146
44 Ga0070711_100102464 3300005439 Bacteria 2085
45 Ga0070711_100411643 3300005439 Unclassified 1100
46 Ga0070711_100755645 3300005439 Unclassified 822
47 Ga0070711_101710397 3300005439 Unclassified 551
48 Ga0070705_100068209 3300005440 Bacteria 2140
49 Ga0070705_100663554 3300005440 Unclassified 815
50 Ga0070694_100017098 3300005444 Bacteria 4578
51 Ga0070694_100084354 3300005444 Bacteria 2216
52 Ga0070694_100662883 3300005444 Unclassified 845
53 Ga0070708_100264337 3300005445 Unclassified 1618
54 Ga0070708_100307638 3300005445 Bacteria 1492
55 Ga0070681_10300183 3300005458 Unclassified 1516
56 Ga0070681_11355717 3300005458 Bacteria 634
57 Ga0068867_100166445 3300005459 Unclassified 1742
58 Ga0070706_100227593 3300005467 Bacteria 1741
59 Ga0070698_100384143 3300005471 Bacteria 1337
60 Ga0070699_100019108 3300005518 Bacteria 5895
61 Ga0070699_100138922 3300005518 Bacteria 2144
62 Ga0070699_100634624 3300005518 Bacteria 975
63 Ga0070684_100000030 3300005535 Bacteria 107248
64 Ga0070697_100000031 3300005536 Bacteria 110959
65 Ga0070697_100089758 3300005536 Bacteria 2539
66 Ga0070686_100012391 3300005544 Bacteria 4855
67 Ga0070686_100371386 3300005544 Bacteria 1080
68 Ga0070695_100004362 3300005545 Bacteria 8292
69 Ga0070695_100070239 3300005545 Bacteria 2290
70 Ga0070695_100090836 3300005545 Bacteria 2039
71 Ga0070695_100608628 3300005545 Unclassified 858
72 Ga0070696_100109991 3300005546 Bacteria 1984
73 Ga0070693_100075457 3300005547 Bacteria 1997
74 Ga0070693_100172067 3300005547 Bacteria 1388
75 Ga0070704_100047746 3300005549 Bacteria 2994
76 Ga0070664_100149326 3300005564 Bacteria 2063
77 Ga0068857_100156169 3300005577 Unclassified 2069
78 Ga0068856_100889936 3300005614 Bacteria 909
79 Ga0070702_100049169 3300005615 Bacteria 2403
80 Ga0068859_100163972 3300005617 Bacteria 2301
81 Ga0068859_100222956 3300005617 Bacteria 1973
82 Ga0068859_100452200 3300005617 Unclassified 1380
83 Ga0068859_100652161 3300005617 Unclassified 1145
84 Ga0068859_100907458 3300005617 Unclassified 965
85 Ga0068859_101407474 3300005617 Unclassified 769
86 Ga0068864_100000580 3300005618 Bacteria 31085
87 Ga0068864_100005618 3300005618 Bacteria 10278
88 Ga0068861_100347671 3300005719 Unclassified 1300
89 Ga0068863_100040511 3300005841 Bacteria 4429
90 Ga0068863_100317013 3300005841 Bacteria 1514
91 Ga0068863_100540672 3300005841 Bacteria 1150
92 Ga0068863_101899607 3300005841 Unclassified 605
93 Ga0068858_100042978 3300005842 Unclassified 4191
94 Ga0068860_100159864 3300005843 Unclassified 2172
95 Ga0068860_100249196 3300005843 Unclassified 1729
96 Ga0068860_101042866 3300005843 Bacteria 836
97 Ga0068862_100133344 3300005844 Bacteria 2199
98 Ga0068862_100246800 3300005844 Bacteria 1625
99 Ga0070717_10085835 3300006028 Bacteria 2649
100 Ga0070717_10442762 3300006028 Bacteria 1170
101 Ga0070716_100273841 3300006173 Bacteria 1161
102 Ga0070716_100292396 3300006173 Bacteria 1129
103 Ga0070712_100004871 3300006175 Bacteria 8301
104 Ga0070712_100125359 3300006175 Bacteria 1939
105 Ga0070712_100347613 3300006175 Unclassified 1213
106 Ga0097621_100336537 3300006237 Bacteria 1340
107 Ga0068871_100050879 3300006358 Bacteria 3352
108 Ga0075434_101483945 3300006871 Unclassified 687
109 Ga0075436_100006283 3300006914 Bacteria 8140
110 Ga0075436_100685573 3300006914 Bacteria 758
111 Ga0097620_100163975 3300006931 Bacteria 2301
112 Ga0097620_100222964 3300006931 Bacteria 1973
113 Ga0097620_100452188 3300006931 Unclassified 1380
114 Ga0097620_100652148 3300006931 Unclassified 1145
115 Ga0097620_100907438 3300006931 Unclassified 965
116 Ga0097620_101407669 3300006931 Unclassified 769
117 Ga0099794_10238829 3300007265 Unclassified 936
118 Ga0105240_10226720 3300009093 Bacteria 2174
119 Ga0111539_10207868 3300009094 Bacteria 2281
120 Ga0111539_10325348 3300009094 Bacteria 1789
121 Ga0105247_10120623 3300009101 Unclassified 1698
122 Ga0105241_11839539 3300009174 Unclassified 592
123 Ga0105241_11895114 3300009174 Bacteria 584
124 Ga0105242_11732411 3300009176 Unclassified 662
125 Ga0105242_12174552 3300009176 Unclassified 600
126 Ga0105248_10022868 3300009177 Bacteria 6941
127 Ga0105248_10228448 3300009177 Bacteria 2095
128 Ga0105248_10320566 3300009177 Bacteria 1746
129 Ga0105248_11416384 3300009177 Bacteria 786
130 Ga0105238_11191838 3300009551 Bacteria 786
131 Ga0105249_10292032 3300009553 Bacteria 1632
132 Ga0105239_10149086 3300010375 Viruses 2610
133 Ga0105239_10248439 3300010375 Bacteria 1998
134 Ga0105239_10739989 3300010375 Unclassified 1125
135 Ga0105239_11308033 3300010375 Bacteria 836
136 Ga0105246_10827839 3300011119 Unclassified 824
137 Ga0105246_11985873 3300011119 Unclassified 561
138 Ga0157373_10262663 3300013100 Bacteria 1222
139 Ga0157369_10967553 3300013105 Bacteria 872
140 Ga0157374_10003897 3300013296 Bacteria 12530
141 Ga0157374_12117736 3300013296 Unclassified 589
142 Ga0157378_10005432 3300013297 Bacteria 11174
143 Ga0157378_10103555 3300013297 Bacteria 2601
144 Ga0163162_10858761 3300013306 Unclassified 1022
145 Ga0163162_11062132 3300013306 Bacteria 917
146 Ga0163162_11360227 3300013306 Bacteria 807
147 Ga0157372_11167438 3300013307 Unclassified 890
148 Ga0157375_10248844 3300013308 Unclassified 1938
149 Ga0157375_10597981 3300013308 Bacteria 1262
150 Ga0163163_10094278 3300014325 Bacteria 3011
151 Ga0157377_10090946 3300014745 Bacteria 1802
152 Ga0157379_10007783 3300014968 Bacteria 9279
153 Ga0157379_10511776 3300014968 Bacteria 1113
154 Ga0157376_10092316 3300014969 Bacteria 2625
155 Ga0157376_11060087 3300014969 Unclassified 835
156 Ga0207692_10186380 3300025898 Unclassified 1212
157 Ga0207699_10024904 3300025906 Bacteria 3279
158 Ga0207699_10174212 3300025906 Bacteria 1442
159 Ga0207699_10480362 3300025906 Bacteria 895
160 Ga0207699_10615543 3300025906 Unclassified 791
161 Ga0207699_10796779 3300025906 Bacteria 694
162 Ga0207699_10819665 3300025906 Unclassified 685
163 Ga0207699_10868927 3300025906 Bacteria 665
164 Ga0207699_11017840 3300025906 Bacteria 613
165 Ga0207643_10217637 3300025908 Bacteria 1168
166 Ga0207684_10798466 3300025910 Bacteria 798
167 Ga0207684_11349406 3300025910 Unclassified 585
168 Ga0207654_10526797 3300025911 Unclassified 837
169 Ga0207707_10059388 3300025912 Bacteria 3327
170 Ga0207695_10280761 3300025913 Bacteria 1559
171 Ga0207693_10007460 3300025915 Bacteria 8995
172 Ga0207693_10369943 3300025915 Unclassified 1121
173 Ga0207693_10382751 3300025915 Bacteria 1100
174 Ga0207663_10000029 3300025916 Bacteria 99755
175 Ga0207663_10015667 3300025916 Unclassified 4188
176 Ga0207646_10122378 3300025922 Bacteria 2338
177 Ga0207681_10150999 3300025923 Unclassified 1741
178 Ga0207681_10873830 3300025923 Bacteria 752
179 Ga0207694_10932491 3300025924 Bacteria 734
180 Ga0207700_10201005 3300025928 Bacteria 1679
181 Ga0207700_10532888 3300025928 Bacteria 1041
182 Ga0207664_10031963 3300025929 Unclassified 4031
183 Ga0207664_10255798 3300025929 Bacteria 1530
184 Ga0207664_10466701 3300025929 Unclassified 1128
185 Ga0207664_10476542 3300025929 Bacteria 1116
186 Ga0207644_10247412 3300025931 Unclassified 1421
187 Ga0207644_11459685 3300025931 Unclassified 574
188 Ga0207686_10359287 3300025934 Unclassified 1099
189 Ga0207670_10685689 3300025936 Bacteria 847
190 Ga0207669_11367301 3300025937 Unclassified 602
191 Ga0207665_10067034 3300025939 Bacteria 2443
192 Ga0207665_10262368 3300025939 Bacteria 1280
193 Ga0207711_10029688 3300025941 Unclassified 4613
194 Ga0207711_10145051 3300025941 Bacteria 2138
195 Ga0207711_10524394 3300025941 Bacteria 1104
196 Ga0207689_10049383 3300025942 Bacteria 3470
197 Ga0207689_10097974 3300025942 Bacteria 2408
198 Ga0207689_10470684 3300025942 Unclassified 1051
199 Ga0207661_10000012 3300025944 Bacteria 354345
200 Ga0207661_10191359 3300025944 Archaea 1794
201 Ga0207679_10185497 3300025945 Bacteria 1724
202 Ga0207651_10268937 3300025960 Unclassified 1403
203 Ga0207712_10510385 3300025961 Bacteria 1029
204 Ga0207658_10138005 3300025986 Unclassified 1969
205 Ga0207677_10208682 3300026023 Bacteria 1558
206 Ga0207703_10054196 3300026035 Unclassified 3261
207 Ga0207703_10120631 3300026035 Bacteria 2251
208 Ga0207708_10247380 3300026075 Unclassified 1436
209 Ga0207708_10663896 3300026075 Unclassified 888
210 Ga0207641_10056269 3300026088 Bacteria 3342
211 Ga0207641_10262976 3300026088 Bacteria 1616
212 Ga0207641_11022004 3300026088 Bacteria 824
213 Ga0207641_11289784 3300026088 Unclassified 731
214 Ga0207641_11291757 3300026088 Unclassified 730
215 Ga0207676_10000278 3300026095 Bacteria 44651
216 Ga0207676_10030141 3300026095 Bacteria 4069
217 Ga0207676_11438411 3300026095 Bacteria 686
218 Ga0207674_10319665 3300026116 Bacteria 1501
219 Ga0207674_10367627 3300026116 Unclassified 1390
220 Ga0207675_100103646 3300026118 Unclassified 2681
221 Ga0207675_100622914 3300026118 Unclassified 1083
222 Ga0207698_10564155 3300026142 Unclassified 1118
223 Ga0207428_10875307 3300027907 Unclassified 635
224 Ga0265356_1003119 3300028017 Bacteria 2121
225 Ga0268266_10710553 3300028379 Bacteria 969
226 Ga0268265_10102841 3300028380 Bacteria 2312
227 Ga0268265_11614955 3300028380 Unclassified 653
228 Ga0268264_10084126 3300028381 Bacteria 2727
229 Ga0268264_10594099 3300028381 Unclassified 1090
230 Ga0268264_12412435 3300028381 Unclassified 532
231 Ga0265762_1001181 3300030760 Unclassified 4730
232 Ga0265760_10004050 3300031090 Bacteria 4227
233 Ga0373951_0106879 3300035091 Unclassified 749
234 Ga0373952_0100518 3300035092 Bacteria 762
235 Ga0373939_0184602 3300035114 Bacteria 780
236 Ga0373945_0020579 3300035116 Bacteria 2260
237 Ga0373962_0140812 3300035242 Bacteria 783
238 Ga0373935_1198991 3300035692 Unclassified 566
239 Ga0373927_0019417 3300035695 Bacteria 4457
240 Ga0373927_0255026 3300035695 Unclassified 1153
241 Ga0373925_0000696 3300037068 Bacteria 31446
242 Ga0395901_1823646 3300038443 Unclassified 557
243 Ga0451577_0193161 3300042876 Unclassified 1837
244 Ga0466964_0200754 3300044706 Unclassified 957
245 Ga0451576_0384042 3300045051 Unclassified 1472
246 Ga0495580_0348496 3300046472 Unclassified 1003
247 Ga0495584_0366081 3300046491 Unclassified 732
248 Ga0495586_0464482 3300046535 Bacteria 730
249 Ga0495598_0286550 3300046537 Bacteria 620
250 Ga0495588_0160446 3300046674 Bacteria 1189
251 Ga0495647_0488239 3300046681 Unclassified 572
252 Ga0495669_0350980 3300046684 Bacteria 713
253 Ga0495636_0553892 3300047318 Unclassified 559
254 Ga0495676_0769903 3300047321 Unclassified 621
255 Ga0495684_0611885 3300047471 Bacteria 734
256 Ga0496111_0009234 3300048914 Bacteria 6571
257 Ga0496112_0454744 3300048915 Bacteria 1218
258 Ga0496112_0624411 3300048915 Bacteria 1008
259 nmdc:mga0qj67_360080_c1 3300050509 Bacteria 1175
260 nmdc:mga08y16_205742_c1 3300050511 Bacteria 2039
261 nmdc:mga08y16_748812_c1 3300050511 Bacteria 973
262 nmdc:mga0n895_1175423_c1 3300050512 Bacteria 742
263 nmdc:mga08x19_7069_c1 3300050514 Bacteria 6664
264 Ga0495619_0590666 3300053085 Unclassified 760
265 Ga0070709_10009358
266 rootH2_10232517
267 Ga0065715_10008002
268 Ga0065715_10029776
269 Ga0065715_10093209
270 Ga0065715_10145542
271 Ga0070683_100045095
272 Ga0070690_100604095
273 Ga0068869_100035285
274 Ga0070666_10116665
275 Ga0070682_100638561
276 Ga0068868_100280951
277 Ga0070689_100439061
278 Ga0070689_100705038
279 Ga0070661_100313971
280 Ga0070692_10567142
281 Ga0070669_100221311
282 Ga0070675_100088738
283 Ga0070674_100159568
284 Ga0070674_100657972
285 Ga0070674_101504075
286 Ga0070673_100110191
287 Ga0070673_100165911
288 Ga0070673_100319750
289 Ga0070688_100049294
290 Ga0070667_100693841
291 Ga0070667_101701798
292 Ga0070709_10130690
293 Ga0070709_10423006
294 Ga0070709_10722277
295 Ga0070709_11610892
296 Ga0070714_100161107
297 Ga0070714_100187066
298 Ga0070714_100345032
299 Ga0070714_100511782
300 Ga0070713_100003973
301 Ga0070713_100245512
302 Ga0070713_100282495
303 Ga0070710_10154426
304 Ga0070701_10639693
305 Ga0070701_11198031
306 Ga0070711_100000042
307 Ga0070711_100040392
308 Ga0070711_100102464
309 Ga0070711_100411643
310 Ga0070711_100755645
311 Ga0070711_101710397
312 Ga0070705_100068209
313 Ga0070705_100663554
314 Ga0070694_100017098
315 Ga0070694_100084354
316 Ga0070694_100662883
317 Ga0070708_100264337
318 Ga0070708_100307638
319 Ga0070681_10300183
320 Ga0070681_11355717
321 Ga0068867_100166445
322 Ga0070706_100227593
323 Ga0070698_100384143
324 Ga0070699_100019108
325 Ga0070699_100138922
326 Ga0070699_100634624
327 Ga0070684_100000030
328 Ga0070697_100000031
329 Ga0070697_100089758
330 Ga0070686_100012391
331 Ga0070686_100371386
332 Ga0070695_100004362
333 Ga0070695_100070239
334 Ga0070695_100090836
335 Ga0070695_100608628
336 Ga0070696_100109991
337 Ga0070693_100075457
338 Ga0070693_100172067
339 Ga0070704_100047746
340 Ga0070664_100149326
341 Ga0068857_100156169
342 Ga0068856_100889936
343 Ga0070702_100049169
344 Ga0068859_100163972
345 Ga0068859_100222956
346 Ga0068859_100452200
347 Ga0068859_100652161
348 Ga0068859_100907458
349 Ga0068859_101407474
350 Ga0068864_100000580
351 Ga0068864_100005618
352 Ga0068861_100347671
353 Ga0068863_100040511
354 Ga0068863_100317013
355 Ga0068863_100540672
356 Ga0068863_101899607
357 Ga0068858_100042978
358 Ga0068860_100159864
359 Ga0068860_100249196
360 Ga0068860_101042866
361 Ga0068862_100133344
362 Ga0068862_100246800
363 Ga0070717_10085835
364 Ga0070717_10442762
365 Ga0070716_100273841
366 Ga0070716_100292396
367 Ga0070712_100004871
368 Ga0070712_100125359
369 Ga0070712_100347613
370 Ga0097621_100336537
371 Ga0068871_100050879
372 Ga0075434_101483945
373 Ga0075436_100006283
374 Ga0075436_100685573
375 Ga0097620_100163975
376 Ga0097620_100222964
377 Ga0097620_100452188
378 Ga0097620_100652148
379 Ga0097620_100907438
380 Ga0097620_101407669
381 Ga0099794_10238829
382 Ga0105240_10226720
383 Ga0111539_10207868
384 Ga0111539_10325348
385 Ga0105247_10120623
386 Ga0105241_11839539
387 Ga0105241_11895114
388 Ga0105242_11732411
389 Ga0105242_12174552
390 Ga0105248_10022868
391 Ga0105248_10228448
392 Ga0105248_10320566
393 Ga0105248_11416384
394 Ga0105238_11191838
395 Ga0105249_10292032
396 Ga0105239_10149086
397 Ga0105239_10248439
398 Ga0105239_10739989
399 Ga0105239_11308033
400 Ga0105246_10827839
401 Ga0105246_11985873
402 Ga0157373_10262663
403 Ga0157369_10967553
404 Ga0157374_10003897
405 Ga0157374_12117736
406 Ga0157378_10005432
407 Ga0157378_10103555
408 Ga0163162_10858761
409 Ga0163162_11062132
410 Ga0163162_11360227
411 Ga0157372_11167438
412 Ga0157375_10248844
413 Ga0157375_10597981
414 Ga0163163_10094278
415 Ga0157377_10090946
416 Ga0157379_10007783
417 Ga0157379_10511776
418 Ga0157376_10092316
419 Ga0157376_11060087
420 Ga0207692_10186380
421 Ga0207699_10024904
422 Ga0207699_10174212
423 Ga0207699_10480362
424 Ga0207699_10615543
425 Ga0207699_10796779
426 Ga0207699_10819665
427 Ga0207699_10868927
428 Ga0207699_11017840
429 Ga0207643_10217637
430 Ga0207684_10798466
431 Ga0207684_11349406
432 Ga0207654_10526797
433 Ga0207707_10059388
434 Ga0207695_10280761
435 Ga0207693_10007460
436 Ga0207693_10369943
437 Ga0207693_10382751
438 Ga0207663_10000029
439 Ga0207663_10015667
440 Ga0207646_10122378
441 Ga0207681_10150999
442 Ga0207681_10873830
443 Ga0207694_10932491
444 Ga0207700_10201005
445 Ga0207700_10532888
446 Ga0207664_10031963
447 Ga0207664_10255798
448 Ga0207664_10466701
449 Ga0207664_10476542
450 Ga0207644_10247412
451 Ga0207644_11459685
452 Ga0207686_10359287
453 Ga0207670_10685689
454 Ga0207669_11367301
455 Ga0207665_10067034
456 Ga0207665_10262368
457 Ga0207711_10029688
458 Ga0207711_10145051
459 Ga0207711_10524394
460 Ga0207689_10049383
461 Ga0207689_10097974
462 Ga0207689_10470684
463 Ga0207661_10000012
464 Ga0207661_10191359
465 Ga0207679_10185497
466 Ga0207651_10268937
467 Ga0207712_10510385
468 Ga0207658_10138005
469 Ga0207677_10208682
470 Ga0207703_10054196
471 Ga0207703_10120631
472 Ga0207708_10247380
473 Ga0207708_10663896
474 Ga0207641_10056269
475 Ga0207641_10262976
476 Ga0207641_11022004
477 Ga0207641_11289784
478 Ga0207641_11291757
479 Ga0207676_10000278
480 Ga0207676_10030141
481 Ga0207676_11438411
482 Ga0207674_10319665
483 Ga0207674_10367627
484 Ga0207675_100103646
485 Ga0207675_100622914
486 Ga0207698_10564155
487 Ga0207428_10875307
488 Ga0265356_1003119
489 Ga0268266_10710553
490 Ga0268265_10102841
491 Ga0268265_11614955
492 Ga0268264_10084126
493 Ga0268264_10594099
494 Ga0268264_12412435
495 Ga0265762_1001181
496 Ga0265760_10004050
497 Ga0373951_0106879
498 Ga0373952_0100518
499 Ga0373939_0184602
500 Ga0373945_0020579
501 Ga0373962_0140812
502 Ga0373935_1198991
503 Ga0373927_0019417
504 Ga0373927_0255026
505 Ga0373925_0000696
506 Ga0395901_1823646
507 Ga0451577_0193161
508 Ga0466964_0200754
509 Ga0451576_0384042
510 Ga0495580_0348496
511 Ga0495584_0366081
512 Ga0495586_0464482
513 Ga0495598_0286550
514 Ga0495588_0160446
515 Ga0495647_0488239
516 Ga0495669_0350980
517 Ga0495636_0553892
518 Ga0495676_0769903
519 Ga0495684_0611885
520 Ga0496111_0009234
521 Ga0496112_0454744
522 Ga0496112_0624411
523 nmdc:mga0qj67_360080_c1
524 nmdc:mga08y16_205742_c1
525 nmdc:mga08y16_748812_c1
526 nmdc:mga0n895_1175423_c1
527 nmdc:mga08x19_7069_c1
528 Ga0495619_0590666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wv5-assembly1.cif.gz_A human vkor c43s mutant with vitamin k1 epoxide 0.4616 4 137
6wv5-assembly1.cif.gz_A human vkor c43s mutant with vitamin k1 epoxide 0.4453 4 137
6wv8-assembly1.cif.gz_A takifugu rubripes vkor-like c138s mutant with vitamin k1 0.4402 7 140
6wv8-assembly1.cif.gz_A takifugu rubripes vkor-like c138s mutant with vitamin k1 0.425 7 140
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.4122 7 138
ID Description Score Start End Superfamily
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6739 4 137 1.10.10.1740
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6581 4 137 1.10.10.1740
af_Q9CQ88_9_199_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6572 4 109 1.20.140.150
af_Q5FVL6_9_193_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6388 4 109 1.20.140.150
af_I1LS12_9_122_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6339 4 81 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A5B9ECK2-F1-model_v4 Uncharacterized protein 0.9232 1 132 GO:0016020
AF-A0A2V7Q5J9-F1-model_v4 Uncharacterized protein 0.9188 1 137 GO:0016020
AF-A0A2N9MT78-F1-model_v4 Uncharacterized protein 0.9174 1 136 GO:0016020
AF-A0A1Q7ZVE3-F1-model_v4 Uncharacterized protein 0.9127 1 92 GO:0016020
AF-A0A2V7Q5J9-F1-model_v4 Uncharacterized protein 0.9063 1 137 GO:0016020

Map