F372324

General Info

Members Datasets Scaffolds Average Seq Length
264 150 528 82

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10000158|JGI25407J50210_100001584
Length 94
Sequence MPAPTRGTISRRPDRSTPFRTCVGCGRKAPKDELIRFVARDGALVPSASDQGRGAYTCRRLACFERAASRSGFSRTLRRTVRVDRDLARLYTAL

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 9.85
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000158 3300003373 Bacteria 10737
2 JGI25407J50210_10104757 3300003373 Bacteria 698
3 Ga0070676_10574530 3300005328 Bacteria 810
4 Ga0068869_100969842 3300005334 Bacteria 739
5 Ga0068869_102104171 3300005334 Unclassified 507
6 Ga0070668_100015067 3300005347 Bacteria 5775
7 Ga0070675_100346913 3300005354 Bacteria 1316
8 Ga0070675_100982496 3300005354 Bacteria 775
9 Ga0070674_101005243 3300005356 Bacteria 732
10 Ga0070688_101711727 3300005365 Bacteria 515
11 Ga0070659_100289248 3300005366 Bacteria 1364
12 Ga0070659_100827662 3300005366 Bacteria 806
13 Ga0070709_10358834 3300005434 Bacteria 1079
14 Ga0070709_10431279 3300005434 Bacteria 990
15 Ga0070709_10536289 3300005434 Bacteria 894
16 Ga0070709_10644052 3300005434 Bacteria 820
17 Ga0070714_100084014 3300005435 Bacteria 2777
18 Ga0070714_100990772 3300005435 Bacteria 818
19 Ga0070714_101524885 3300005435 Bacteria 653
20 Ga0070713_100269995 3300005436 Bacteria 1557
21 Ga0070713_100339558 3300005436 Bacteria 1391
22 Ga0070713_100357774 3300005436 Bacteria 1356
23 Ga0070710_10275572 3300005437 Bacteria 1090
24 Ga0070701_10632604 3300005438 Bacteria 712
25 Ga0070701_10837383 3300005438 Unclassified 630
26 Ga0070711_100585063 3300005439 Bacteria 930
27 Ga0070711_100953184 3300005439 Bacteria 734
28 Ga0070711_100960173 3300005439 Unclassified 732
29 Ga0070705_100295342 3300005440 Bacteria 1158
30 Ga0070705_101026142 3300005440 Bacteria 671
31 Ga0070694_100105224 3300005444 Bacteria 2002
32 Ga0070694_100566625 3300005444 Bacteria 911
33 Ga0070708_100241857 3300005445 Bacteria 1694
34 Ga0070708_100775359 3300005445 Bacteria 901
35 Ga0070662_100222991 3300005457 Bacteria 1505
36 Ga0070685_10547909 3300005466 Bacteria 825
37 Ga0070706_100163768 3300005467 Bacteria 2076
38 Ga0070706_101638944 3300005467 Unclassified 587
39 Ga0070707_100014901 3300005468 Bacteria 7292
40 Ga0070707_100043301 3300005468 Bacteria 4309
41 Ga0070707_100415572 3300005468 Bacteria 1305
42 Ga0070707_100504620 3300005468 Bacteria 1171
43 Ga0070707_100618527 3300005468 Bacteria 1046
44 Ga0070707_101901151 3300005468 Bacteria 562
45 Ga0070698_100248463 3300005471 Bacteria 1712
46 Ga0070698_101189117 3300005471 Unclassified 712
47 Ga0070698_101413569 3300005471 Unclassified 647
48 Ga0070699_101194601 3300005518 Bacteria 698
49 Ga0070699_101195042 3300005518 Unclassified 698
50 Ga0070699_102108852 3300005518 Unclassified 515
51 Ga0070697_100090052 3300005536 Bacteria 2535
52 Ga0070697_100301865 3300005536 Bacteria 1376
53 Ga0070697_100409266 3300005536 Bacteria 1178
54 Ga0068853_101912733 3300005539 Bacteria 575
55 Ga0070695_100280747 3300005545 Bacteria 1223
56 Ga0070695_100441099 3300005545 Bacteria 995
57 Ga0070695_101264596 3300005545 Bacteria 609
58 Ga0070696_100058965 3300005546 Bacteria 2682
59 Ga0070696_100191968 3300005546 Bacteria 1521
60 Ga0070704_100488490 3300005549 Bacteria 1066
61 Ga0070704_101032885 3300005549 Bacteria 744
62 Ga0068855_100165939 3300005563 Bacteria 2503
63 Ga0068855_101336838 3300005563 Bacteria 740
64 Ga0068854_100801963 3300005578 Bacteria 821
65 Ga0068854_101047741 3300005578 Unclassified 724
66 Ga0068854_101335705 3300005578 Unclassified 646
67 Ga0068854_101377272 3300005578 Bacteria 637
68 Ga0068856_100299757 3300005614 Bacteria 1625
69 Ga0068856_101128711 3300005614 Unclassified 801
70 Ga0070702_100241882 3300005615 Bacteria 1218
71 Ga0068860_100782458 3300005843 Bacteria 967
72 Ga0081455_10006092 3300005937 Bacteria 13043
73 Ga0081455_10026546 3300005937 Bacteria 5323
74 Ga0081538_10000558 3300005981 Bacteria 41287
75 Ga0081538_10003531 3300005981 Bacteria 14713
76 Ga0070717_10020140 3300006028 Bacteria 5242
77 Ga0070717_10524510 3300006028 Bacteria 1071
78 Ga0075365_10004328 3300006038 Bacteria 7500
79 Ga0075365_10032584 3300006038 Bacteria 3351
80 Ga0075364_10002546 3300006051 Bacteria 10209
81 Ga0070716_100188478 3300006173 Bacteria 1361
82 Ga0070716_100257463 3300006173 Bacteria 1192
83 Ga0070716_101044207 3300006173 Unclassified 648
84 Ga0070712_100076712 3300006175 Bacteria 2407
85 Ga0070712_100247866 3300006175 Bacteria 1421
86 Ga0070712_100319315 3300006175 Bacteria 1262
87 Ga0075362_10007327 3300006177 Bacteria 4172
88 Ga0075367_10568111 3300006178 Unclassified 720
89 Ga0075428_100000374 3300006844 Bacteria 44299
90 Ga0075428_100090997 3300006844 Bacteria 3328
91 Ga0075428_100096251 3300006844 Bacteria 3227
92 Ga0075430_100027733 3300006846 Bacteria 4810
93 Ga0075431_100187046 3300006847 Bacteria 2123
94 Ga0075431_100216279 3300006847 Bacteria 1956
95 Ga0075433_10024540 3300006852 Bacteria 5090
96 Ga0075433_10102538 3300006852 Bacteria 2534
97 Ga0075434_100127744 3300006871 Bacteria 2559
98 Ga0075429_100035980 3300006880 Bacteria 4306
99 Ga0075429_100294830 3300006880 Bacteria 1420
100 Ga0068865_100919471 3300006881 Bacteria 762
101 Ga0075436_100011731 3300006914 Bacteria 6015
102 Ga0075436_100596995 3300006914 Bacteria 813
103 Ga0075435_100009218 3300007076 Bacteria 7126
104 Ga0075435_100345830 3300007076 Bacteria 1274
105 Ga0105250_10608409 3300009092 Unclassified 507
106 Ga0105240_10931797 3300009093 Bacteria 933
107 Ga0111539_10068446 3300009094 Bacteria 4192
108 Ga0111539_10083933 3300009094 Bacteria 3746
109 Ga0105245_11110554 3300009098 Bacteria 837
110 Ga0105245_13233296 3300009098 Unclassified 505
111 Ga0114129_10088748 3300009147 Bacteria 4286
112 Ga0114129_10221129 3300009147 Bacteria 2554
113 Ga0105243_10546026 3300009148 Bacteria 1106
114 Ga0105243_11061059 3300009148 Unclassified 816
115 Ga0105242_10943066 3300009176 Bacteria 866
116 Ga0105242_11127115 3300009176 Bacteria 800
117 Ga0163162_10231383 3300013306 Bacteria 1979
118 Ga0157375_10655888 3300013308 Bacteria 1205
119 Ga0157375_12845470 3300013308 Unclassified 578
120 Ga0157377_10098704 3300014745 Bacteria 1736
121 Ga0163161_10342432 3300017792 Bacteria 1186
122 Ga0207699_10454044 3300025906 Bacteria 920
123 Ga0207699_10456757 3300025906 Bacteria 917
124 Ga0207645_10228239 3300025907 Bacteria 1228
125 Ga0207684_10677396 3300025910 Bacteria 877
126 Ga0207693_10013824 3300025915 Bacteria 6500
127 Ga0207693_10149089 3300025915 Bacteria 1839
128 Ga0207693_10386239 3300025915 Bacteria 1095
129 Ga0207663_10034428 3300025916 Bacteria 3029
130 Ga0207663_10096244 3300025916 Bacteria 1977
131 Ga0207663_10491716 3300025916 Bacteria 952
132 Ga0207649_10867254 3300025920 Bacteria 707
133 Ga0207646_10316666 3300025922 Bacteria 1410
134 Ga0207646_10608924 3300025922 Bacteria 980
135 Ga0207687_11480135 3300025927 Bacteria 583
136 Ga0207664_10044458 3300025929 Bacteria 3478
137 Ga0207664_11054896 3300025929 Bacteria 727
138 Ga0207664_11282805 3300025929 Bacteria 652
139 Ga0207690_11212167 3300025932 Bacteria 630
140 Ga0207686_10220848 3300025934 Bacteria 1368
141 Ga0207709_10184093 3300025935 Bacteria 1478
142 Ga0207704_11020194 3300025938 Unclassified 700
143 Ga0207665_10405663 3300025939 Bacteria 1039
144 Ga0207665_10691008 3300025939 Bacteria 802
145 Ga0207667_10854006 3300025949 Bacteria 904
146 Ga0207640_10218713 3300025981 Bacteria 1457
147 Ga0207677_10111694 3300026023 Bacteria 2037
148 Ga0207702_10214415 3300026078 Bacteria 1791
149 Ga0207683_11977516 3300026121 Unclassified 531
150 Ga0207428_10012539 3300027907 Bacteria 7442
151 Ga0207428_10602241 3300027907 Unclassified 792
152 Ga0268264_12669827 3300028381 Bacteria 503
153 Ga0265327_10229338 3300031251 Bacteria 833
154 Ga0307408_100355601 3300031548 Bacteria 1244
155 Ga0307416_100071362 3300032002 Bacteria 2885
156 Ga0307416_100181713 3300032002 Bacteria 1972
157 Ga0307415_101246704 3300032126 Bacteria 702
158 Ga0395899_0023665 3300037312 Bacteria 4649
159 Ga0395899_0114492 3300037312 Bacteria 1936
160 Ga0395899_0373267 3300037312 Bacteria 949
161 Ga0395900_0014712 3300037418 Bacteria 7979
162 Ga0395900_0031885 3300037418 Bacteria 5417
163 Ga0395900_0036677 3300037418 Bacteria 5054
164 Ga0395900_0081682 3300037418 Bacteria 3320
165 Ga0395900_0338578 3300037418 Bacteria 1480
166 Ga0395900_0514474 3300037418 Bacteria 1146
167 Ga0395900_0622195 3300037418 Bacteria 1018
168 Ga0395898_0005873 3300037466 Bacteria 13198
169 Ga0395898_0038275 3300037466 Bacteria 4755
170 Ga0395898_0127166 3300037466 Bacteria 2441
171 Ga0395898_0178334 3300037466 Bacteria 2030
172 Ga0395898_0262788 3300037466 Bacteria 1646
173 Ga0395898_0464624 3300037466 Bacteria 1205
174 Ga0395905_0012729 3300037471 Bacteria 8091
175 Ga0395905_0013273 3300037471 Bacteria 7903
176 Ga0395905_0153186 3300037471 Bacteria 2168
177 Ga0395905_0300633 3300037471 Bacteria 1492
178 Ga0395905_0585563 3300037471 Bacteria 1017
179 Ga0395901_0009452 3300038443 Bacteria 9892
180 Ga0395901_0009977 3300038443 Bacteria 9626
181 Ga0395901_0027496 3300038443 Bacteria 5845
182 Ga0395901_0174779 3300038443 Bacteria 2252
183 Ga0395901_0351605 3300038443 Bacteria 1521
184 Ga0395901_0500846 3300038443 Bacteria 1236
185 Ga0395901_0606338 3300038443 Bacteria 1103
186 Ga0395901_0677196 3300038443 Bacteria 1032
187 Ga0451853_2514414 3300041512 Unclassified 845
188 Ga0439463_153559 3300042016 Unclassified 597
189 Ga0439440_0012313 3300042993 Bacteria 1818
190 Ga0466967_0212294 3300045976 Bacteria 1836
191 Ga0495629_0690671 3300046459 Unclassified 678
192 Ga0495653_0053781 3300046463 Bacteria 3079
193 Ga0495582_0357917 3300046473 Bacteria 841
194 Ga0495584_0376643 3300046491 Unclassified 721
195 Ga0495607_0437186 3300046501 Bacteria 589
196 Ga0495628_0859733 3300046516 Bacteria 632
197 Ga0495630_0181250 3300046517 Bacteria 1606
198 Ga0495630_1023259 3300046517 Unclassified 627
199 Ga0495644_0407934 3300046523 Unclassified 538
200 Ga0495663_0062839 3300046525 Bacteria 1170
201 Ga0495609_0044452 3300046538 Bacteria 1992
202 Ga0495609_0223753 3300046538 Bacteria 781
203 Ga0495667_0469850 3300046559 Bacteria 789
204 Ga0495657_0362580 3300046675 Bacteria 856
205 Ga0495599_0232863 3300046678 Bacteria 1124
206 Ga0495670_0829893 3300046691 Unclassified 505
207 Ga0495680_0499849 3300047322 Bacteria 825
208 Ga0496100_0583121 3300048903 Bacteria 867
209 Ga0496101_0062417 3300048904 Bacteria 2709
210 Ga0496102_0287371 3300048905 Bacteria 1550
211 Ga0496102_0353565 3300048905 Bacteria 1383
212 Ga0496103_0025278 3300048906 Bacteria 3588
213 Ga0496103_0054943 3300048906 Bacteria 2469
214 Ga0496104_0020881 3300048907 Bacteria 6006
215 Ga0496105_0047274 3300048908 Bacteria 3551
216 Ga0496105_0387027 3300048908 Unclassified 1112
217 Ga0496106_0311903 3300048909 Unclassified 1262
218 Ga0496106_0960584 3300048909 Bacteria 673
219 Ga0496107_0104365 3300048910 Bacteria 2080
220 Ga0496108_0005215 3300048911 Bacteria 10498
221 Ga0496109_0001424 3300048912 Bacteria 19854
222 Ga0496109_0314270 3300048912 Bacteria 1478
223 Ga0496110_0031497 3300048913 Bacteria 4576
224 Ga0496110_0313566 3300048913 Bacteria 1428
225 Ga0496111_0057173 3300048914 Bacteria 2824
226 Ga0496111_0093153 3300048914 Bacteria 2209
227 Ga0496112_0059208 3300048915 Bacteria 3774
228 Ga0496112_0361394 3300048915 Bacteria 1394
229 Ga0496112_0612119 3300048915 Bacteria 1021
230 Ga0496113_0181110 3300048916 Bacteria 1670
231 Ga0496114_0029370 3300048917 Bacteria 4518
232 Ga0496115_0036903 3300048918 Bacteria 3871
233 Ga0496115_0454922 3300048918 Bacteria 1033
234 Ga0501034_0446568 3300049571 Bacteria 1211
235 Ga0501043_0176428 3300049579 Bacteria 1666
236 Ga0501046_0334924 3300049580 Unclassified 1101
237 Ga0501048_0361527 3300049582 Bacteria 1036
238 Ga0501048_0575872 3300049582 Bacteria 808
239 Ga0501068_0353657 3300049584 Bacteria 944
240 Ga0501070_0198252 3300049586 Bacteria 1649
241 Ga0501070_0482951 3300049586 Bacteria 996
242 Ga0501073_0108441 3300049589 Bacteria 1927
243 Ga0501079_0943261 3300049741 Bacteria 680
244 Ga0501079_1034769 3300049741 Bacteria 647
245 Ga0501080_0074323 3300049742 Bacteria 3161
246 Ga0501080_0328219 3300049742 Bacteria 1384
247 Ga0501080_0491489 3300049742 Bacteria 1097
248 Ga0501035_0944775 3300049822 Bacteria 681
249 Ga0501044_0333829 3300049823 Bacteria 1438
250 nmdc:mga00v17_639590_c1 3300050491 Bacteria 684
251 nmdc:mga0yw44_32169_c1 3300050492 Bacteria 3055
252 nmdc:mga06z11_522242_c1 3300050494 Unclassified 720
253 nmdc:mga05p37_10836_c1 3300050507 Bacteria 10825
254 nmdc:mga05p37_226235_c1 3300050507 Bacteria 2255
255 nmdc:mga05p37_26954_c1 3300050507 Bacteria 6992
256 nmdc:mga0n895_1666709_c1 3300050512 Bacteria 601
257 nmdc:mga0rr50_167059_c1 3300050513 Bacteria 1790
258 nmdc:mga08x19_131279_c1 3300050514 Bacteria 1685
259 nmdc:mga08x19_914491_c1 3300050514 Bacteria 623
260 nmdc:mga0a205_398282_c1 3300050515 Bacteria 1240
261 Ga0495601_0300229 3300053077 Bacteria 1046
262 Ga0495619_0017786 3300053085 Bacteria 4504
263 Ga0501082_1914506 3300060353 Unclassified 517
264 Ga0530510_0698701 3300061734 Bacteria 773
265 JGI25407J50210_10000158
266 JGI25407J50210_10104757
267 Ga0070676_10574530
268 Ga0068869_100969842
269 Ga0068869_102104171
270 Ga0070668_100015067
271 Ga0070675_100346913
272 Ga0070675_100982496
273 Ga0070674_101005243
274 Ga0070688_101711727
275 Ga0070659_100289248
276 Ga0070659_100827662
277 Ga0070709_10358834
278 Ga0070709_10431279
279 Ga0070709_10536289
280 Ga0070709_10644052
281 Ga0070714_100084014
282 Ga0070714_100990772
283 Ga0070714_101524885
284 Ga0070713_100269995
285 Ga0070713_100339558
286 Ga0070713_100357774
287 Ga0070710_10275572
288 Ga0070701_10632604
289 Ga0070701_10837383
290 Ga0070711_100585063
291 Ga0070711_100953184
292 Ga0070711_100960173
293 Ga0070705_100295342
294 Ga0070705_101026142
295 Ga0070694_100105224
296 Ga0070694_100566625
297 Ga0070708_100241857
298 Ga0070708_100775359
299 Ga0070662_100222991
300 Ga0070685_10547909
301 Ga0070706_100163768
302 Ga0070706_101638944
303 Ga0070707_100014901
304 Ga0070707_100043301
305 Ga0070707_100415572
306 Ga0070707_100504620
307 Ga0070707_100618527
308 Ga0070707_101901151
309 Ga0070698_100248463
310 Ga0070698_101189117
311 Ga0070698_101413569
312 Ga0070699_101194601
313 Ga0070699_101195042
314 Ga0070699_102108852
315 Ga0070697_100090052
316 Ga0070697_100301865
317 Ga0070697_100409266
318 Ga0068853_101912733
319 Ga0070695_100280747
320 Ga0070695_100441099
321 Ga0070695_101264596
322 Ga0070696_100058965
323 Ga0070696_100191968
324 Ga0070704_100488490
325 Ga0070704_101032885
326 Ga0068855_100165939
327 Ga0068855_101336838
328 Ga0068854_100801963
329 Ga0068854_101047741
330 Ga0068854_101335705
331 Ga0068854_101377272
332 Ga0068856_100299757
333 Ga0068856_101128711
334 Ga0070702_100241882
335 Ga0068860_100782458
336 Ga0081455_10006092
337 Ga0081455_10026546
338 Ga0081538_10000558
339 Ga0081538_10003531
340 Ga0070717_10020140
341 Ga0070717_10524510
342 Ga0075365_10004328
343 Ga0075365_10032584
344 Ga0075364_10002546
345 Ga0070716_100188478
346 Ga0070716_100257463
347 Ga0070716_101044207
348 Ga0070712_100076712
349 Ga0070712_100247866
350 Ga0070712_100319315
351 Ga0075362_10007327
352 Ga0075367_10568111
353 Ga0075428_100000374
354 Ga0075428_100090997
355 Ga0075428_100096251
356 Ga0075430_100027733
357 Ga0075431_100187046
358 Ga0075431_100216279
359 Ga0075433_10024540
360 Ga0075433_10102538
361 Ga0075434_100127744
362 Ga0075429_100035980
363 Ga0075429_100294830
364 Ga0068865_100919471
365 Ga0075436_100011731
366 Ga0075436_100596995
367 Ga0075435_100009218
368 Ga0075435_100345830
369 Ga0105250_10608409
370 Ga0105240_10931797
371 Ga0111539_10068446
372 Ga0111539_10083933
373 Ga0105245_11110554
374 Ga0105245_13233296
375 Ga0114129_10088748
376 Ga0114129_10221129
377 Ga0105243_10546026
378 Ga0105243_11061059
379 Ga0105242_10943066
380 Ga0105242_11127115
381 Ga0163162_10231383
382 Ga0157375_10655888
383 Ga0157375_12845470
384 Ga0157377_10098704
385 Ga0163161_10342432
386 Ga0207699_10454044
387 Ga0207699_10456757
388 Ga0207645_10228239
389 Ga0207684_10677396
390 Ga0207693_10013824
391 Ga0207693_10149089
392 Ga0207693_10386239
393 Ga0207663_10034428
394 Ga0207663_10096244
395 Ga0207663_10491716
396 Ga0207649_10867254
397 Ga0207646_10316666
398 Ga0207646_10608924
399 Ga0207687_11480135
400 Ga0207664_10044458
401 Ga0207664_11054896
402 Ga0207664_11282805
403 Ga0207690_11212167
404 Ga0207686_10220848
405 Ga0207709_10184093
406 Ga0207704_11020194
407 Ga0207665_10405663
408 Ga0207665_10691008
409 Ga0207667_10854006
410 Ga0207640_10218713
411 Ga0207677_10111694
412 Ga0207702_10214415
413 Ga0207683_11977516
414 Ga0207428_10012539
415 Ga0207428_10602241
416 Ga0268264_12669827
417 Ga0265327_10229338
418 Ga0307408_100355601
419 Ga0307416_100071362
420 Ga0307416_100181713
421 Ga0307415_101246704
422 Ga0395899_0023665
423 Ga0395899_0114492
424 Ga0395899_0373267
425 Ga0395900_0014712
426 Ga0395900_0031885
427 Ga0395900_0036677
428 Ga0395900_0081682
429 Ga0395900_0338578
430 Ga0395900_0514474
431 Ga0395900_0622195
432 Ga0395898_0005873
433 Ga0395898_0038275
434 Ga0395898_0127166
435 Ga0395898_0178334
436 Ga0395898_0262788
437 Ga0395898_0464624
438 Ga0395905_0012729
439 Ga0395905_0013273
440 Ga0395905_0153186
441 Ga0395905_0300633
442 Ga0395905_0585563
443 Ga0395901_0009452
444 Ga0395901_0009977
445 Ga0395901_0027496
446 Ga0395901_0174779
447 Ga0395901_0351605
448 Ga0395901_0500846
449 Ga0395901_0606338
450 Ga0395901_0677196
451 Ga0451853_2514414
452 Ga0439463_153559
453 Ga0439440_0012313
454 Ga0466967_0212294
455 Ga0495629_0690671
456 Ga0495653_0053781
457 Ga0495582_0357917
458 Ga0495584_0376643
459 Ga0495607_0437186
460 Ga0495628_0859733
461 Ga0495630_0181250
462 Ga0495630_1023259
463 Ga0495644_0407934
464 Ga0495663_0062839
465 Ga0495609_0044452
466 Ga0495609_0223753
467 Ga0495667_0469850
468 Ga0495657_0362580
469 Ga0495599_0232863
470 Ga0495670_0829893
471 Ga0495680_0499849
472 Ga0496100_0583121
473 Ga0496101_0062417
474 Ga0496102_0287371
475 Ga0496102_0353565
476 Ga0496103_0025278
477 Ga0496103_0054943
478 Ga0496104_0020881
479 Ga0496105_0047274
480 Ga0496105_0387027
481 Ga0496106_0311903
482 Ga0496106_0960584
483 Ga0496107_0104365
484 Ga0496108_0005215
485 Ga0496109_0001424
486 Ga0496109_0314270
487 Ga0496110_0031497
488 Ga0496110_0313566
489 Ga0496111_0057173
490 Ga0496111_0093153
491 Ga0496112_0059208
492 Ga0496112_0361394
493 Ga0496112_0612119
494 Ga0496113_0181110
495 Ga0496114_0029370
496 Ga0496115_0036903
497 Ga0496115_0454922
498 Ga0501034_0446568
499 Ga0501043_0176428
500 Ga0501046_0334924
501 Ga0501048_0361527
502 Ga0501048_0575872
503 Ga0501068_0353657
504 Ga0501070_0198252
505 Ga0501070_0482951
506 Ga0501073_0108441
507 Ga0501079_0943261
508 Ga0501079_1034769
509 Ga0501080_0074323
510 Ga0501080_0328219
511 Ga0501080_0491489
512 Ga0501035_0944775
513 Ga0501044_0333829
514 nmdc:mga00v17_639590_c1
515 nmdc:mga0yw44_32169_c1
516 nmdc:mga06z11_522242_c1
517 nmdc:mga05p37_10836_c1
518 nmdc:mga05p37_226235_c1
519 nmdc:mga05p37_26954_c1
520 nmdc:mga0n895_1666709_c1
521 nmdc:mga0rr50_167059_c1
522 nmdc:mga08x19_131279_c1
523 nmdc:mga08x19_914491_c1
524 nmdc:mga0a205_398282_c1
525 Ga0495601_0300229
526 Ga0495619_0017786
527 Ga0501082_1914506
528 Ga0530510_0698701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04296

YlxR

Protein of unknown function (DUF448)

20

93

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lqm-assembly1.cif.gz_f cryo-em structure of a pre-60s ribosomal subunit - state c 0.7265 18 70
1g2r-assembly1.cif.gz_A structure of cytosolic protein of unknown function coded by gene from nusa/infb region, a ylxr homologue 0.7206 15 93
6m62-assembly1.cif.gz_u cryo-em structure of eukaryotic pre-60s ribosome subunit from saccharomyces cerevisiae rpf2 delta 255-344 strain, c4 state. 0.7081 18 70
6ylx-assembly1.cif.gz_u pre-60s state ne1 (tap-flag-nop53) 0.706 18 70
6r6g-assembly1.cif.gz_W structure of xbp1u-paused ribosome nascent chain complex with srp. 0.7019 20 69
ID Description Score Start End Superfamily
af_I6XFF7_1_86_3.30.1230.10 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.8567 20 93 3.30.1230.10
af_Q54DM8_406_494_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7744 17 59 3.30.40.10
af_I6XFF7_1_86_3.30.1230.10 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.7383 20 93 3.30.1230.10
1g2rA00 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.7211 15 93 3.30.1230.10
af_Q84RQ9_108_204_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7031 19 59 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A538F3I4-F1-model_v4 YlxR family protein 0.9958 16 92
AF-A0A7V9IFD9-F1-model_v4 YlxR family protein 0.9867 16 82
AF-A0A7Y5U6M0-F1-model_v4 DUF448 domain-containing protein 0.9775 18 92
AF-A0A538AGX4-F1-model_v4 YlxR family protein 0.9687 14 92
AF-A0A7V9G091-F1-model_v4 YlxR family protein 0.9675 14 92

Map