F372109

General Info

Members Datasets Scaffolds Average Seq Length
263 217 212 189

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0051339|Ga0495668_0051339_927_1577
Length 216
Sequence MKNDLITSLRPAAVMTILFAVVLGVIYPILMTIVGQTVFPHQANGSLIRDGDKVIGSELIGQNFAAARYFHGRPSAAGKGYDATASSGSNYGPTSQALIDRVRGDIKTLAAEHPGRPIPADLVTASGSGLDPEITPEAAEWQVDRVARARGIDAAAVRKIVASETREPVLGFIGEPRVNVLALNRRLDAQAAGRKSPRAPIRMPCCAPLRAKGAAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
5 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
6 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
7 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
8 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
9 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
10 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
11 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
12 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
13 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
14 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
15 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
16 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
17 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
18 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
19 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
20 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
21 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
22 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
23 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
24 2909042592 Labrys sp. LIt4 Isolate Nodule
25 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
26 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
27 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
28 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
29 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
30 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
31 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
32 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
33 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
34 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
35 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
36 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
37 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
38 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
39 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
40 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
41 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
42 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
43 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
44 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
45 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
46 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
47 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
48 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
137 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
217 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.23
Metatranscriptomes 0.38
Isolates 19.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.76
Bulb 0
Endosphere 17.87
Nodule 8.37
Rhizoplane 4.56
Rhizosphere 55.13
Stem 0
Stem Tuber 1.9
Unclassified 11.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10023959 3300001979 Bacteria 2076
2 JGI25160J50197_1012675 3300003354 Bacteria 2914
3 Ga0055542_1000792 3300003762 Bacteria 23465
4 Ga0055529_1004278 3300003763 Bacteria 2189
5 Ga0055526_1014647 3300003771 Bacteria 3207
6 Ga0055536_1000344 3300003781 Bacteria 34426
7 Ga0055536_1000492 3300003781 Bacteria 27396
8 Ga0055530_10002951 3300003791 Bacteria 10267
9 Ga0055530_10013013 3300003791 Bacteria 2864
10 Ga0055531_10000526 3300003794 Bacteria 34418
11 Ga0055543_1043435 3300004625 Bacteria 753
12 Ga0070658_10095923 3300005327 Bacteria 2448
13 Ga0070658_10186792 3300005327 Bacteria 1746
14 Ga0068869_100213194 3300005334 Bacteria 1528
15 Ga0070680_100022494 3300005336 Bacteria 5022
16 Ga0070660_100323302 3300005339 Bacteria 1267
17 Ga0070691_10004399 3300005341 Bacteria 6400
18 Ga0070671_100023569 3300005355 Bacteria 5039
19 Ga0070681_10037373 3300005458 Bacteria 4873
20 Ga0070685_10003083 3300005466 Bacteria 8477
21 Ga0070679_100130194 3300005530 Bacteria 2497
22 Ga0068853_100130979 3300005539 Bacteria 2245
23 Ga0068853_101050660 3300005539 Bacteria 785
24 Ga0070686_100260442 3300005544 Bacteria 1271
25 Ga0068855_100065965 3300005563 Bacteria 4220
26 Ga0068854_100001702 3300005578 Bacteria 13388
27 Ga0068852_100137826 3300005616 Bacteria 2254
28 Ga0068863_100075978 3300005841 Bacteria 3178
29 Ga0068860_100376891 3300005843 Bacteria 1400
30 Ga0075365_10018115 3300006038 Bacteria 4324
31 Ga0075364_10018577 3300006051 Bacteria 4353
32 Ga0075369_10113878 3300006186 Bacteria 1220
33 Ga0097621_100145336 3300006237 Bacteria 2030
34 Ga0075370_10428449 3300006353 Bacteria 795
35 Ga0105240_10005462 3300009093 Bacteria 18943
36 Ga0105245_10859695 3300009098 Bacteria 947
37 Ga0105241_10098480 3300009174 Bacteria 2320
38 Ga0105242_10444140 3300009176 Bacteria 1221
39 Ga0105248_10174327 3300009177 Bacteria 2424
40 Ga0105238_10216632 3300009551 Bacteria 1891
41 Ga0105238_10308990 3300009551 Bacteria 1566
42 Ga0105239_10025918 3300010375 Bacteria 6457
43 Ga0105239_10348148 3300010375 Bacteria 1673
44 Ga0105239_10565249 3300010375 Bacteria 1296
45 Ga0157373_10916040 3300013100 Bacteria 651
46 Ga0157369_10702769 3300013105 Bacteria 1041
47 Ga0157374_10165913 3300013296 Bacteria 2152
48 Ga0157378_10000136 3300013297 Bacteria 69380
49 Ga0157378_10000273 3300013297 Bacteria 50350
50 Ga0157375_10000059 3300013308 Bacteria 118614
51 Ga0157380_10573776 3300014326 Bacteria 1111
52 Ga0182008_10035203 3300014497 Bacteria 2509
53 Ga0182006_1070011 3300015261 Bacteria 1303
54 Ga0209677_119597 3300025253 Bacteria 804
55 Ga0209148_1000080 3300025254 Bacteria 277806
56 Ga0209455_1000219 3300025272 Bacteria 79850
57 Ga0209676_1000057 3300025292 Bacteria 361061
58 Ga0209676_1000468 3300025292 Bacteria 67646
59 Ga0209050_1000486 3300025298 Bacteria 69279
60 Ga0209050_1000522 3300025298 Bacteria 63985
61 Ga0209050_1005294 3300025298 Bacteria 8204
62 Ga0207426_1009851 3300025302 Bacteria 3746
63 Ga0209051_1000720 3300025303 Bacteria 36140
64 Ga0209257_1000520 3300025304 Bacteria 66890
65 Ga0209257_1005080 3300025304 Bacteria 9554
66 Ga0207705_10012038 3300025909 Bacteria 6250
67 Ga0207705_10110070 3300025909 Bacteria 2035
68 Ga0207654_10082087 3300025911 Bacteria 1943
69 Ga0207707_10028691 3300025912 Bacteria 4863
70 Ga0207671_10003582 3300025914 Bacteria 15373
71 Ga0207671_10667094 3300025914 Bacteria 828
72 Ga0207660_10160572 3300025917 Bacteria 1734
73 Ga0207657_10136985 3300025919 Bacteria 2002
74 Ga0207657_10280370 3300025919 Bacteria 1323
75 Ga0207652_10066587 3300025921 Bacteria 3122
76 Ga0207694_10146936 3300025924 Bacteria 1898
77 Ga0207694_10401150 3300025924 Bacteria 1140
78 Ga0207690_10264479 3300025932 Bacteria 1334
79 Ga0207689_10010363 3300025942 Bacteria 8032
80 Ga0207640_10001843 3300025981 Bacteria 11365
81 Ga0207703_10825880 3300026035 Bacteria 886
82 Ga0207678_10106412 3300026067 Bacteria 2393
83 Ga0207678_10480736 3300026067 Bacteria 1082
84 Ga0207641_10105769 3300026088 Bacteria 2486
85 Ga0207698_10059418 3300026142 Bacteria 2969
86 Ga0268264_10147474 3300028381 Bacteria 2105
87 Ga0265338_10370565 3300028800 Bacteria 1026
88 Ga0265340_10000223 3300031247 Bacteria 28904
89 Ga0265340_10005815 3300031247 Bacteria 6828
90 Ga0265331_10000006 3300031250 Bacteria 418907
91 Ga0265331_10015033 3300031250 Bacteria 4101
92 Ga0265316_10148259 3300031344 Bacteria 1758
93 Ga0307408_100032395 3300031548 Bacteria 3644
94 Ga0265313_10070366 3300031595 Bacteria 1612
95 Ga0265314_10023733 3300031711 Bacteria 4667
96 Ga0265314_10103412 3300031711 Bacteria 1826
97 Ga0265342_10035660 3300031712 Bacteria 3044
98 Ga0307413_10006196 3300031824 Bacteria 5434
99 Ga0307413_10019510 3300031824 Bacteria 3585
100 Ga0307410_10086480 3300031852 Bacteria 2214
101 Ga0307410_10087433 3300031852 Bacteria 2204
102 Ga0307406_10006216 3300031901 Bacteria 6574
103 Ga0307407_10252004 3300031903 Bacteria 1210
104 Ga0307412_10029315 3300031911 Bacteria 3453
105 Ga0307409_100007660 3300031995 Bacteria 6480
106 Ga0307416_100118056 3300032002 Bacteria 2356
107 Ga0307414_10003914 3300032004 Bacteria 8025
108 Ga0307414_10605082 3300032004 Bacteria 983
109 Ga0307415_100038363 3300032126 Bacteria 3157
110 Ga0436363_0805742 3300039450 Bacteria 1165
111 Ga0451845_0485342 3300041501 Bacteria 1064
112 Ga0451843_1431392 3300041509 Bacteria 1113
113 Ga0495627_000788 3300046453 Bacteria 23346
114 Ga0495591_012288 3300046458 Bacteria 3195
115 Ga0495641_0065989 3300046461 Bacteria 1629
116 Ga0495650_0000034 3300046471 Bacteria 410132
117 Ga0495584_0015110 3300046491 Bacteria 3934
118 Ga0495596_0201043 3300046500 Bacteria 774
119 Ga0495607_0014027 3300046501 Bacteria 5232
120 Ga0495606_0002195 3300046507 Bacteria 23408
121 Ga0495610_0000153 3300046512 Bacteria 76652
122 Ga0495610_0003614 3300046512 Bacteria 11938
123 Ga0495616_0111963 3300046513 Bacteria 1267
124 Ga0495637_0089788 3300046520 Bacteria 1214
125 Ga0495637_0134871 3300046520 Bacteria 940
126 Ga0495648_0014266 3300046524 Bacteria 5826
127 Ga0495654_0000146 3300046530 Bacteria 73331
128 Ga0495609_0311648 3300046538 Bacteria 639
129 Ga0495597_0105161 3300046542 Bacteria 1187
130 Ga0495622_0029238 3300046557 Bacteria 2575
131 Ga0495633_0013516 3300046558 Bacteria 4298
132 Ga0495668_0000019 3300046616 Bacteria 416042
133 Ga0495668_0051339 3300046616 Bacteria 2283
134 Ga0495625_0361709 3300046660 Bacteria 914
135 Ga0495661_0017191 3300046665 Bacteria 4779
136 Ga0495661_0125332 3300046665 Bacteria 1414
137 Ga0495671_0017656 3300046692 Bacteria 3795
138 Ga0495649_0022851 3300046694 Bacteria 3497
139 Ga0495589_0016646 3300046794 Bacteria 3777
140 Ga0495660_0000020 3300046810 Bacteria 304768
141 Ga0495672_0000011 3300047320 Bacteria 535362
142 Ga0495672_0188549 3300047320 Bacteria 1039
143 Ga0495676_0368484 3300047321 Bacteria 958
144 Ga0495683_0037794 3300047323 Bacteria 2445
145 Ga0495679_011237 3300047446 Bacteria 3469
146 Ga0495673_0000020 3300047469 Bacteria 548327
147 Ga0495673_0080217 3300047469 Bacteria 1353
148 Ga0495681_0000015 3300047470 Bacteria 183538
149 Ga0495686_0000864 3300047472 Bacteria 38828
150 Ga0495686_0025608 3300047472 Bacteria 3866
151 Ga0495686_0077541 3300047472 Bacteria 2034
152 Ga0495686_0172723 3300047472 Bacteria 1256
153 Ga0496100_0116577 3300048903 Bacteria 1864
154 Ga0496101_0822801 3300048904 Bacteria 732
155 Ga0496102_0052595 3300048905 Bacteria 3712
156 Ga0496104_0776137 3300048907 Bacteria 865
157 Ga0496106_0060422 3300048909 Bacteria 2873
158 Ga0496112_0028508 3300048915 Bacteria 5390
159 Ga0496113_0319694 3300048916 Bacteria 1244
160 Ga0496114_0708647 3300048917 Bacteria 882
161 Ga0496115_0385130 3300048918 Bacteria 1140
162 Ga0496115_0507593 3300048918 Bacteria 968
163 Ga0496118_0156405 3300048921 Bacteria 1417
164 Ga0496122_0115283 3300048925 Bacteria 1751
165 Ga0496123_0052973 3300048926 Bacteria 2686
166 Ga0496124_0004871 3300048927 Bacteria 15435
167 Ga0496124_0014207 3300048927 Bacteria 7714
168 Ga0496124_0020765 3300048927 Bacteria 6061
169 Ga0496124_0138049 3300048927 Bacteria 1928
170 Ga0496124_0138609 3300048927 Bacteria 1923
171 Ga0496124_0304141 3300048927 Bacteria 1150
172 Ga0496125_0113283 3300048928 Bacteria 1957
173 Ga0496125_0239066 3300048928 Bacteria 1155
174 Ga0496126_0022224 3300048929 Bacteria 6175
175 Ga0495678_000551 3300049459 Bacteria 36076
176 Ga0495682_0000005 3300049460 Bacteria 360387
177 Ga0495682_0014588 3300049460 Bacteria 2979
178 Ga0501321_009287 3300049537 Bacteria 1059
179 Ga0501036_0306033 3300049572 Bacteria 1329
180 Ga0501043_0018304 3300049579 Bacteria 5493
181 Ga0501046_0098327 3300049580 Bacteria 2247
182 Ga0501047_0019401 3300049581 Bacteria 6523
183 Ga0501047_0682936 3300049581 Bacteria 845
184 Ga0501067_0246469 3300049583 Bacteria 994
185 Ga0501072_0021773 3300049588 Bacteria 4971
186 Ga0501074_0230810 3300049590 Bacteria 1317
187 Ga0501202_072383 3300049652 Bacteria 797
188 Ga0501247_011748 3300049677 Bacteria 1059
189 Ga0501249_001366 3300049679 Bacteria 5057
190 Ga0501044_0315768 3300049823 Bacteria 1488
191 nmdc:mga03n38_17870_c1 3300050490 Bacteria 2786
192 nmdc:mga07m45_17612_c1 3300050496 Bacteria 3841
193 nmdc:mga07m45_343134_c1 3300050496 Bacteria 868
194 nmdc:mga0sz30_4001_c1 3300050516 Bacteria 5308
195 Ga0500647_0034810 3300053091 Bacteria 2406
196 Ga0500651_0002216 3300053093 Bacteria 10188
197 Ga0500566_0004635 3300053094 Bacteria 8176
198 Ga0500641_0118754 3300053096 Bacteria 1139
199 Ga0500555_001028 3300053103 Bacteria 9426
200 Ga0500608_242209 3300053122 Bacteria 710
201 Ga0500621_000014 3300053126 Bacteria 126576
202 Ga0500642_0003804 3300053130 Bacteria 4626
203 Ga0500655_000030 3300053133 Bacteria 39615
204 Ga0500559_0092558 3300053136 Bacteria 1385
205 Ga0500559_0114902 3300053136 Bacteria 1249
206 Ga0500577_0030248 3300053142 Bacteria 1883
207 Ga0500622_0019825 3300053156 Bacteria 3569
208 Ga0500622_0067908 3300053156 Bacteria 1807
209 Ga0500622_0171142 3300053156 Bacteria 1011
210 Ga0500624_000018 3300053157 Bacteria 131677
211 Ga0500570_008941 3300053724 Bacteria 5549
212 Ga0501082_0195199 3300060353 Bacteria 1761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10113878 Ga0075369_101138782 144
2 3300048916 Ga0496113_0319694 Ga0496113_0319694_15_485 151
3 3300046794 Ga0495589_0016646 Ga0495589_0016646_20_499 157
4 3300049572 Ga0501036_0306033 Ga0501036_0306033_124_693 169
5 3300049579 Ga0501043_0018304 Ga0501043_0018304_4823_5392 169
6 3300049580 Ga0501046_0098327 Ga0501046_0098327_1344_1913 169
7 3300049581 Ga0501047_0019401 Ga0501047_0019401_5337_5906 169
8 3300049823 Ga0501044_0315768 Ga0501044_0315768_307_876 169
9 3300048904 Ga0496101_0822801 Ga0496101_0822801_98_703 172
10 3300048918 Ga0496115_0507593 Ga0496115_0507593_194_799 172
11 3300003771 Ga0055526_1014647 Ga0055526_10146472 173
12 3300053094 Ga0500566_0004635 Ga0500566_0004635_7283_7888 173
13 3300003354 JGI25160J50197_1012675 JGI25160J50197_10126752 175
14 3300004625 Ga0055543_1043435 Ga0055543_10434351 175
15 3300005339 Ga0070660_100323302 Ga0070660_1003233021 175
16 3300005539 Ga0068853_101050660 Ga0068853_1010506601 175
17 3300010375 Ga0105239_10348148 Ga0105239_103481482 175
18 3300025302 Ga0207426_1009851 Ga0207426_10098512 175
19 3300026035 Ga0207703_10825880 Ga0207703_108258802 175
20 3300041501 Ga0451845_0485342 Ga0451845_0485342_265_867 175
21 3300046458 Ga0495591_012288 Ga0495591_012288_2145_2714 175
22 3300046461 Ga0495641_0065989 Ga0495641_0065989_1032_1601 175
23 3300046471 Ga0495650_0000034 Ga0495650_0000034_201227_201796 175
24 3300046491 Ga0495584_0015110 Ga0495584_0015110_918_1487 175
25 3300046507 Ga0495606_0002195 Ga0495606_0002195_14173_14742 175
26 3300046524 Ga0495648_0014266 Ga0495648_0014266_4825_5394 175
27 3300047321 Ga0495676_0368484 Ga0495676_0368484_55_624 175
28 3300048903 Ga0496100_0116577 Ga0496100_0116577_158_763 175
29 3300048921 Ga0496118_0156405 Ga0496118_0156405_467_1072 175
30 3300049459 Ga0495678_000551 Ga0495678_000551_23235_23804 175
31 3300053126 Ga0500621_000014 Ga0500621_000014_38732_39301 175
32 3300006353 Ga0075370_10428449 Ga0075370_104284492 176
33 3300046501 Ga0495607_0014027 Ga0495607_0014027_3391_3960 176
34 3300046513 Ga0495616_0111963 Ga0495616_0111963_162_731 176
35 3300046520 Ga0495637_0089788 Ga0495637_0089788_203_772 176
36 3300046530 Ga0495654_0000146 Ga0495654_0000146_65979_66548 176
37 3300046692 Ga0495671_0017656 Ga0495671_0017656_1097_1666 176
38 3300046694 Ga0495649_0022851 Ga0495649_0022851_2578_3147 176
39 3300046810 Ga0495660_0000020 Ga0495660_0000020_125339_125908 176
40 3300047320 Ga0495672_0000011 Ga0495672_0000011_224645_225214 176
41 3300047323 Ga0495683_0037794 Ga0495683_0037794_851_1420 176
42 3300047469 Ga0495673_0000020 Ga0495673_0000020_211208_211777 176
43 3300048918 Ga0496115_0385130 Ga0496115_0385130_94_639 176
44 3300048927 Ga0496124_0014207 Ga0496124_0014207_2644_3189 176
45 3300049460 Ga0495682_0000005 Ga0495682_0000005_329673_330242 176
46 3300049679 Ga0501249_001366 Ga0501249_001366_4358_4948 176
47 3300050496 nmdc:mga07m45_343134_c1 nmdc:mga07m45_343134_c1_170_754 176
48 3300050516 nmdc:mga0sz30_4001_c1 nmdc:mga0sz30_4001_c1_803_1348 176
49 3300028800 Ga0265338_10370565 Ga0265338_103705651 177
50 3300031903 Ga0307407_10252004 Ga0307407_102520042 177
51 3300046538 Ga0495609_0311648 Ga0495609_0311648_49_597 177
52 3300046542 Ga0495597_0105161 Ga0495597_0105161_195_743 177
53 3300046660 Ga0495625_0361709 Ga0495625_0361709_239_787 177
54 3300047320 Ga0495672_0188549 Ga0495672_0188549_330_875 177
55 3300049590 Ga0501074_0230810 Ga0501074_0230810_86_634 177
56 3300053091 Ga0500647_0034810 Ga0500647_0034810_1819_2367 177
57 3300053093 Ga0500651_0002216 Ga0500651_0002216_8255_8803 177
58 3300053096 Ga0500641_0118754 Ga0500641_0118754_303_851 177
59 3300053130 Ga0500642_0003804 Ga0500642_0003804_3427_3975 177
60 3300053133 Ga0500655_000030 Ga0500655_000030_33074_33622 177
61 3300053136 Ga0500559_0114902 Ga0500559_0114902_51_599 177
62 3300053142 Ga0500577_0030248 Ga0500577_0030248_481_1029 177
63 3300053156 Ga0500622_0067908 Ga0500622_0067908_589_1137 177
64 3300053724 Ga0500570_008941 Ga0500570_008941_1641_2189 177
65 3300049581 Ga0501047_0682936 Ga0501047_0682936_63_611 178
66 3300006237 Ga0097621_100145336 Ga0097621_1001453362 179
67 3300013297 Ga0157378_10000273 Ga0157378_1000027326 179
68 3300048909 Ga0496106_0060422 Ga0496106_0060422_661_1212 179
69 3300005334 Ga0068869_100213194 Ga0068869_1002131942 181
70 3300005539 Ga0068853_100130979 Ga0068853_1001309793 181
71 3300005544 Ga0070686_100260442 Ga0070686_1002604422 181
72 3300009098 Ga0105245_10859695 Ga0105245_108596952 181
73 3300013297 Ga0157378_10000136 Ga0157378_1000013642 181
74 3300013308 Ga0157375_10000059 Ga0157375_1000005997 181
75 3300025942 Ga0207689_10010363 Ga0207689_100103637 181
76 3300047446 Ga0495679_011237 Ga0495679_011237_352_909 181
77 3300005578 Ga0068854_100001702 Ga0068854_1000017027 182
78 3300025914 Ga0207671_10003582 Ga0207671_1000358212 182
79 3300025981 Ga0207640_10001843 Ga0207640_100018433 182
80 3300039450 Ga0436363_0805742 Ga0436363_0805742_247_819 182
81 3300048925 Ga0496122_0115283 Ga0496122_0115283_967_1539 182
82 3300048926 Ga0496123_0052973 Ga0496123_0052973_654_1226 182
83 3300048927 Ga0496124_0004871 Ga0496124_0004871_4847_5419 182
84 3300048927 Ga0496124_0020765 Ga0496124_0020765_4161_4733 182
85 3300048927 Ga0496124_0138049 Ga0496124_0138049_1224_1796 182
86 iso_pu_bacteria 2537561728 2538427315 182
87 iso_pu_bacteria 2599185359 2600226766 182
88 iso_pu_bacteria 2818991466 2819715787 182
89 iso_pu_bacteria 2852103415 2852103780 182
90 iso_pu_bacteria 2855195626 2855198698 182
91 iso_pu_bacteria 2858466076 2858470082 182
92 iso_pu_bacteria 2871272651 2871277193 182
93 iso_pu_bacteria 2900051742 2900054103 182
94 iso_pu_bacteria 2900051742 2900055769 182
95 iso_pu_bacteria 2928526807 2928529801 182
96 iso_pu_bacteria 2928968154 2928970702 182
97 3300005355 Ga0070671_100023569 Ga0070671_1000235693 183
98 3300005841 Ga0068863_100075978 Ga0068863_1000759782 183
99 3300026067 Ga0207678_10106412 Ga0207678_101064122 183
100 3300026088 Ga0207641_10105769 Ga0207641_101057692 183
101 3300046500 Ga0495596_0201043 Ga0495596_0201043_129_686 183
102 3300046557 Ga0495622_0029238 Ga0495622_0029238_1209_1766 183
103 iso_pu_bacteria 2507262055 2507511198 183
104 iso_pu_bacteria 2508501042 2508693743 183
105 iso_pu_bacteria 2512875016 2512932655 183
106 iso_pu_bacteria 2513237161 2514010461 183
107 iso_pu_bacteria 2588253730 2588518738 183
108 iso_pu_bacteria 2617270735 2617350559 183
109 iso_pu_bacteria 2838122688 2838129118 183
110 iso_pu_bacteria 2841983080 2841990339 183
111 iso_pu_bacteria 2876363079 2876365093 183
112 iso_pu_bacteria 2885409591 2885411568 183
113 iso_pu_bacteria 2903448605 2903450093 183
114 iso_pu_bacteria 2903521522 2903522172 183
115 iso_pu_bacteria 2903528002 2903528550 183
116 iso_pu_bacteria 2909042592 2909047323 183
117 iso_pu_bacteria 2928531327 2928535190 183
118 iso_pu_bacteria 2935648319 2935653530 183
119 iso_pu_bacteria 2935656913 2935662279 183
120 iso_pu_bacteria 2935984226 2935986183 183
121 iso_pu_bacteria 2936011229 2936016581 183
122 iso_pu_bacteria 2936019824 2936025105 183
123 iso_pu_bacteria 2936028420 2936034056 183
124 iso_pu_bacteria 2936046547 2936052004 183
125 iso_pu_bacteria 2936055302 2936059777 183
126 iso_pu_bacteria 2937848649 2937852119 183
127 iso_pu_bacteria 2963644680 2963646548 183
128 iso_pu_bacteria 2965062239 2965069141 183
129 iso_pu_bacteria 2968083720 2968090659 183
130 iso_pu_bacteria 2968128360 2968134494 183
131 iso_pu_bacteria 2977922695 2977926161 183
132 iso_pu_bacteria 2977986579 2977988595 183
133 iso_pu_bacteria 3004211236 3004217944 183
134 iso_pu_bacteria 3004218560 3004221008 183
135 iso_pu_bacteria 3004334049 3004335876 183
136 iso_pu_bacteria 637000159 637075751 183
137 iso_pu_bacteria 8055431914 8055434532 183
138 3300005466 Ga0070685_10003083 Ga0070685_100030832 184
139 iso_pu_bacteria 2928027323 2928029161 184
140 iso_pu_bacteria 2984555340 2984555397 184
141 iso_pu_bacteria 2993356040 2993357504 184
142 3300031901 Ga0307406_10006216 Ga0307406_100062163 185
143 3300005843 Ga0068860_100376891 Ga0068860_1003768912 186
144 3300009176 Ga0105242_10444140 Ga0105242_104441402 186
145 3300014326 Ga0157380_10573776 Ga0157380_105737762 186
146 3300028381 Ga0268264_10147474 Ga0268264_101474742 186
147 3300031548 Ga0307408_100032395 Ga0307408_1000323953 186
148 3300031824 Ga0307413_10006196 Ga0307413_100061962 186
149 3300031852 Ga0307410_10087433 Ga0307410_100874332 186
150 3300031911 Ga0307412_10029315 Ga0307412_100293152 186
151 3300041509 Ga0451843_1431392 Ga0451843_1431392_343_939 186
152 3300048905 Ga0496102_0052595 Ga0496102_0052595_2308_2904 186
153 3300049537 Ga0501321_009287 Ga0501321_009287_349_954 186
154 3300049583 Ga0501067_0246469 Ga0501067_0246469_188_808 186
155 3300049588 Ga0501072_0021773 Ga0501072_0021773_3924_4499 186
156 3300060353 Ga0501082_0195199 Ga0501082_0195199_427_1047 186
157 3300001979 JGI24740J21852_10023959 JGI24740J21852_100239591 187
158 3300003762 Ga0055542_1000792 Ga0055542_100079212 187
159 3300003763 Ga0055529_1004278 Ga0055529_10042782 187
160 3300003781 Ga0055536_1000344 Ga0055536_100034416 187
161 3300003781 Ga0055536_1000492 Ga0055536_100049215 187
162 3300003791 Ga0055530_10002951 Ga0055530_100029513 187
163 3300003791 Ga0055530_10013013 Ga0055530_100130131 187
164 3300003794 Ga0055531_10000526 Ga0055531_100005269 187
165 3300005327 Ga0070658_10095923 Ga0070658_100959232 187
166 3300005327 Ga0070658_10186792 Ga0070658_101867922 187
167 3300005336 Ga0070680_100022494 Ga0070680_1000224943 187
168 3300005341 Ga0070691_10004399 Ga0070691_100043992 187
169 3300005458 Ga0070681_10037373 Ga0070681_100373733 187
170 3300005530 Ga0070679_100130194 Ga0070679_1001301942 187
171 3300005563 Ga0068855_100065965 Ga0068855_1000659652 187
172 3300005616 Ga0068852_100137826 Ga0068852_1001378262 187
173 3300006038 Ga0075365_10018115 Ga0075365_100181152 187
174 3300006051 Ga0075364_10018577 Ga0075364_100185773 187
175 3300009093 Ga0105240_10005462 Ga0105240_100054622 187
176 3300009174 Ga0105241_10098480 Ga0105241_100984802 187
177 3300009177 Ga0105248_10174327 Ga0105248_101743272 187
178 3300009551 Ga0105238_10216632 Ga0105238_102166321 187
179 3300009551 Ga0105238_10308990 Ga0105238_103089902 187
180 3300010375 Ga0105239_10025918 Ga0105239_100259182 187
181 3300010375 Ga0105239_10565249 Ga0105239_105652492 187
182 3300013100 Ga0157373_10916040 Ga0157373_109160401 187
183 3300013105 Ga0157369_10702769 Ga0157369_107027692 187
184 3300013296 Ga0157374_10165913 Ga0157374_101659132 187
185 3300014497 Ga0182008_10035203 Ga0182008_100352032 187
186 3300015261 Ga0182006_1070011 Ga0182006_10700112 187
187 3300025253 Ga0209677_119597 Ga0209677_1195972 187
188 3300025254 Ga0209148_1000080 Ga0209148_100008016 187
189 3300025272 Ga0209455_1000219 Ga0209455_100021938 187
190 3300025292 Ga0209676_1000057 Ga0209676_100005763 187
191 3300025292 Ga0209676_1000468 Ga0209676_100046832 187
192 3300025298 Ga0209050_1000486 Ga0209050_100048636 187
193 3300025298 Ga0209050_1000522 Ga0209050_100052231 187
194 3300025298 Ga0209050_1005294 Ga0209050_10052942 187
195 3300025303 Ga0209051_1000720 Ga0209051_10007202 187
196 3300025304 Ga0209257_1000520 Ga0209257_100052018 187
197 3300025304 Ga0209257_1005080 Ga0209257_100508011 187
198 3300025909 Ga0207705_10012038 Ga0207705_100120382 187
199 3300025909 Ga0207705_10110070 Ga0207705_101100702 187
200 3300025911 Ga0207654_10082087 Ga0207654_100820872 187
201 3300025912 Ga0207707_10028691 Ga0207707_100286913 187
202 3300025914 Ga0207671_10667094 Ga0207671_106670942 187
203 3300025917 Ga0207660_10160572 Ga0207660_101605722 187
204 3300025919 Ga0207657_10136985 Ga0207657_101369852 187
205 3300025919 Ga0207657_10280370 Ga0207657_102803702 187
206 3300025921 Ga0207652_10066587 Ga0207652_100665872 187
207 3300025924 Ga0207694_10146936 Ga0207694_101469362 187
208 3300025924 Ga0207694_10401150 Ga0207694_104011502 187
209 3300025932 Ga0207690_10264479 Ga0207690_102644792 187
210 3300026067 Ga0207678_10480736 Ga0207678_104807362 187
211 3300026142 Ga0207698_10059418 Ga0207698_100594182 187
212 3300031247 Ga0265340_10000223 Ga0265340_100002232 187
213 3300031247 Ga0265340_10005815 Ga0265340_100058152 187
214 3300031250 Ga0265331_10000006 Ga0265331_10000006308 187
215 3300031250 Ga0265331_10015033 Ga0265331_100150332 187
216 3300031344 Ga0265316_10148259 Ga0265316_101482592 187
217 3300031595 Ga0265313_10070366 Ga0265313_100703662 187
218 3300031711 Ga0265314_10023733 Ga0265314_100237332 187
219 3300031711 Ga0265314_10103412 Ga0265314_101034122 187
220 3300031712 Ga0265342_10035660 Ga0265342_100356602 187
221 3300031824 Ga0307413_10019510 Ga0307413_100195102 187
222 3300031852 Ga0307410_10086480 Ga0307410_100864802 187
223 3300031995 Ga0307409_100007660 Ga0307409_1000076603 187
224 3300032002 Ga0307416_100118056 Ga0307416_1001180562 187
225 3300032004 Ga0307414_10003914 Ga0307414_100039147 187
226 3300032004 Ga0307414_10605082 Ga0307414_106050822 187
227 3300032126 Ga0307415_100038363 Ga0307415_1000383632 187
228 3300046453 Ga0495627_000788 Ga0495627_000788_16722_17309 187
229 3300046512 Ga0495610_0000153 Ga0495610_0000153_49313_49900 187
230 3300046512 Ga0495610_0003614 Ga0495610_0003614_11057_11635 187
231 3300046520 Ga0495637_0134871 Ga0495637_0134871_177_755 187
232 3300046558 Ga0495633_0013516 Ga0495633_0013516_2202_2789 187
233 3300046616 Ga0495668_0000019 Ga0495668_0000019_46546_47124 187
234 3300046616 Ga0495668_0051339 Ga0495668_0051339_927_1577 187
235 3300046665 Ga0495661_0017191 Ga0495661_0017191_2807_3394 187
236 3300046665 Ga0495661_0125332 Ga0495661_0125332_592_1182 187
237 3300047469 Ga0495673_0080217 Ga0495673_0080217_709_1299 187
238 3300047470 Ga0495681_0000015 Ga0495681_0000015_139985_140572 187
239 3300047472 Ga0495686_0000864 Ga0495686_0000864_15659_16249 187
240 3300047472 Ga0495686_0025608 Ga0495686_0025608_1896_2474 187
241 3300047472 Ga0495686_0077541 Ga0495686_0077541_927_1514 187
242 3300047472 Ga0495686_0172723 Ga0495686_0172723_224_802 187
243 3300048907 Ga0496104_0776137 Ga0496104_0776137_89_673 187
244 3300048915 Ga0496112_0028508 Ga0496112_0028508_4614_5177 187
245 3300048917 Ga0496114_0708647 Ga0496114_0708647_284_862 187
246 3300048927 Ga0496124_0138609 Ga0496124_0138609_1014_1604 187
247 3300048927 Ga0496124_0304141 Ga0496124_0304141_178_756 187
248 3300048928 Ga0496125_0113283 Ga0496125_0113283_259_837 187
249 3300048928 Ga0496125_0239066 Ga0496125_0239066_424_987 187
250 3300048929 Ga0496126_0022224 Ga0496126_0022224_491_1069 187
251 3300049460 Ga0495682_0014588 Ga0495682_0014588_1015_1605 187
252 3300049652 Ga0501202_072383 Ga0501202_072383_68_682 187
253 3300049677 Ga0501247_011748 Ga0501247_011748_167_781 187
254 3300050490 nmdc:mga03n38_17870_c1 nmdc:mga03n38_17870_c1_1930_2493 187
255 3300050496 nmdc:mga07m45_17612_c1 nmdc:mga07m45_17612_c1_184_747 187
256 3300053103 Ga0500555_001028 Ga0500555_001028_6098_6688 187
257 3300053122 Ga0500608_242209 Ga0500608_242209_85_663 187
258 3300053136 Ga0500559_0092558 Ga0500559_0092558_662_1237 187
259 3300053156 Ga0500622_0019825 Ga0500622_0019825_1583_2161 187
260 3300053156 Ga0500622_0171142 Ga0500622_0171142_406_993 187
261 3300053157 Ga0500624_000018 Ga0500624_000018_36313_36903 187
262 iso_pu_bacteria 2582581305 2585262521 187
263 iso_pu_bacteria 2751185897 2753767431 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

9

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7413 6 186
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7263 1 186
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7212 1 186
8dgl-assembly1.cif.gz_C crystal structure of the rdfs excisionase 0.502 127 185
2j37-assembly1.cif.gz_W model of mammalian srp bound to 80s rncs 0.5007 90 159
ID Description Score Start End Superfamily
af_Q14B70_7_70_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.537 98 159 1.10.10.60
af_Q4DXG1_88_164_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5289 92 185 1.10.238.10
af_Q4DXG1_88_164_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.5064 92 185 1.10.238.10
1kcyA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4989 94 187 1.10.238.10
5le5J00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.4933 88 146 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9795 111 184 GO:0005524
GO:0005886
GO:0008556
AF-A0A8B3G858-F1-model_v4 deleted 0.9759 130 184
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9703 114 187 GO:0005524
GO:0005886
GO:0008556
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.9604 120 187 GO:0005524
GO:0005886
GO:0008556
AF-Q8VTB5-F1-model_v4 FrrA 0.9593 127 186 GO:0005524
GO:0005886
GO:0008556

Feature Viewer

pLDDT pTM Quality
81.75 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map