F372002

General Info

Members Datasets Scaffolds Average Seq Length
263 157 263 440

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0009503|Ga0373935_0009503_3480_4820
Length 446
Sequence MIARYTRPAMGAIWTDAARYAHWLEIEALACEALAQRGTVPKSAVRAIRXXXXIDVXXXAALEAEVKHDVIAFVTQVAESVGPEGRFLHLGLTSSDVLDTGFALQLREAARVLLAGQEALITALGRLARRHKRTLMIGRTHGMHAEPITFGLKVTGWHAEARRNRARLVSAMEQIAVGKISGAVGVFGNVTPAVESYVLKRLGLAPEPLATQVVARDRHAEFFNTLALLGAGLERIAVEVRHLQRTEVGEAEEPFSVGQKGSSAMPHKRNPIVSENTVGLARLLRAYAGAALENVALWHERDISHSAVERVIGPDATCALDYMLARMTAVIDGLVVRPERMRENLDRSRGVVLSENVLLALVRAGADRAEAYRWVQRAAHAALDGSATFAAALTAEPEVRKRLTRAQIDVVLDPARHLEHLDLLFQRGLGSNRGRPRRGVGTRPRS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.79
Rhizosphere 88.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100201342 3300005329 Bacteria 1891
2 Ga0070680_100000006 3300005336 Bacteria 113367
3 Ga0070692_10036497 3300005345 Bacteria 2494
4 Ga0070668_100087463 3300005347 Bacteria 2452
5 Ga0070675_100035406 3300005354 Bacteria 4056
6 Ga0070674_100001116 3300005356 Bacteria 14090
7 Ga0070673_100032952 3300005364 Bacteria 3906
8 Ga0070659_100034131 3300005366 Bacteria 3956
9 Ga0070667_100083775 3300005367 Bacteria 2732
10 Ga0070701_10020998 3300005438 Bacteria 3109
11 Ga0070705_100022176 3300005440 Bacteria 3390
12 Ga0070705_100063762 3300005440 Bacteria 2199
13 Ga0070705_100068347 3300005440 Bacteria 2138
14 Ga0070705_100079440 3300005440 Bacteria 2009
15 Ga0070700_100008655 3300005441 Bacteria 5549
16 Ga0070708_100028283 3300005445 Bacteria 4823
17 Ga0070708_100092816 3300005445 Bacteria 2751
18 Ga0070663_100061574 3300005455 Bacteria 2703
19 Ga0068867_100006532 3300005459 Bacteria 8236
20 Ga0070706_100002396 3300005467 Bacteria 18908
21 Ga0070706_100031927 3300005467 Bacteria 4856
22 Ga0070707_100001368 3300005468 Bacteria 23956
23 Ga0070707_100002720 3300005468 Bacteria 16817
24 Ga0070707_100010970 3300005468 Bacteria 8440
25 Ga0070707_100034552 3300005468 Bacteria 4822
26 Ga0070707_100074166 3300005468 Bacteria 3281
27 Ga0070698_100011181 3300005471 Bacteria 9536
28 Ga0070698_100072652 3300005471 Bacteria 3448
29 Ga0070698_100078670 3300005471 Bacteria 3295
30 Ga0070698_100202108 3300005471 Bacteria 1922
31 Ga0070698_100352014 3300005471 Bacteria 1404
32 Ga0070699_100004378 3300005518 Bacteria 12476
33 Ga0070699_100015400 3300005518 Bacteria 6571
34 Ga0070699_100040452 3300005518 Bacteria 4037
35 Ga0070684_100035818 3300005535 Bacteria 4250
36 Ga0070684_100073515 3300005535 Bacteria 3012
37 Ga0070697_100067711 3300005536 Bacteria 2921
38 Ga0070697_100140112 3300005536 Bacteria 2034
39 Ga0070697_100211110 3300005536 Bacteria 1653
40 Ga0070695_100002330 3300005545 Bacteria 10899
41 Ga0070695_100027375 3300005545 Bacteria 3531
42 Ga0070696_100010049 3300005546 Bacteria 6332
43 Ga0070696_100027403 3300005546 Bacteria 3882
44 Ga0070696_100079857 3300005546 Bacteria 2315
45 Ga0070693_100003144 3300005547 Bacteria 7663
46 Ga0070704_100016100 3300005549 Bacteria 4716
47 Ga0070704_100033057 3300005549 Bacteria 3495
48 Ga0070664_100032156 3300005564 Bacteria 4388
49 Ga0070702_100002279 3300005615 Bacteria 8215
50 Ga0068859_100008240 3300005617 Bacteria 10570
51 Ga0068864_100051105 3300005618 Bacteria 3559
52 Ga0068866_10056614 3300005718 Bacteria 2017
53 Ga0068870_10004617 3300005840 Bacteria 5942
54 Ga0068863_100055320 3300005841 Bacteria 3758
55 Ga0068863_100112419 3300005841 Bacteria 2594
56 Ga0068858_100034505 3300005842 Bacteria 4693
57 Ga0068860_100011135 3300005843 Bacteria 8862
58 Ga0068862_100080206 3300005844 Bacteria 2830
59 Ga0081539_10028416 3300005985 Bacteria 3518
60 Ga0081539_10029721 3300005985 Bacteria 3407
61 Ga0097621_100108277 3300006237 Bacteria 2346
62 Ga0075428_100014023 3300006844 Bacteria 8919
63 Ga0075431_100076696 3300006847 Bacteria 3450
64 Ga0075433_10036567 3300006852 Bacteria 4230
65 Ga0075433_10216103 3300006852 Bacteria 1703
66 Ga0075434_100118298 3300006871 Bacteria 2663
67 Ga0068865_100026965 3300006881 Bacteria 3792
68 Ga0097620_100008241 3300006931 Bacteria 10570
69 Ga0111539_10015164 3300009094 Bacteria 9601
70 Ga0111539_10124084 3300009094 Bacteria 3027
71 Ga0105245_10209628 3300009098 Bacteria 1875
72 Ga0114129_10158153 3300009147 Bacteria 3097
73 Ga0105243_10004531 3300009148 Bacteria 10980
74 Ga0105243_10301039 3300009148 Bacteria 1453
75 Ga0105248_10045894 3300009177 Bacteria 4898
76 Ga0105238_10042511 3300009551 Bacteria 4601
77 Ga0105249_10034163 3300009553 Bacteria 4605
78 Ga0105249_10044202 3300009553 Bacteria 4051
79 Ga0105239_10007925 3300010375 Bacteria 12143
80 Ga0105246_10066353 3300011119 Bacteria 2526
81 Ga0157378_10030972 3300013297 Bacteria 4724
82 Ga0157375_10005306 3300013308 Bacteria 11194
83 Ga0163163_10047322 3300014325 Bacteria 4227
84 Ga0157380_10010874 3300014326 Bacteria 6562
85 Ga0157379_10012690 3300014968 Bacteria 7363
86 Ga0157376_10086475 3300014969 Bacteria 2703
87 Ga0207643_10005791 3300025908 Bacteria 6604
88 Ga0207684_10002926 3300025910 Bacteria 16919
89 Ga0207684_10014603 3300025910 Bacteria 6768
90 Ga0207684_10043015 3300025910 Bacteria 3829
91 Ga0207684_10050395 3300025910 Bacteria 3531
92 Ga0207660_10000002 3300025917 Bacteria 883566
93 Ga0207662_10002007 3300025918 Bacteria 10061
94 Ga0207657_10100241 3300025919 Bacteria 2405
95 Ga0207646_10000393 3300025922 Bacteria 58925
96 Ga0207646_10007604 3300025922 Bacteria 10978
97 Ga0207646_10010687 3300025922 Bacteria 8937
98 Ga0207646_10017880 3300025922 Bacteria 6622
99 Ga0207646_10023623 3300025922 Bacteria 5645
100 Ga0207646_10111434 3300025922 Bacteria 2456
101 Ga0207687_10013365 3300025927 Bacteria 5360
102 Ga0207687_10168814 3300025927 Bacteria 1686
103 Ga0207644_10215665 3300025931 Bacteria 1519
104 Ga0207709_10013924 3300025935 Bacteria 4442
105 Ga0207670_10009148 3300025936 Bacteria 5634
106 Ga0207679_10050656 3300025945 Bacteria 3036
107 Ga0207651_10033071 3300025960 Bacteria 3331
108 Ga0207712_10050783 3300025961 Bacteria 2897
109 Ga0207668_10064511 3300025972 Bacteria 2589
110 Ga0207703_10023793 3300026035 Bacteria 4818
111 Ga0207678_10040635 3300026067 Bacteria 4033
112 Ga0207708_10005128 3300026075 Bacteria 9664
113 Ga0207708_10059415 3300026075 Bacteria 2918
114 Ga0207648_10003076 3300026089 Bacteria 17627
115 Ga0207674_10134950 3300026116 Bacteria 2430
116 Ga0207675_100113215 3300026118 Bacteria 2562
117 Ga0207683_10044506 3300026121 Bacteria 3880
118 Ga0209998_10001157 3300027717 Bacteria 6526
119 Ga0268264_10043072 3300028381 Bacteria 3739
120 Ga0268264_10119795 3300028381 Bacteria 2318
121 Ga0268264_10134993 3300028381 Bacteria 2192
122 Ga0265337_1024128 3300028556 Bacteria 1864
123 Ga0265326_10016004 3300028558 Bacteria 2170
124 Ga0265319_1002146 3300028563 Bacteria 11037
125 Ga0265319_1011466 3300028563 Bacteria 3627
126 Ga0265319_1013032 3300028563 Bacteria 3328
127 Ga0265318_10015440 3300028577 Bacteria 3176
128 Ga0265318_10015651 3300028577 Bacteria 3148
129 Ga0265318_10025947 3300028577 Bacteria 2310
130 Ga0265323_10026333 3300028653 Bacteria 2193
131 Ga0265338_10091823 3300028800 Bacteria 2506
132 Ga0265324_10013785 3300029957 Bacteria 3007
133 Ga0265324_10015563 3300029957 Bacteria 2794
134 Ga0265328_10044553 3300031239 Bacteria 1632
135 Ga0265320_10001931 3300031240 Bacteria 14633
136 Ga0265320_10014354 3300031240 Bacteria 4513
137 Ga0265320_10014543 3300031240 Bacteria 4475
138 Ga0265320_10035737 3300031240 Bacteria 2517
139 Ga0265320_10041888 3300031240 Bacteria 2275
140 Ga0265325_10013700 3300031241 Bacteria 4605
141 Ga0265325_10020510 3300031241 Bacteria 3643
142 Ga0265340_10036930 3300031247 Bacteria 2420
143 Ga0265316_10019050 3300031344 Bacteria 5881
144 Ga0265316_10061386 3300031344 Bacteria 2920
145 Ga0265316_10100870 3300031344 Bacteria 2194
146 Ga0265313_10034497 3300031595 Bacteria 2558
147 Ga0265314_10003728 3300031711 Bacteria 14585
148 Ga0265314_10020495 3300031711 Bacteria 5104
149 Ga0265342_10008156 3300031712 Bacteria 7558
150 Ga0265342_10048101 3300031712 Bacteria 2558
151 Ga0316576_10007382 3300031727 Bacteria 6920
152 Ga0307405_10037242 3300031731 Bacteria 2922
153 Ga0316577_10000982 3300031733 Bacteria 12732
154 Ga0307409_100306293 3300031995 Bacteria 1480
155 Ga0307416_100001579 3300032002 Bacteria 12493
156 Ga0307415_100019327 3300032126 Bacteria 4135
157 Ga0373931_0023515 3300035691 Bacteria 3112
158 Ga0373935_0009503 3300035692 Bacteria 5818
159 Ga0373927_0047199 3300035695 Bacteria 2786
160 Ga0316584_0001575 3300036712 Bacteria 13839
161 Ga0395900_0332232 3300037418 Bacteria 1498
162 Ga0439441_004494 3300042001 Bacteria 2118
163 Ga0439446_0018189 3300042156 Bacteria 1967
164 Ga0495580_0013082 3300046472 Bacteria 6353
165 Ga0495662_0064441 3300046476 Bacteria 1771
166 Ga0495676_0134998 3300047321 Bacteria 1776
167 Ga0495680_0143980 3300047322 Bacteria 1742
168 Ga0495602_0112510 3300048088 Bacteria 2209
169 Ga0496100_0149765 3300048903 Bacteria 1663
170 Ga0496102_0007949 3300048905 Bacteria 9065
171 Ga0496102_0126133 3300048905 Bacteria 2393
172 Ga0496104_0029981 3300048907 Bacteria 5051
173 Ga0496104_0173181 3300048907 Bacteria 2069
174 Ga0496105_0008043 3300048908 Bacteria 8195
175 Ga0496105_0013213 3300048908 Bacteria 6552
176 Ga0496106_0066763 3300048909 Bacteria 2741
177 Ga0496106_0092633 3300048909 Bacteria 2334
178 Ga0496107_0049122 3300048910 Bacteria 3040
179 Ga0496108_0004940 3300048911 Bacteria 10773
180 Ga0496108_0018247 3300048911 Bacteria 5745
181 Ga0496108_0037968 3300048911 Bacteria 4012
182 Ga0496108_0050166 3300048911 Bacteria 3493
183 Ga0496109_0007211 3300048912 Bacteria 9396
184 Ga0496109_0017976 3300048912 Bacteria 6207
185 Ga0496109_0038951 3300048912 Bacteria 4300
186 Ga0496109_0227813 3300048912 Bacteria 1753
187 Ga0496109_0240100 3300048912 Bacteria 1705
188 Ga0496110_0028228 3300048913 Bacteria 4817
189 Ga0496110_0087223 3300048913 Bacteria 2787
190 Ga0496111_0018696 3300048914 Bacteria 4804
191 Ga0496111_0026136 3300048914 Bacteria 4121
192 Ga0496112_0000007 3300048915 Bacteria 338850
193 Ga0496112_0012999 3300048915 Bacteria 7675
194 Ga0496112_0101102 3300048915 Bacteria 2853
195 Ga0496113_0008979 3300048916 Bacteria 6544
196 Ga0496113_0010961 3300048916 Bacteria 6021
197 Ga0496113_0063513 3300048916 Bacteria 2791
198 Ga0496114_0064215 3300048917 Bacteria 3074
199 Ga0496114_0118932 3300048917 Bacteria 2271
200 Ga0501031_0114806 3300049568 Bacteria 1759
201 Ga0501033_0035751 3300049570 Bacteria 3724
202 Ga0501034_0238346 3300049571 Bacteria 1766
203 Ga0501036_0014573 3300049572 Bacteria 6547
204 Ga0501036_0026301 3300049572 Bacteria 4911
205 Ga0501038_0179389 3300049574 Bacteria 1710
206 Ga0501039_0114698 3300049575 Bacteria 2108
207 Ga0501040_0027865 3300049576 Bacteria 3805
208 Ga0501040_0030658 3300049576 Bacteria 3633
209 Ga0501040_0124635 3300049576 Bacteria 1809
210 Ga0501040_0160595 3300049576 Bacteria 1589
211 Ga0501041_0031132 3300049577 Bacteria 3221
212 Ga0501041_0047814 3300049577 Bacteria 2605
213 Ga0501042_0103002 3300049578 Bacteria 2053
214 Ga0501046_0131730 3300049580 Bacteria 1896
215 Ga0501046_0163895 3300049580 Bacteria 1671
216 Ga0501048_0064786 3300049582 Bacteria 2584
217 Ga0501068_0055974 3300049584 Bacteria 2390
218 Ga0501068_0069812 3300049584 Bacteria 2142
219 Ga0501071_0010881 3300049587 Bacteria 6105
220 Ga0501071_0017871 3300049587 Bacteria 4901
221 Ga0501071_0068643 3300049587 Bacteria 2580
222 Ga0501072_0003881 3300049588 Bacteria 11302
223 Ga0501072_0111742 3300049588 Bacteria 2175
224 Ga0501074_0161127 3300049590 Bacteria 1602
225 Ga0501074_0193276 3300049590 Bacteria 1451
226 Ga0501075_0013476 3300049591 Bacteria 5835
227 Ga0501075_0051787 3300049591 Bacteria 3087
228 Ga0501076_0015705 3300049592 Bacteria 5727
229 Ga0501076_0036842 3300049592 Bacteria 3834
230 Ga0501076_0063470 3300049592 Bacteria 2943
231 Ga0501076_0073900 3300049592 Bacteria 2730
232 Ga0501076_0077431 3300049592 Bacteria 2668
233 Ga0501076_0098128 3300049592 Bacteria 2360
234 Ga0501077_0023502 3300049593 Bacteria 3909
235 Ga0501077_0104916 3300049593 Bacteria 1791
236 Ga0501077_0154252 3300049593 Bacteria 1457
237 Ga0501079_0013761 3300049741 Bacteria 6169
238 Ga0501079_0045775 3300049741 Bacteria 3377
239 Ga0501079_0090828 3300049741 Bacteria 2366
240 Ga0501079_0120543 3300049741 Bacteria 2040
241 Ga0501081_0008739 3300049743 Bacteria 6583
242 Ga0501081_0011970 3300049743 Bacteria 5684
243 Ga0501081_0032370 3300049743 Bacteria 3547
244 Ga0501081_0106797 3300049743 Bacteria 1985
245 Ga0501035_0082770 3300049822 Bacteria 2832
246 Ga0501045_0010783 3300049824 Bacteria 6406
247 Ga0501045_0025272 3300049824 Bacteria 4269
248 nmdc:mga05p37_1736_c1 3300050507 Bacteria 25436
249 nmdc:mga05p37_213601_c1 3300050507 Bacteria 2331
250 nmdc:mga08y16_54535_c1 3300050511 Bacteria 4177
251 nmdc:mga08y16_66343_c1 3300050511 Bacteria 3766
252 nmdc:mga0a205_124024_c1 3300050515 Bacteria 2483
253 nmdc:mga0a205_231722_c1 3300050515 Bacteria 1730
254 Ga0495601_0052312 3300053077 Bacteria 2578
255 Ga0495595_0033546 3300053084 Bacteria 2317
256 Ga0495595_0039473 3300053084 Bacteria 2154
257 Ga0501084_0098046 3300054114 Bacteria 2461
258 Ga0501084_0147582 3300054114 Bacteria 1981
259 Ga0501082_0024356 3300060353 Bacteria 5218
260 Ga0501082_0057464 3300060353 Bacteria 3352
261 Ga0530510_0016014 3300061734 Bacteria 5299
262 Ga0530510_0091242 3300061734 Bacteria 2223
263 Ga0530510_0189066 3300061734 Bacteria 1528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_1736_c1 nmdc:mga05p37_1736_c1_18600_19736 364
2 3300060353 Ga0501082_0057464 Ga0501082_0057464_2132_3322 382
3 3300049741 Ga0501079_0120543 Ga0501079_0120543_821_2014 383
4 3300048915 Ga0496112_0101102 Ga0496112_0101102_761_2083 384
5 3300042001 Ga0439441_004494 Ga0439441_004494_10_1290 392
6 3300046476 Ga0495662_0064441 Ga0495662_0064441_143_1474 392
7 3300006852 Ga0075433_10216103 Ga0075433_102161032 400
8 3300014325 Ga0163163_10047322 Ga0163163_100473222 403
9 3300048903 Ga0496100_0149765 Ga0496100_0149765_177_1529 405
10 3300048908 Ga0496105_0013213 Ga0496105_0013213_4663_6015 405
11 3300048912 Ga0496109_0240100 Ga0496109_0240100_125_1477 405
12 3300048917 Ga0496114_0064215 Ga0496114_0064215_877_2229 405
13 3300047322 Ga0495680_0143980 Ga0495680_0143980_27_1313 406
14 3300047321 Ga0495676_0134998 Ga0495676_0134998_92_1414 407
15 3300005546 Ga0070696_100010049 Ga0070696_1000100494 408
16 3300005549 Ga0070704_100033057 Ga0070704_1000330572 408
17 3300005985 Ga0081539_10028416 Ga0081539_100284164 408
18 3300049593 Ga0501077_0104916 Ga0501077_0104916_10_1278 408
19 3300028381 Ga0268264_10119795 Ga0268264_101197952 409
20 3300005440 Ga0070705_100079440 Ga0070705_1000794402 410
21 3300005545 Ga0070695_100002330 Ga0070695_1000023309 410
22 3300005546 Ga0070696_100027403 Ga0070696_1000274032 410
23 3300005549 Ga0070704_100016100 Ga0070704_1000161004 410
24 3300006852 Ga0075433_10036567 Ga0075433_100365672 410
25 3300048905 Ga0496102_0007949 Ga0496102_0007949_1249_2571 410
26 3300048905 Ga0496102_0126133 Ga0496102_0126133_472_1794 410
27 3300048909 Ga0496106_0092633 Ga0496106_0092633_21_1343 410
28 3300048910 Ga0496107_0049122 Ga0496107_0049122_479_1801 410
29 3300048907 Ga0496104_0029981 Ga0496104_0029981_842_2164 411
30 3300048911 Ga0496108_0004940 Ga0496108_0004940_5371_6693 411
31 3300048912 Ga0496109_0017976 Ga0496109_0017976_2299_3621 411
32 3300048914 Ga0496111_0026136 Ga0496111_0026136_804_2126 411
33 3300048915 Ga0496112_0012999 Ga0496112_0012999_5365_6687 411
34 3300048916 Ga0496113_0010961 Ga0496113_0010961_2654_3976 411
35 3300009094 Ga0111539_10124084 Ga0111539_101240842 417
36 3300049577 Ga0501041_0031132 Ga0501041_0031132_10_1323 418
37 3300005536 Ga0070697_100140112 Ga0070697_1001401121 419
38 3300048088 Ga0495602_0112510 Ga0495602_0112510_722_2047 419
39 3300053084 Ga0495595_0033546 Ga0495595_0033546_378_1703 419
40 3300049580 Ga0501046_0163895 Ga0501046_0163895_220_1527 421
41 3300049587 Ga0501071_0068643 Ga0501071_0068643_1025_2332 421
42 3300049592 Ga0501076_0073900 Ga0501076_0073900_794_2101 421
43 3300027717 Ga0209998_10001157 Ga0209998_100011574 422
44 3300025927 Ga0207687_10168814 Ga0207687_101688142 423
45 3300028558 Ga0265326_10016004 Ga0265326_100160042 424
46 3300031239 Ga0265328_10044553 Ga0265328_100445532 424
47 3300031712 Ga0265342_10008156 Ga0265342_100081563 424
48 3300005336 Ga0070680_100000006 Ga0070680_10000000671 425
49 3300005440 Ga0070705_100022176 Ga0070705_1000221764 425
50 3300005440 Ga0070705_100068347 Ga0070705_1000683472 425
51 3300005467 Ga0070706_100002396 Ga0070706_1000023964 425
52 3300005468 Ga0070707_100001368 Ga0070707_10000136811 425
53 3300005468 Ga0070707_100002720 Ga0070707_1000027202 425
54 3300005471 Ga0070698_100202108 Ga0070698_1002021082 425
55 3300005471 Ga0070698_100352014 Ga0070698_1003520141 425
56 3300005518 Ga0070699_100004378 Ga0070699_1000043786 425
57 3300005518 Ga0070699_100015400 Ga0070699_1000154006 425
58 3300005535 Ga0070684_100073515 Ga0070684_1000735152 425
59 3300005843 Ga0068860_100011135 Ga0068860_1000111357 425
60 3300005844 Ga0068862_100080206 Ga0068862_1000802062 425
61 3300006237 Ga0097621_100108277 Ga0097621_1001082772 425
62 3300009553 Ga0105249_10044202 Ga0105249_100442022 425
63 3300011119 Ga0105246_10066353 Ga0105246_100663532 425
64 3300014968 Ga0157379_10012690 Ga0157379_100126903 425
65 3300014969 Ga0157376_10086475 Ga0157376_100864752 425
66 3300025910 Ga0207684_10002926 Ga0207684_1000292611 425
67 3300025910 Ga0207684_10050395 Ga0207684_100503952 425
68 3300025917 Ga0207660_10000002 Ga0207660_1000000270 425
69 3300025922 Ga0207646_10000393 Ga0207646_1000039343 425
70 3300025922 Ga0207646_10007604 Ga0207646_100076042 425
71 3300025961 Ga0207712_10050783 Ga0207712_100507832 425
72 3300028381 Ga0268264_10134993 Ga0268264_101349932 425
73 3300028563 Ga0265319_1002146 Ga0265319_10021462 425
74 3300028563 Ga0265319_1013032 Ga0265319_10130322 425
75 3300028577 Ga0265318_10015651 Ga0265318_100156512 425
76 3300028577 Ga0265318_10025947 Ga0265318_100259472 425
77 3300028653 Ga0265323_10026333 Ga0265323_100263332 425
78 3300031240 Ga0265320_10014354 Ga0265320_100143543 425
79 3300031240 Ga0265320_10035737 Ga0265320_100357372 425
80 3300031240 Ga0265320_10041888 Ga0265320_100418882 425
81 3300031241 Ga0265325_10020510 Ga0265325_100205103 425
82 3300031247 Ga0265340_10036930 Ga0265340_100369302 425
83 3300031344 Ga0265316_10019050 Ga0265316_100190506 425
84 3300031344 Ga0265316_10100870 Ga0265316_101008702 425
85 3300031731 Ga0307405_10037242 Ga0307405_100372424 425
86 3300035691 Ga0373931_0023515 Ga0373931_0023515_50_1369 425
87 3300035692 Ga0373935_0009503 Ga0373935_0009503_3480_4820 425
88 3300035695 Ga0373927_0047199 Ga0373927_0047199_382_1722 425
89 3300042156 Ga0439446_0018189 Ga0439446_0018189_588_1919 425
90 3300046472 Ga0495580_0013082 Ga0495580_0013082_3957_5297 425
91 3300048908 Ga0496105_0008043 Ga0496105_0008043_4791_6113 425
92 3300048911 Ga0496108_0018247 Ga0496108_0018247_1667_2986 425
93 3300048911 Ga0496108_0037968 Ga0496108_0037968_2513_3835 425
94 3300048912 Ga0496109_0007211 Ga0496109_0007211_5067_6386 425
95 3300048912 Ga0496109_0038951 Ga0496109_0038951_492_1814 425
96 3300048913 Ga0496110_0028228 Ga0496110_0028228_2671_3993 425
97 3300048913 Ga0496110_0087223 Ga0496110_0087223_75_1394 425
98 3300048914 Ga0496111_0018696 Ga0496111_0018696_1791_3110 425
99 3300048916 Ga0496113_0008979 Ga0496113_0008979_3783_5105 425
100 3300049584 Ga0501068_0069812 Ga0501068_0069812_291_1610 425
101 3300050511 nmdc:mga08y16_54535_c1 nmdc:mga08y16_54535_c1_757_2076 425
102 3300050511 nmdc:mga08y16_66343_c1 nmdc:mga08y16_66343_c1_1422_2741 425
103 3300031733 Ga0316577_10000982 Ga0316577_100009828 426
104 3300036712 Ga0316584_0001575 Ga0316584_0001575_11841_13175 426
105 3300037418 Ga0395900_0332232 Ga0395900_0332232_138_1460 426
106 3300005445 Ga0070708_100092816 Ga0070708_1000928162 427
107 3300009147 Ga0114129_10158153 Ga0114129_101581532 427
108 3300025922 Ga0207646_10017880 Ga0207646_100178802 427
109 3300029957 Ga0265324_10013785 Ga0265324_100137852 427
110 3300031240 Ga0265320_10014543 Ga0265320_100145433 427
111 3300031241 Ga0265325_10013700 Ga0265325_100137005 427
112 3300031344 Ga0265316_10061386 Ga0265316_100613863 427
113 3300031711 Ga0265314_10020495 Ga0265314_100204952 427
114 3300031712 Ga0265342_10048101 Ga0265342_100481012 427
115 3300031995 Ga0307409_100306293 Ga0307409_1003062932 427
116 3300049570 Ga0501033_0035751 Ga0501033_0035751_1375_2715 427
117 3300049571 Ga0501034_0238346 Ga0501034_0238346_200_1540 427
118 3300049576 Ga0501040_0027865 Ga0501040_0027865_2093_3433 427
119 3300049578 Ga0501042_0103002 Ga0501042_0103002_195_1535 427
120 3300049580 Ga0501046_0131730 Ga0501046_0131730_29_1369 427
121 3300049582 Ga0501048_0064786 Ga0501048_0064786_505_1845 427
122 3300049584 Ga0501068_0055974 Ga0501068_0055974_280_1620 427
123 3300049591 Ga0501075_0051787 Ga0501075_0051787_1707_3047 427
124 3300049592 Ga0501076_0036842 Ga0501076_0036842_976_2316 427
125 3300049593 Ga0501077_0154252 Ga0501077_0154252_64_1404 427
126 3300049822 Ga0501035_0082770 Ga0501035_0082770_956_2296 427
127 3300054114 Ga0501084_0098046 Ga0501084_0098046_734_2083 427
128 3300005445 Ga0070708_100028283 Ga0070708_1000282833 428
129 3300005468 Ga0070707_100074166 Ga0070707_1000741662 428
130 3300006871 Ga0075434_100118298 Ga0075434_1001182983 428
131 3300009098 Ga0105245_10209628 Ga0105245_102096281 428
132 3300025922 Ga0207646_10111434 Ga0207646_101114342 428
133 3300031727 Ga0316576_10007382 Ga0316576_100073824 428
134 3300048907 Ga0496104_0173181 Ga0496104_0173181_84_1430 428
135 3300048915 Ga0496112_0000007 Ga0496112_0000007_254844_256193 428
136 3300048917 Ga0496114_0118932 Ga0496114_0118932_345_1700 428
137 3300049576 Ga0501040_0160595 Ga0501040_0160595_200_1576 428
138 3300053077 Ga0495601_0052312 Ga0495601_0052312_552_1910 428
139 3300053084 Ga0495595_0039473 Ga0495595_0039473_122_1480 428
140 3300005467 Ga0070706_100031927 Ga0070706_1000319272 429
141 3300005468 Ga0070707_100010970 Ga0070707_1000109705 429
142 3300005468 Ga0070707_100034552 Ga0070707_1000345522 429
143 3300005471 Ga0070698_100011181 Ga0070698_1000111816 429
144 3300005471 Ga0070698_100078670 Ga0070698_1000786702 429
145 3300005536 Ga0070697_100067711 Ga0070697_1000677112 429
146 3300005536 Ga0070697_100211110 Ga0070697_1002111102 429
147 3300025910 Ga0207684_10014603 Ga0207684_100146034 429
148 3300025922 Ga0207646_10010687 Ga0207646_100106875 429
149 3300025922 Ga0207646_10023623 Ga0207646_100236235 429
150 3300049572 Ga0501036_0014573 Ga0501036_0014573_4964_6295 429
151 3300049575 Ga0501039_0114698 Ga0501039_0114698_472_1803 429
152 3300049576 Ga0501040_0124635 Ga0501040_0124635_103_1434 429
153 3300049577 Ga0501041_0047814 Ga0501041_0047814_318_1649 429
154 3300049587 Ga0501071_0017871 Ga0501071_0017871_1578_2909 429
155 3300049588 Ga0501072_0003881 Ga0501072_0003881_9511_10842 429
156 3300049590 Ga0501074_0161127 Ga0501074_0161127_173_1504 429
157 3300049591 Ga0501075_0013476 Ga0501075_0013476_3901_5232 429
158 3300049592 Ga0501076_0077431 Ga0501076_0077431_21_1352 429
159 3300049741 Ga0501079_0013761 Ga0501079_0013761_3752_5083 429
160 3300049741 Ga0501079_0045775 Ga0501079_0045775_1460_2791 429
161 3300049743 Ga0501081_0011970 Ga0501081_0011970_398_1729 429
162 3300049743 Ga0501081_0032370 Ga0501081_0032370_1859_3190 429
163 3300049824 Ga0501045_0010783 Ga0501045_0010783_990_2321 429
164 3300050507 nmdc:mga05p37_213601_c1 nmdc:mga05p37_213601_c1_289_1638 429
165 3300050515 nmdc:mga0a205_124024_c1 nmdc:mga0a205_124024_c1_137_1495 429
166 3300050515 nmdc:mga0a205_231722_c1 nmdc:mga0a205_231722_c1_20_1378 429
167 3300054114 Ga0501084_0147582 Ga0501084_0147582_293_1624 429
168 3300061734 Ga0530510_0016014 Ga0530510_0016014_945_2276 429
169 3300061734 Ga0530510_0189066 Ga0530510_0189066_120_1451 429
170 3300049574 Ga0501038_0179389 Ga0501038_0179389_304_1638 430
171 3300049588 Ga0501072_0111742 Ga0501072_0111742_745_2079 430
172 3300049592 Ga0501076_0063470 Ga0501076_0063470_1038_2372 430
173 3300049743 Ga0501081_0106797 Ga0501081_0106797_614_1948 430
174 3300061734 Ga0530510_0091242 Ga0530510_0091242_220_1554 430
175 3300005440 Ga0070705_100063762 Ga0070705_1000637622 432
176 3300005471 Ga0070698_100072652 Ga0070698_1000726522 432
177 3300005518 Ga0070699_100040452 Ga0070699_1000404523 432
178 3300005545 Ga0070695_100027375 Ga0070695_1000273752 432
179 3300005546 Ga0070696_100079857 Ga0070696_1000798572 432
180 3300025910 Ga0207684_10043015 Ga0207684_100430152 432
181 3300048912 Ga0496109_0227813 Ga0496109_0227813_373_1725 432
182 3300005841 Ga0068863_100055320 Ga0068863_1000553204 433
183 3300006847 Ga0075431_100076696 Ga0075431_1000766962 433
184 3300028556 Ga0265337_1024128 Ga0265337_10241281 433
185 3300028563 Ga0265319_1011466 Ga0265319_10114662 433
186 3300028577 Ga0265318_10015440 Ga0265318_100154402 433
187 3300028800 Ga0265338_10091823 Ga0265338_100918232 433
188 3300029957 Ga0265324_10015563 Ga0265324_100155633 433
189 3300031240 Ga0265320_10001931 Ga0265320_100019312 433
190 3300031595 Ga0265313_10034497 Ga0265313_100344972 433
191 3300031711 Ga0265314_10003728 Ga0265314_100037282 433
192 3300049572 Ga0501036_0026301 Ga0501036_0026301_1087_2430 433
193 3300049587 Ga0501071_0010881 Ga0501071_0010881_2501_3844 433
194 3300049592 Ga0501076_0098128 Ga0501076_0098128_265_1608 433
195 3300049593 Ga0501077_0023502 Ga0501077_0023502_1025_2368 433
196 3300049741 Ga0501079_0090828 Ga0501079_0090828_691_2034 433
197 3300049743 Ga0501081_0008739 Ga0501081_0008739_4161_5504 433
198 3300060353 Ga0501082_0024356 Ga0501082_0024356_1478_2821 433
199 3300005329 Ga0070683_100201342 Ga0070683_1002013422 434
200 3300005345 Ga0070692_10036497 Ga0070692_100364971 434
201 3300005347 Ga0070668_100087463 Ga0070668_1000874632 434
202 3300005354 Ga0070675_100035406 Ga0070675_1000354064 434
203 3300005356 Ga0070674_100001116 Ga0070674_1000011168 434
204 3300005364 Ga0070673_100032952 Ga0070673_1000329523 434
205 3300005366 Ga0070659_100034131 Ga0070659_1000341312 434
206 3300005367 Ga0070667_100083775 Ga0070667_1000837752 434
207 3300005438 Ga0070701_10020998 Ga0070701_100209982 434
208 3300005441 Ga0070700_100008655 Ga0070700_1000086552 434
209 3300005455 Ga0070663_100061574 Ga0070663_1000615742 434
210 3300005459 Ga0068867_100006532 Ga0068867_1000065324 434
211 3300005535 Ga0070684_100035818 Ga0070684_1000358185 434
212 3300005547 Ga0070693_100003144 Ga0070693_1000031446 434
213 3300005564 Ga0070664_100032156 Ga0070664_1000321563 434
214 3300005615 Ga0070702_100002279 Ga0070702_1000022793 434
215 3300005617 Ga0068859_100008240 Ga0068859_1000082404 434
216 3300005618 Ga0068864_100051105 Ga0068864_1000511053 434
217 3300005718 Ga0068866_10056614 Ga0068866_100566142 434
218 3300005840 Ga0068870_10004617 Ga0068870_100046173 434
219 3300005841 Ga0068863_100112419 Ga0068863_1001124192 434
220 3300005842 Ga0068858_100034505 Ga0068858_1000345054 434
221 3300005985 Ga0081539_10029721 Ga0081539_100297213 434
222 3300006844 Ga0075428_100014023 Ga0075428_1000140236 434
223 3300006881 Ga0068865_100026965 Ga0068865_1000269654 434
224 3300006931 Ga0097620_100008241 Ga0097620_1000082414 434
225 3300009094 Ga0111539_10015164 Ga0111539_100151645 434
226 3300009148 Ga0105243_10004531 Ga0105243_100045315 434
227 3300009148 Ga0105243_10301039 Ga0105243_103010391 434
228 3300009177 Ga0105248_10045894 Ga0105248_100458943 434
229 3300009551 Ga0105238_10042511 Ga0105238_100425114 434
230 3300009553 Ga0105249_10034163 Ga0105249_100341634 434
231 3300010375 Ga0105239_10007925 Ga0105239_100079254 434
232 3300013297 Ga0157378_10030972 Ga0157378_100309723 434
233 3300013308 Ga0157375_10005306 Ga0157375_100053068 434
234 3300014326 Ga0157380_10010874 Ga0157380_100108743 434
235 3300025908 Ga0207643_10005791 Ga0207643_100057915 434
236 3300025918 Ga0207662_10002007 Ga0207662_100020078 434
237 3300025919 Ga0207657_10100241 Ga0207657_101002412 434
238 3300025927 Ga0207687_10013365 Ga0207687_100133652 434
239 3300025931 Ga0207644_10215665 Ga0207644_102156652 434
240 3300025935 Ga0207709_10013924 Ga0207709_100139243 434
241 3300025936 Ga0207670_10009148 Ga0207670_100091485 434
242 3300025945 Ga0207679_10050656 Ga0207679_100506562 434
243 3300025960 Ga0207651_10033071 Ga0207651_100330711 434
244 3300025972 Ga0207668_10064511 Ga0207668_100645112 434
245 3300026035 Ga0207703_10023793 Ga0207703_100237933 434
246 3300026067 Ga0207678_10040635 Ga0207678_100406354 434
247 3300026075 Ga0207708_10005128 Ga0207708_100051285 434
248 3300026075 Ga0207708_10059415 Ga0207708_100594152 434
249 3300026089 Ga0207648_10003076 Ga0207648_1000307614 434
250 3300026116 Ga0207674_10134950 Ga0207674_101349502 434
251 3300026118 Ga0207675_100113215 Ga0207675_1001132152 434
252 3300026121 Ga0207683_10044506 Ga0207683_100445063 434
253 3300028381 Ga0268264_10043072 Ga0268264_100430725 434
254 3300032002 Ga0307416_100001579 Ga0307416_10000157910 434
255 3300032126 Ga0307415_100019327 Ga0307415_1000193272 434
256 3300048909 Ga0496106_0066763 Ga0496106_0066763_418_1782 434
257 3300048911 Ga0496108_0050166 Ga0496108_0050166_1797_3161 434
258 3300048916 Ga0496113_0063513 Ga0496113_0063513_1068_2432 434
259 3300049568 Ga0501031_0114806 Ga0501031_0114806_262_1614 434
260 3300049576 Ga0501040_0030658 Ga0501040_0030658_2120_3472 434
261 3300049590 Ga0501074_0193276 Ga0501074_0193276_55_1407 434
262 3300049592 Ga0501076_0015705 Ga0501076_0015705_1939_3291 434
263 3300049824 Ga0501045_0025272 Ga0501045_0025272_461_1813 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10397

ADSL_C

Adenylosuccinate lyase C-terminus

350

428

0.96

PF00206

Lyase_1

Lyase

3

284

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jbd-assembly1.cif.gz_A-2 crystal structure of adenylosuccinate lyase from thermus thermophilus hb8, ttpurb 0.9009 1 328
8jbd-assembly1.cif.gz_B-2 crystal structure of adenylosuccinate lyase from thermus thermophilus hb8, ttpurb 0.8632 1 349
2fen-assembly2.cif.gz_E 3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2 0.8588 9 333
8jbd-assembly1.cif.gz_B-2 crystal structure of adenylosuccinate lyase from thermus thermophilus hb8, ttpurb 0.8577 1 349
2fen-assembly1.cif.gz_D 3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2 0.8406 9 332
ID Description Score Start End Superfamily
2x75A01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9681 2 92 1.10.275.10
2x75A01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9579 2 92 1.10.275.10
2pfmB01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9458 2 92 1.10.275.10
1c3uB01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9357 2 92 1.10.275.10
1c3uB01 Mainly Alpha;Orthogonal Bundle;Fumarase C; Chain B, domain 1;Fumarase/aspartase (N-terminal domain) 0.9261 2 92 1.10.275.10
ID Description Score Start End GO Terms
AF-A0A1Q7UV81-F1-model_v4 Fumarate lyase N-terminal domain-containing protein 0.9821 11 108 GO:0004018
GO:0005829
GO:0044208
GO:0070626
AF-A0A7C5FK43-F1-model_v4 Adenylosuccinate lyase 0.9686 1 107 GO:0004018
GO:0005829
GO:0044208
GO:0070626
AF-A0A2V6ZY15-F1-model_v4 Adenylosuccinate lyase 0.9673 1 178 GO:0004018
GO:0005829
GO:0044208
GO:0070626
AF-A0A4R5MTY8-F1-model_v4 deleted 0.9667 1 123
AF-A0A7C7K395-F1-model_v4 Adenylosuccinate lyase 0.9665 1 106 GO:0004018
GO:0005829
GO:0044208
GO:0070626

Feature Viewer

pLDDT pTM Quality
82.1 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map