F371827

General Info

Members Datasets Scaffolds Average Seq Length
263 141 526 308

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10589937|Ga0111539_105899372
Length 348
Sequence MDGLLIIDKPAGPTSHDVVSRMRRLLREKRIGHTGTLDPMATGVLLLVVGRATRLSQFLTASDKSYEAVVRLGFATDTADAEGQPAGPISRAPLPPRETIDAALDEFRGTFLQQPPAFSAKKIDGKRSHKLARARARGDARLKPSRSGTSFGVAAPPGSPGLLDPPXXXSLAAASPSFVSVTTYAVEVVGLHGDRVTLRVDCSAGFYIRSLAHDLGERLGVGGHLVALRRTRSGTLTLADAVGLDAIEREPELAAGRVIPLANMLPGLAPVVLTSDGVRKAIHGRELGPGDCVSGFASRDSGLGIQSESGTTIRESRLYRLLDPAGQLVAIARPATAAGLLHPSVVLL

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
108 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
109 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 3.8
Rhizosphere 95.06
Stem 0
Stem Tuber 0
Unclassified 7.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10589937 3300009094 Bacteria 1294
2 Ga0065712_10077436 3300005290 Bacteria 3491
3 Ga0065707_10001501 3300005295 Bacteria 7697
4 Ga0070658_10184744 3300005327 Unclassified 1755
5 Ga0070676_10001489 3300005328 Bacteria 11843
6 Ga0070676_10109579 3300005328 Bacteria 1718
7 Ga0070683_100020773 3300005329 Bacteria 5849
8 Ga0070666_10008148 3300005335 Bacteria 6491
9 Ga0070666_10325325 3300005335 Bacteria 1097
10 Ga0070682_100295243 3300005337 Bacteria 1187
11 Ga0070689_100042380 3300005340 Bacteria 3495
12 Ga0070691_10016878 3300005341 Bacteria 3358
13 Ga0070687_100002030 3300005343 Bacteria 7434
14 Ga0070687_100120848 3300005343 Bacteria 1498
15 Ga0070668_100177963 3300005347 Bacteria 1736
16 Ga0070669_100027826 3300005353 Bacteria 4069
17 Ga0070669_100035786 3300005353 Bacteria 3597
18 Ga0070669_100036668 3300005353 Bacteria 3554
19 Ga0070669_100057414 3300005353 Bacteria 2855
20 Ga0070669_100077272 3300005353 Bacteria 2473
21 Ga0070675_100002124 3300005354 Bacteria 14642
22 Ga0070671_100004389 3300005355 Bacteria 11150
23 Ga0070674_100001069 3300005356 Bacteria 14335
24 Ga0070674_100101748 3300005356 Bacteria 2095
25 Ga0070674_100173690 3300005356 Bacteria 1645
26 Ga0070674_100402368 3300005356 Bacteria 1119
27 Ga0070673_100054973 3300005364 Bacteria 3135
28 Ga0070673_100061986 3300005364 Bacteria 2969
29 Ga0070667_100084297 3300005367 Bacteria 2724
30 Ga0070701_10118727 3300005438 Bacteria 1487
31 Ga0070705_100042454 3300005440 Bacteria 2600
32 Ga0070700_100005312 3300005441 Bacteria 6810
33 Ga0070700_100056151 3300005441 Unclassified 2467
34 Ga0070694_100014947 3300005444 Bacteria 4863
35 Ga0070708_100213315 3300005445 Unclassified 1809
36 Ga0070662_100031873 3300005457 Bacteria 3702
37 Ga0070662_100136994 3300005457 Bacteria 1894
38 Ga0070681_10029886 3300005458 Bacteria 5469
39 Ga0070681_10107335 3300005458 Bacteria 2733
40 Ga0068867_100119851 3300005459 Bacteria 2032
41 Ga0068867_100196415 3300005459 Bacteria 1613
42 Ga0070707_100233251 3300005468 Bacteria 1791
43 Ga0070707_100244776 3300005468 Bacteria 1745
44 Ga0070698_100030792 3300005471 Bacteria 5563
45 Ga0070698_100039488 3300005471 Bacteria 4858
46 Ga0070699_100002282 3300005518 Bacteria 17248
47 Ga0070699_100064784 3300005518 Bacteria 3170
48 Ga0070679_100018134 3300005530 Bacteria 6824
49 Ga0070679_100150747 3300005530 Bacteria 2302
50 Ga0070686_100004278 3300005544 Bacteria 7869
51 Ga0070686_100223893 3300005544 Bacteria 1361
52 Ga0070695_100002175 3300005545 Bacteria 11231
53 Ga0070695_100220707 3300005545 Bacteria 1366
54 Ga0070696_100028666 3300005546 Bacteria 3799
55 Ga0070665_100000947 3300005548 Bacteria 37012
56 Ga0070704_100012744 3300005549 Bacteria 5200
57 Ga0068855_100185128 3300005563 Bacteria 2352
58 Ga0068854_100158449 3300005578 Bacteria 1751
59 Ga0068854_100188781 3300005578 Bacteria 1613
60 Ga0068854_100436424 3300005578 Bacteria 1091
61 Ga0070702_100004052 3300005615 Bacteria 6642
62 Ga0068859_100001016 3300005617 Bacteria 28725
63 Ga0068859_100242014 3300005617 Unclassified 1894
64 Ga0068864_100292303 3300005618 Bacteria 1523
65 Ga0068866_10026521 3300005718 Bacteria 2737
66 Ga0068861_100012520 3300005719 Bacteria 5917
67 Ga0068861_100079931 3300005719 Bacteria 2557
68 Ga0068861_100234876 3300005719 Bacteria 1557
69 Ga0068863_100325511 3300005841 Bacteria 1493
70 Ga0068858_100043456 3300005842 Bacteria 4166
71 Ga0068858_100091905 3300005842 Bacteria 2824
72 Ga0068858_100194681 3300005842 Bacteria 1916
73 Ga0068858_100207731 3300005842 Unclassified 1853
74 Ga0068858_100669275 3300005842 Bacteria 1009
75 Ga0068862_100134799 3300005844 Bacteria 2188
76 Ga0068862_100294742 3300005844 Bacteria 1491
77 Ga0068862_100515719 3300005844 Unclassified 1137
78 Ga0081455_10020806 3300005937 Bacteria 6166
79 Ga0097621_100000621 3300006237 Bacteria 25044
80 Ga0097621_100002917 3300006237 Bacteria 11749
81 Ga0075370_10030390 3300006353 Bacteria 3014
82 Ga0068871_100000308 3300006358 Bacteria 34022
83 Ga0075428_100002343 3300006844 Bacteria 20552
84 Ga0075428_100288901 3300006844 Unclassified 1764
85 Ga0075428_100469231 3300006844 Unclassified 1347
86 Ga0075431_100055900 3300006847 Bacteria 4072
87 Ga0075431_100208877 3300006847 Bacteria 1995
88 Ga0075434_100001575 3300006871 Bacteria 19332
89 Ga0075434_100002563 3300006871 Bacteria 16046
90 Ga0075434_100076670 3300006871 Bacteria 3338
91 Ga0075434_100200774 3300006871 Bacteria 2014
92 Ga0075434_100260564 3300006871 Unclassified 1753
93 Ga0068865_100000313 3300006881 Bacteria 26815
94 Ga0075436_100001140 3300006914 Bacteria 17973
95 Ga0075436_100020614 3300006914 Bacteria 4524
96 Ga0075436_100021031 3300006914 Bacteria 4476
97 Ga0075436_100030255 3300006914 Bacteria 3727
98 Ga0097620_100001016 3300006931 Bacteria 28725
99 Ga0097620_100242002 3300006931 Unclassified 1894
100 Ga0075435_100000417 3300007076 Bacteria 26219
101 Ga0075435_100007408 3300007076 Bacteria 7815
102 Ga0075435_100034538 3300007076 Bacteria 4007
103 Ga0075435_100055002 3300007076 Bacteria 3213
104 Ga0075435_100073276 3300007076 Bacteria 2799
105 Ga0111539_10000366 3300009094 Bacteria 55748
106 Ga0111539_10019289 3300009094 Bacteria 8420
107 Ga0111539_10036858 3300009094 Bacteria 5910
108 Ga0111539_10143080 3300009094 Bacteria 2799
109 Ga0111539_10394474 3300009094 Bacteria 1612
110 Ga0105245_10010193 3300009098 Bacteria 8182
111 Ga0105247_10021389 3300009101 Bacteria 3893
112 Ga0105247_10022299 3300009101 Bacteria 3813
113 Ga0114129_10007322 3300009147 Bacteria 15705
114 Ga0114129_10023699 3300009147 Bacteria 8702
115 Ga0114129_10053465 3300009147 Bacteria 5663
116 Ga0114129_10564447 3300009147 Unclassified 1478
117 Ga0105243_10024829 3300009148 Bacteria 4575
118 Ga0105243_10027396 3300009148 Bacteria 4366
119 Ga0105242_10023714 3300009176 Bacteria 4838
120 Ga0105248_10018388 3300009177 Bacteria 7721
121 Ga0105248_10116432 3300009177 Bacteria 3014
122 Ga0105248_10140944 3300009177 Bacteria 2720
123 Ga0105248_10288525 3300009177 Bacteria 1848
124 Ga0105248_10433668 3300009177 Bacteria 1480
125 Ga0105238_10352802 3300009551 Bacteria 1460
126 Ga0105249_10143956 3300009553 Bacteria 2288
127 Ga0105249_10165186 3300009553 Bacteria 2142
128 Ga0163162_10098437 3300013306 Bacteria 3014
129 Ga0157375_10092149 3300013308 Bacteria 3093
130 Ga0157375_10464529 3300013308 Bacteria 1431
131 Ga0157380_10008338 3300014326 Bacteria 7387
132 Ga0157380_10027033 3300014326 Bacteria 4360
133 Ga0157380_10110744 3300014326 Bacteria 2307
134 Ga0157379_10002823 3300014968 Bacteria 14633
135 Ga0157376_10042461 3300014969 Bacteria 3727
136 Ga0163161_10143048 3300017792 Bacteria 1812
137 Ga0207642_10117083 3300025899 Bacteria 1368
138 Ga0207710_10005148 3300025900 Bacteria 5649
139 Ga0207680_10002783 3300025903 Bacteria 8180
140 Ga0207645_10196043 3300025907 Bacteria 1328
141 Ga0207707_10027468 3300025912 Bacteria 4977
142 Ga0207660_10058277 3300025917 Bacteria 2769
143 Ga0207662_10025159 3300025918 Bacteria 3427
144 Ga0207662_10095309 3300025918 Bacteria 1837
145 Ga0207657_10011604 3300025919 Bacteria 8740
146 Ga0207652_10041952 3300025921 Bacteria 3892
147 Ga0207652_10550390 3300025921 Bacteria 1037
148 Ga0207646_10009801 3300025922 Bacteria 9435
149 Ga0207646_10172249 3300025922 Bacteria 1955
150 Ga0207646_10230149 3300025922 Bacteria 1674
151 Ga0207681_10023173 3300025923 Bacteria 3968
152 Ga0207681_10028839 3300025923 Bacteria 3598
153 Ga0207681_10031108 3300025923 Bacteria 3483
154 Ga0207681_10052492 3300025923 Unclassified 2765
155 Ga0207681_10128300 3300025923 Bacteria 1871
156 Ga0207659_10000196 3300025926 Bacteria 35986
157 Ga0207659_10083971 3300025926 Bacteria 2362
158 Ga0207659_10177075 3300025926 Unclassified 1687
159 Ga0207706_10045401 3300025933 Bacteria 3893
160 Ga0207686_10060619 3300025934 Bacteria 2396
161 Ga0207709_10040629 3300025935 Bacteria 2786
162 Ga0207670_10015185 3300025936 Bacteria 4594
163 Ga0207669_10020017 3300025937 Bacteria 3498
164 Ga0207669_10041002 3300025937 Bacteria 2691
165 Ga0207704_10156255 3300025938 Unclassified 1617
166 Ga0207704_10250402 3300025938 Bacteria 1329
167 Ga0207691_10032181 3300025940 Bacteria 4891
168 Ga0207711_10066294 3300025941 Bacteria 3123
169 Ga0207711_10265213 3300025941 Unclassified 1579
170 Ga0207711_10299130 3300025941 Bacteria 1484
171 Ga0207667_10082575 3300025949 Bacteria 3328
172 Ga0207667_10513480 3300025949 Bacteria 1214
173 Ga0207651_10021471 3300025960 Bacteria 3925
174 Ga0207651_10024530 3300025960 Bacteria 3733
175 Ga0207640_10011407 3300025981 Bacteria 5032
176 Ga0207658_10069016 3300025986 Bacteria 2669
177 Ga0207677_10026556 3300026023 Bacteria 3634
178 Ga0207703_10032997 3300026035 Bacteria 4102
179 Ga0207703_10127055 3300026035 Bacteria 2197
180 Ga0207703_10135996 3300026035 Bacteria 2128
181 Ga0207703_10159960 3300026035 Bacteria 1972
182 Ga0207708_10010620 3300026075 Bacteria 6838
183 Ga0207708_10043971 3300026075 Bacteria 3404
184 Ga0207708_10149141 3300026075 Bacteria 1840
185 Ga0207641_10059370 3300026088 Bacteria 3256
186 Ga0207641_10092649 3300026088 Bacteria 2647
187 Ga0207648_10011682 3300026089 Bacteria 8264
188 Ga0207648_10021670 3300026089 Bacteria 5773
189 Ga0207648_10047298 3300026089 Bacteria 3772
190 Ga0207648_10160015 3300026089 Bacteria 1989
191 Ga0207648_10466463 3300026089 Unclassified 1152
192 Ga0207676_10005834 3300026095 Bacteria 8704
193 Ga0207675_100005094 3300026118 Bacteria 12643
194 Ga0207675_100071662 3300026118 Bacteria 3240
195 Ga0207675_100074056 3300026118 Bacteria 3186
196 Ga0207675_100183889 3300026118 Bacteria 2002
197 Ga0207675_100257139 3300026118 Bacteria 1692
198 Ga0207683_10081445 3300026121 Bacteria 2873
199 Ga0207428_10000294 3300027907 Bacteria 66640
200 Ga0207428_10000491 3300027907 Bacteria 47284
201 Ga0207428_10003104 3300027907 Bacteria 16327
202 Ga0207428_10204556 3300027907 Bacteria 1485
203 Ga0268264_10166319 3300028381 Unclassified 1991
204 Ga0307413_10098115 3300031824 Bacteria 1928
205 Ga0307416_100034505 3300032002 Bacteria 3851
206 Ga0373930_0002766 3300034816 Unclassified 2738
207 Ga0373948_0000251 3300034817 Bacteria 6456
208 Ga0373928_0030660 3300035084 Bacteria 1190
209 Ga0373944_0065681 3300035089 Bacteria 1172
210 Ga0373949_0008269 3300035090 Bacteria 2278
211 Ga0373951_0001174 3300035091 Bacteria 6923
212 Ga0373952_0000970 3300035092 Bacteria 5215
213 Ga0373939_0003058 3300035114 Bacteria 3929
214 Ga0373941_0001306 3300035115 Bacteria 5242
215 Ga0373960_0000580 3300035121 Bacteria 7463
216 Ga0373961_0002075 3300035241 Bacteria 5338
217 Ga0373962_0000828 3300035242 Bacteria 7067
218 Ga0373931_0009411 3300035691 Bacteria 4672
219 Ga0373925_0214655 3300037068 Bacteria 1534
220 Ga0451807_1478434 3300041486 Bacteria 1157
221 Ga0451576_0006583 3300045051 Bacteria 14208
222 Ga0451576_0733172 3300045051 Bacteria 1038
223 Ga0495621_0004171 3300046539 Bacteria 4036
224 Ga0495633_0077493 3300046558 Bacteria 1548
225 Ga0496102_0294402 3300048905 Bacteria 1530
226 Ga0496102_0686829 3300048905 Bacteria 947
227 Ga0496106_0075537 3300048909 Bacteria 2581
228 Ga0496110_0338463 3300048913 Bacteria 1371
229 Ga0496112_0002130 3300048915 Bacteria 15719
230 Ga0496114_0018898 3300048917 Bacteria 5582
231 Ga0496114_0040688 3300048917 Bacteria 3849
232 Ga0496114_0042222 3300048917 Bacteria 3780
233 Ga0496115_0025713 3300048918 Bacteria 4588
234 Ga0501042_0054322 3300049578 Bacteria 2857
235 nmdc:mga05p37_4878_c1 3300050507 Bacteria 15701
236 nmdc:mga05p37_8274_c1 3300050507 Bacteria 12299
237 nmdc:mga05p37_9415_c1 3300050507 Bacteria 11564
238 nmdc:mga06r32_185987_c1 3300050510 Bacteria 2064
239 nmdc:mga06r32_88419_c1 3300050510 Bacteria 3024
240 nmdc:mga08y16_12911_c1 3300050511 Bacteria 8786
241 nmdc:mga08y16_17415_c1 3300050511 Bacteria 7566
242 nmdc:mga08y16_20016_c1 3300050511 Bacteria 7059
243 nmdc:mga08y16_266841_c1 3300050511 Unclassified 1767
244 nmdc:mga08y16_541001_c1 3300050511 Bacteria 1180
245 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
246 nmdc:mga0n895_123794_c1 3300050512 Bacteria 2608
247 nmdc:mga0n895_182_c1 3300050512 Bacteria 38722
248 nmdc:mga0n895_51091_c1 3300050512 Bacteria 4055
249 nmdc:mga0n895_553527_c1 3300050512 Unclassified 1156
250 nmdc:mga0rr50_154082_c1 3300050513 Bacteria 1860
251 nmdc:mga0rr50_38622_c1 3300050513 Bacteria 3457
252 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
253 nmdc:mga0rr50_4612_c1 3300050513 Bacteria 8117
254 nmdc:mga0rr50_4631_c1 3300050513 Bacteria 8104
255 nmdc:mga08x19_152086_c1 3300050514 Bacteria 1568
256 nmdc:mga08x19_18245_c1 3300050514 Bacteria 4300
257 nmdc:mga08x19_21106_c1 3300050514 Bacteria 4017
258 nmdc:mga08x19_50835_c1 3300050514 Bacteria 2660
259 nmdc:mga08x19_753_c1 3300050514 Bacteria 20724
260 Ga0495601_0030670 3300053077 Bacteria 3340
261 Ga0500555_013121 3300053103 Unclassified 2389
262 Ga0500593_119828 3300053117 Bacteria 1068
263 Ga0501084_0160605 3300054114 Bacteria 1896
264 Ga0111539_10589937
265 Ga0065712_10077436
266 Ga0065707_10001501
267 Ga0070658_10184744
268 Ga0070676_10001489
269 Ga0070676_10109579
270 Ga0070683_100020773
271 Ga0070666_10008148
272 Ga0070666_10325325
273 Ga0070682_100295243
274 Ga0070689_100042380
275 Ga0070691_10016878
276 Ga0070687_100002030
277 Ga0070687_100120848
278 Ga0070668_100177963
279 Ga0070669_100027826
280 Ga0070669_100035786
281 Ga0070669_100036668
282 Ga0070669_100057414
283 Ga0070669_100077272
284 Ga0070675_100002124
285 Ga0070671_100004389
286 Ga0070674_100001069
287 Ga0070674_100101748
288 Ga0070674_100173690
289 Ga0070674_100402368
290 Ga0070673_100054973
291 Ga0070673_100061986
292 Ga0070667_100084297
293 Ga0070701_10118727
294 Ga0070705_100042454
295 Ga0070700_100005312
296 Ga0070700_100056151
297 Ga0070694_100014947
298 Ga0070708_100213315
299 Ga0070662_100031873
300 Ga0070662_100136994
301 Ga0070681_10029886
302 Ga0070681_10107335
303 Ga0068867_100119851
304 Ga0068867_100196415
305 Ga0070707_100233251
306 Ga0070707_100244776
307 Ga0070698_100030792
308 Ga0070698_100039488
309 Ga0070699_100002282
310 Ga0070699_100064784
311 Ga0070679_100018134
312 Ga0070679_100150747
313 Ga0070686_100004278
314 Ga0070686_100223893
315 Ga0070695_100002175
316 Ga0070695_100220707
317 Ga0070696_100028666
318 Ga0070665_100000947
319 Ga0070704_100012744
320 Ga0068855_100185128
321 Ga0068854_100158449
322 Ga0068854_100188781
323 Ga0068854_100436424
324 Ga0070702_100004052
325 Ga0068859_100001016
326 Ga0068859_100242014
327 Ga0068864_100292303
328 Ga0068866_10026521
329 Ga0068861_100012520
330 Ga0068861_100079931
331 Ga0068861_100234876
332 Ga0068863_100325511
333 Ga0068858_100043456
334 Ga0068858_100091905
335 Ga0068858_100194681
336 Ga0068858_100207731
337 Ga0068858_100669275
338 Ga0068862_100134799
339 Ga0068862_100294742
340 Ga0068862_100515719
341 Ga0081455_10020806
342 Ga0097621_100000621
343 Ga0097621_100002917
344 Ga0075370_10030390
345 Ga0068871_100000308
346 Ga0075428_100002343
347 Ga0075428_100288901
348 Ga0075428_100469231
349 Ga0075431_100055900
350 Ga0075431_100208877
351 Ga0075434_100001575
352 Ga0075434_100002563
353 Ga0075434_100076670
354 Ga0075434_100200774
355 Ga0075434_100260564
356 Ga0068865_100000313
357 Ga0075436_100001140
358 Ga0075436_100020614
359 Ga0075436_100021031
360 Ga0075436_100030255
361 Ga0097620_100001016
362 Ga0097620_100242002
363 Ga0075435_100000417
364 Ga0075435_100007408
365 Ga0075435_100034538
366 Ga0075435_100055002
367 Ga0075435_100073276
368 Ga0111539_10000366
369 Ga0111539_10019289
370 Ga0111539_10036858
371 Ga0111539_10143080
372 Ga0111539_10394474
373 Ga0105245_10010193
374 Ga0105247_10021389
375 Ga0105247_10022299
376 Ga0114129_10007322
377 Ga0114129_10023699
378 Ga0114129_10053465
379 Ga0114129_10564447
380 Ga0105243_10024829
381 Ga0105243_10027396
382 Ga0105242_10023714
383 Ga0105248_10018388
384 Ga0105248_10116432
385 Ga0105248_10140944
386 Ga0105248_10288525
387 Ga0105248_10433668
388 Ga0105238_10352802
389 Ga0105249_10143956
390 Ga0105249_10165186
391 Ga0163162_10098437
392 Ga0157375_10092149
393 Ga0157375_10464529
394 Ga0157380_10008338
395 Ga0157380_10027033
396 Ga0157380_10110744
397 Ga0157379_10002823
398 Ga0157376_10042461
399 Ga0163161_10143048
400 Ga0207642_10117083
401 Ga0207710_10005148
402 Ga0207680_10002783
403 Ga0207645_10196043
404 Ga0207707_10027468
405 Ga0207660_10058277
406 Ga0207662_10025159
407 Ga0207662_10095309
408 Ga0207657_10011604
409 Ga0207652_10041952
410 Ga0207652_10550390
411 Ga0207646_10009801
412 Ga0207646_10172249
413 Ga0207646_10230149
414 Ga0207681_10023173
415 Ga0207681_10028839
416 Ga0207681_10031108
417 Ga0207681_10052492
418 Ga0207681_10128300
419 Ga0207659_10000196
420 Ga0207659_10083971
421 Ga0207659_10177075
422 Ga0207706_10045401
423 Ga0207686_10060619
424 Ga0207709_10040629
425 Ga0207670_10015185
426 Ga0207669_10020017
427 Ga0207669_10041002
428 Ga0207704_10156255
429 Ga0207704_10250402
430 Ga0207691_10032181
431 Ga0207711_10066294
432 Ga0207711_10265213
433 Ga0207711_10299130
434 Ga0207667_10082575
435 Ga0207667_10513480
436 Ga0207651_10021471
437 Ga0207651_10024530
438 Ga0207640_10011407
439 Ga0207658_10069016
440 Ga0207677_10026556
441 Ga0207703_10032997
442 Ga0207703_10127055
443 Ga0207703_10135996
444 Ga0207703_10159960
445 Ga0207708_10010620
446 Ga0207708_10043971
447 Ga0207708_10149141
448 Ga0207641_10059370
449 Ga0207641_10092649
450 Ga0207648_10011682
451 Ga0207648_10021670
452 Ga0207648_10047298
453 Ga0207648_10160015
454 Ga0207648_10466463
455 Ga0207676_10005834
456 Ga0207675_100005094
457 Ga0207675_100071662
458 Ga0207675_100074056
459 Ga0207675_100183889
460 Ga0207675_100257139
461 Ga0207683_10081445
462 Ga0207428_10000294
463 Ga0207428_10000491
464 Ga0207428_10003104
465 Ga0207428_10204556
466 Ga0268264_10166319
467 Ga0307413_10098115
468 Ga0307416_100034505
469 Ga0373930_0002766
470 Ga0373948_0000251
471 Ga0373928_0030660
472 Ga0373944_0065681
473 Ga0373949_0008269
474 Ga0373951_0001174
475 Ga0373952_0000970
476 Ga0373939_0003058
477 Ga0373941_0001306
478 Ga0373960_0000580
479 Ga0373961_0002075
480 Ga0373962_0000828
481 Ga0373931_0009411
482 Ga0373925_0214655
483 Ga0451807_1478434
484 Ga0451576_0006583
485 Ga0451576_0733172
486 Ga0495621_0004171
487 Ga0495633_0077493
488 Ga0496102_0294402
489 Ga0496102_0686829
490 Ga0496106_0075537
491 Ga0496110_0338463
492 Ga0496112_0002130
493 Ga0496114_0018898
494 Ga0496114_0040688
495 Ga0496114_0042222
496 Ga0496115_0025713
497 Ga0501042_0054322
498 nmdc:mga05p37_4878_c1
499 nmdc:mga05p37_8274_c1
500 nmdc:mga05p37_9415_c1
501 nmdc:mga06r32_185987_c1
502 nmdc:mga06r32_88419_c1
503 nmdc:mga08y16_12911_c1
504 nmdc:mga08y16_17415_c1
505 nmdc:mga08y16_20016_c1
506 nmdc:mga08y16_266841_c1
507 nmdc:mga08y16_541001_c1
508 nmdc:mga08y16_6_c1
509 nmdc:mga0n895_123794_c1
510 nmdc:mga0n895_182_c1
511 nmdc:mga0n895_51091_c1
512 nmdc:mga0n895_553527_c1
513 nmdc:mga0rr50_154082_c1
514 nmdc:mga0rr50_38622_c1
515 nmdc:mga0rr50_45_c1
516 nmdc:mga0rr50_4612_c1
517 nmdc:mga0rr50_4631_c1
518 nmdc:mga08x19_152086_c1
519 nmdc:mga08x19_18245_c1
520 nmdc:mga08x19_21106_c1
521 nmdc:mga08x19_50835_c1
522 nmdc:mga08x19_753_c1
523 Ga0495601_0030670
524 Ga0500555_013121
525 Ga0500593_119828
526 Ga0501084_0160605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01509

TruB_N

TruB family pseudouridylate synthase (N terminal domain)

23

146

0.94

PF16198

TruB_C_2

tRNA pseudouridylate synthase B C-terminal domain

209

265

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ze1-assembly4.cif.gz_D conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.9076 2 311
1sgv-assembly1.cif.gz_A structure of trna psi55 pseudouridine synthase (trub) 0.8812 2 323
1ze2-assembly1.cif.gz_A conformational change of pseudouridine 55 synthase upon its association with rna substrate 0.877 2 322
2ab4-assembly1.cif.gz_A dissecting the roles of a strictly conserved tyrosine in substrate recognition and catalysis by pseudouridine 55 synthase 0.8661 2 322
1k8w-assembly1.cif.gz_A crystal structure of the e. coli pseudouridine synthase trub bound to a t stem-loop rna 0.8649 1 324
ID Description Score Start End Superfamily
af_B9F4Z0_25_81_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9819 2 52 3.30.2350.10
af_Q57612_45_223_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.958 3 248 3.30.2350.10
1ze1D01 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9557 2 262 3.30.2350.10
1ze1D01 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9374 2 262 3.30.2350.10
af_Q57612_45_223_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9321 3 248 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A7J2J591-F1-model_v4 RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5 0.965 3 248 GO:0000495
GO:0003723
GO:0009982
GO:0031118
GO:0031120
GO:1990481
AF-A0A7C0Z1J8-F1-model_v4 RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5 0.9625 2 244 GO:0000495
GO:0003723
GO:0009982
GO:0031118
GO:0031120
GO:1990481
AF-A0A7C1G8H0-F1-model_v4 RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5 0.9549 3 252 GO:0000495
GO:0003723
GO:0009982
GO:0031118
GO:0031120
GO:1990481
AF-T1BV38-F1-model_v4 H/ACA RNA-protein complex component Cbf5p 0.9524 2 229 GO:0000495
GO:0003723
GO:0009982
GO:0031118
GO:0031120
GO:1990481
AF-A0A2M6YHM2-F1-model_v4 tRNA pseudouridine(55) synthase (EC 5.4.99.25) 0.9464 1 241 GO:0003723
GO:0006400
GO:0160148
GO:1990481

Map