F371655

General Info

Members Datasets Scaffolds Average Seq Length
263 174 526 324

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100004786|Ga0070714_1000047864
Length 368
Sequence VARQKELVERTLPHVGRAPRPRRTPWPGFFVLAVIFASWGNAQTDAQALPPPGFHHLHLNSTNPEAAIDFYTKQFPSTSKSTWGGMPALKTGKVYVLFNKVDRPAPNEPQTAIWHFGWHVVDVRETNARYNRDHVPLLPLYTGDGDNAVYISSDTWPGAGGTLGRTKPQITEAKANGVKPVGGAGFAYLLAPDGAAVEYQGNMPAERFNHVHMYQDDPFCAQLWYQKHLNAAIPGRGRGPQHTEADCKVERTPDKSWPALDKDGMYRIPGAGVLFDDVSLNWYIRQGDGPLVSTRGHMADHFALSVANLDAWVDKLGKEGVRFLPQQQQMSDGRIRVEGLGRPYKLGDTRAIMIEGPSKEAIELVEAK

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
96 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
97 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
98 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
99 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
100 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
101 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.46
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 14.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100004786 3300005435 Bacteria 10259
2 Ga0070690_100038174 3300005330 Bacteria 3029
3 Ga0070690_100274406 3300005330 Bacteria 1201
4 Ga0070666_10003066 3300005335 Bacteria 10148
5 Ga0068868_100269281 3300005338 Unclassified 1439
6 Ga0070691_10182715 3300005341 Bacteria 1093
7 Ga0070669_100021137 3300005353 Bacteria 4651
8 Ga0070667_100024828 3300005367 Bacteria 4980
9 Ga0070709_10026855 3300005434 Unclassified 3417
10 Ga0070709_10030633 3300005434 Bacteria 3230
11 Ga0070709_10245770 3300005434 Bacteria 1287
12 Ga0070713_100004470 3300005436 Bacteria 9397
13 Ga0070713_100030081 3300005436 Bacteria 4309
14 Ga0070713_100076092 3300005436 Unclassified 2849
15 Ga0070710_10023762 3300005437 Viruses 3226
16 Ga0070708_100109132 3300005445 Bacteria 2542
17 Ga0070708_100192664 3300005445 Bacteria 1907
18 Ga0070681_10054181 3300005458 Bacteria 3996
19 Ga0070681_10232303 3300005458 Unclassified 1759
20 Ga0070681_10444372 3300005458 Unclassified 1209
21 Ga0068867_100074692 3300005459 Bacteria 2542
22 Ga0070706_100017177 3300005467 Bacteria 6682
23 Ga0070707_100256129 3300005468 Bacteria 1703
24 Ga0070698_100074774 3300005471 Bacteria 3393
25 Ga0070697_100233452 3300005536 Bacteria 1569
26 Ga0068853_100060744 3300005539 Bacteria 3267
27 Ga0070672_100279187 3300005543 Bacteria 1412
28 Ga0070686_100000668 3300005544 Bacteria 20025
29 Ga0070686_100309216 3300005544 Unclassified 1175
30 Ga0070665_100111787 3300005548 Bacteria 2734
31 Ga0068856_100004088 3300005614 Bacteria 14583
32 Ga0068856_100070749 3300005614 Unclassified 3452
33 Ga0068859_100198393 3300005617 Bacteria 2091
34 Ga0068864_100001789 3300005618 Bacteria 17634
35 Ga0068864_100061137 3300005618 Bacteria 3263
36 Ga0068863_100043793 3300005841 Bacteria 4249
37 Ga0068863_100408491 3300005841 Bacteria 1329
38 Ga0068858_100004219 3300005842 Bacteria 14148
39 Ga0068858_100430103 3300005842 Bacteria 1270
40 Ga0068860_100021462 3300005843 Bacteria 6253
41 Ga0068862_100151221 3300005844 Unclassified 2066
42 Ga0068862_100299434 3300005844 Bacteria 1479
43 Ga0070717_10092050 3300006028 Unclassified 2561
44 Ga0070717_10147885 3300006028 Bacteria 2031
45 Ga0097621_100001625 3300006237 Bacteria 15417
46 Ga0097621_100012866 3300006237 Bacteria 6216
47 Ga0097621_100042068 3300006237 Bacteria 3679
48 Ga0097621_100222968 3300006237 Bacteria 1643
49 Ga0068871_100008133 3300006358 Bacteria 7530
50 Ga0068871_100166787 3300006358 Bacteria 1886
51 Ga0068871_100173877 3300006358 Bacteria 1848
52 Ga0068871_100287100 3300006358 Bacteria 1441
53 Ga0075431_100468969 3300006847 Unclassified 1253
54 Ga0075434_100049569 3300006871 Bacteria 4170
55 Ga0068865_100039729 3300006881 Bacteria 3193
56 Ga0075436_100169728 3300006914 Bacteria 1540
57 Ga0097620_100198416 3300006931 Bacteria 2091
58 Ga0075435_100000406 3300007076 Bacteria 26435
59 Ga0099795_10001124 3300007788 Bacteria 5572
60 Ga0105240_10054639 3300009093 Bacteria 5004
61 Ga0111539_10592966 3300009094 Bacteria 1290
62 Ga0105245_10005989 3300009098 Bacteria 10688
63 Ga0105245_10006911 3300009098 Bacteria 9951
64 Ga0105245_10014513 3300009098 Bacteria 6860
65 Ga0105245_10015516 3300009098 Bacteria 6642
66 Ga0105247_10009784 3300009101 Bacteria 5810
67 Ga0114129_10104125 3300009147 Bacteria 3922
68 Ga0105243_10012578 3300009148 Bacteria 6399
69 Ga0105243_10152395 3300009148 Unclassified 1984
70 Ga0105241_10002440 3300009174 Bacteria 13948
71 Ga0105241_10005631 3300009174 Bacteria 9241
72 Ga0105241_10276519 3300009174 Bacteria 1432
73 Ga0105242_10014487 3300009176 Bacteria 6109
74 Ga0105242_10026280 3300009176 Bacteria 4614
75 Ga0105242_10092933 3300009176 Bacteria 2542
76 Ga0105242_10153596 3300009176 Bacteria 2009
77 Ga0105248_10019769 3300009177 Bacteria 7458
78 Ga0105248_10032675 3300009177 Bacteria 5813
79 Ga0105248_10033978 3300009177 Bacteria 5700
80 Ga0105248_10051948 3300009177 Bacteria 4600
81 Ga0105248_10108534 3300009177 Bacteria 3130
82 Ga0105248_10295057 3300009177 Unclassified 1825
83 Ga0105248_10512398 3300009177 Bacteria 1353
84 Ga0105237_10014664 3300009545 Bacteria 8185
85 Ga0105238_10003506 3300009551 Bacteria 15622
86 Ga0105238_10027081 3300009551 Bacteria 5842
87 Ga0105239_10005545 3300010375 Bacteria 14772
88 Ga0105239_10037857 3300010375 Bacteria 5286
89 Ga0105246_10191112 3300011119 Bacteria 1585
90 Ga0157369_10027146 3300013105 Bacteria 6348
91 Ga0157374_10106071 3300013296 Bacteria 2699
92 Ga0157378_10013715 3300013297 Bacteria 7088
93 Ga0163162_10035282 3300013306 Unclassified 4980
94 Ga0163162_10126378 3300013306 Bacteria 2663
95 Ga0163162_10508376 3300013306 Bacteria 1335
96 Ga0157372_10366137 3300013307 Bacteria 1680
97 Ga0157372_10478892 3300013307 Bacteria 1451
98 Ga0157375_10038278 3300013308 Bacteria 4605
99 Ga0157375_10115285 3300013308 Bacteria 2790
100 Ga0157375_10156084 3300013308 Bacteria 2421
101 Ga0157375_10180282 3300013308 Bacteria 2263
102 Ga0157375_10652827 3300013308 Bacteria 1208
103 Ga0163163_10000335 3300014325 Bacteria 45290
104 Ga0163163_10010601 3300014325 Bacteria 8302
105 Ga0163163_10135585 3300014325 Bacteria 2503
106 Ga0163163_10254868 3300014325 Bacteria 1805
107 Ga0163163_10332333 3300014325 Bacteria 1574
108 Ga0157379_10186640 3300014968 Bacteria 1874
109 Ga0157376_10004782 3300014969 Bacteria 9426
110 Ga0157376_10095355 3300014969 Bacteria 2587
111 Ga0157376_10534833 3300014969 Unclassified 1157
112 Ga0213876_10005285 3300021384 Bacteria 7108
113 Ga0207710_10011912 3300025900 Bacteria 3659
114 Ga0207680_10001442 3300025903 Bacteria 11278
115 Ga0207680_10010030 3300025903 Bacteria 4723
116 Ga0207699_10080809 3300025906 Unclassified 2015
117 Ga0207684_10017592 3300025910 Bacteria 6131
118 Ga0207654_10011032 3300025911 Bacteria 4599
119 Ga0207707_10040772 3300025912 Bacteria 4055
120 Ga0207695_10075871 3300025913 Bacteria 3419
121 Ga0207695_10440057 3300025913 Unclassified 1187
122 Ga0207652_10432753 3300025921 Bacteria 1186
123 Ga0207646_10021099 3300025922 Bacteria 6024
124 Ga0207687_10044872 3300025927 Unclassified 3053
125 Ga0207700_10018892 3300025928 Bacteria 4644
126 Ga0207700_10145982 3300025928 Unclassified 1950
127 Ga0207664_10005048 3300025929 Bacteria 8984
128 Ga0207686_10063081 3300025934 Bacteria 2355
129 Ga0207709_10014587 3300025935 Bacteria 4342
130 Ga0207704_10159245 3300025938 Unclassified 1604
131 Ga0207691_10451295 3300025940 Bacteria 1094
132 Ga0207711_10024622 3300025941 Bacteria 5046
133 Ga0207711_10064848 3300025941 Bacteria 3156
134 Ga0207689_10186945 3300025942 Bacteria 1709
135 Ga0207651_10107317 3300025960 Bacteria 2087
136 Ga0207677_10196292 3300026023 Unclassified 1600
137 Ga0207677_10202242 3300026023 Bacteria 1580
138 Ga0207677_10373045 3300026023 Bacteria 1202
139 Ga0207703_10118112 3300026035 Bacteria 2273
140 Ga0207703_10340783 3300026035 Bacteria 1378
141 Ga0207702_10006565 3300026078 Bacteria 10003
142 Ga0207641_10019758 3300026088 Bacteria 5530
143 Ga0207641_10572672 3300026088 Unclassified 1103
144 Ga0207648_10069917 3300026089 Bacteria 3060
145 Ga0207676_10069769 3300026095 Bacteria 2815
146 Ga0207676_10099776 3300026095 Unclassified 2404
147 Ga0207674_10003616 3300026116 Bacteria 18845
148 Ga0207674_10017416 3300026116 Bacteria 7841
149 Ga0207698_10098485 3300026142 Bacteria 2416
150 Ga0209968_1009016 3300027526 Bacteria 1524
151 Ga0268266_10566387 3300028379 Unclassified 1089
152 Ga0268265_10308823 3300028380 Bacteria 1427
153 Ga0268264_10120612 3300028381 Bacteria 2310
154 Ga0265338_10065902 3300028800 Bacteria 3138
155 Ga0265314_10003433 3300031711 Bacteria 15310
156 Ga0373930_0001428 3300034816 Bacteria 3547
157 Ga0373948_0006385 3300034817 Bacteria 1947
158 Ga0373950_0002027 3300034818 Bacteria 2741
159 Ga0373959_0003319 3300034820 Bacteria 2560
160 Ga0373938_0014429 3300034957 Bacteria 1516
161 Ga0373928_0012234 3300035084 Bacteria 1709
162 Ga0373929_0001985 3300035085 Bacteria 3823
163 Ga0373944_0006598 3300035089 Bacteria 3083
164 Ga0373949_0001596 3300035090 Bacteria 6382
165 Ga0373932_0001459 3300035112 Bacteria 6618
166 Ga0373939_0000780 3300035114 Bacteria 7850
167 Ga0373941_0001005 3300035115 Bacteria 5864
168 Ga0373943_0015105 3300035170 Bacteria 3505
169 Ga0373943_0017516 3300035170 Unclassified 3278
170 Ga0373946_0092328 3300035171 Unclassified 1343
171 Ga0373955_0004248 3300035172 Bacteria 6326
172 Ga0373961_0001118 3300035241 Bacteria 8456
173 Ga0373962_0005679 3300035242 Bacteria 3012
174 Ga0373924_0038067 3300035410 Bacteria 1960
175 Ga0373935_0025900 3300035692 Bacteria 3615
176 Ga0373927_0002990 3300035695 Bacteria 12263
177 Ga0373947_0039320 3300035725 Unclassified 2814
178 Ga0373947_0050795 3300035725 Unclassified 2493
179 Ga0373937_0051978 3300036401 Unclassified 3756
180 Ga0373937_0112992 3300036401 Unclassified 2527
181 Ga0373937_0181901 3300036401 Bacteria 1974
182 Ga0373937_0226403 3300036401 Unclassified 1760
183 Ga0373925_0059901 3300037068 Bacteria 2857
184 Ga0373925_0083930 3300037068 Archaea 2427
185 Ga0373925_0136346 3300037068 Bacteria 1918
186 Ga0373925_0153638 3300037068 Bacteria 1809
187 Ga0373925_0359996 3300037068 Unclassified 1182
188 Ga0436365_0877944 3300039437 Bacteria 23304
189 Ga0436365_1068316 3300039437 Bacteria 3252
190 Ga0436362_0018286 3300039453 Bacteria 3374
191 Ga0439435_0026144 3300042436 Unclassified 1552
192 Ga0439444_0006080 3300042437 Bacteria 1812
193 Ga0451576_0019295 3300045051 Bacteria 7444
194 Ga0451576_0495794 3300045051 Bacteria 1283
195 Ga0495651_0002970 3300046462 Bacteria 13093
196 Ga0495653_0017981 3300046463 Bacteria 5746
197 Ga0495580_0026597 3300046472 Bacteria 4218
198 Ga0495580_0071706 3300046472 Bacteria 2420
199 Ga0495580_0173171 3300046472 Unclassified 1491
200 Ga0495594_0174545 3300046499 Bacteria 1223
201 Ga0495608_0003827 3300046511 Bacteria 10815
202 Ga0495608_0027151 3300046511 Unclassified 3897
203 Ga0495618_0058466 3300046514 Bacteria 2442
204 Ga0495628_0002397 3300046516 Bacteria 16900
205 Ga0495630_0003116 3300046517 Bacteria 11495
206 Ga0495630_0038225 3300046517 Bacteria 3591
207 Ga0495630_0131759 3300046517 Bacteria 1899
208 Ga0495652_0012503 3300046529 Bacteria 7653
209 Ga0495665_0025528 3300046531 Bacteria 3175
210 Ga0495665_0188350 3300046531 Unclassified 1071
211 Ga0495587_0005471 3300046536 Bacteria 8283
212 Ga0495667_0007673 3300046559 Bacteria 7318
213 Ga0495634_0090627 3300046642 Bacteria 1986
214 Ga0495657_0006386 3300046675 Bacteria 9227
215 Ga0495599_0005597 3300046678 Bacteria 7531
216 Ga0495658_0132537 3300046683 Bacteria 1518
217 Ga0495613_0132953 3300046689 Bacteria 1781
218 Ga0495600_0003972 3300046809 Bacteria 8786
219 Ga0495581_0073177 3300047315 Unclassified 1983
220 Ga0495604_0014035 3300047317 Bacteria 6389
221 Ga0495604_0226944 3300047317 Bacteria 1283
222 Ga0495674_0015696 3300047319 Bacteria 7071
223 Ga0495680_0005662 3300047322 Bacteria 11703
224 Ga0495675_0000497 3300047444 Bacteria 25512
225 Ga0495675_0106590 3300047444 Bacteria 1751
226 Ga0495684_0000105 3300047471 Bacteria 59779
227 Ga0495602_0009806 3300048088 Bacteria 9944
228 Ga0496100_0153308 3300048903 Bacteria 1646
229 Ga0496102_0158856 3300048905 Bacteria 2126
230 Ga0496104_0016738 3300048907 Bacteria 6666
231 Ga0496105_0082414 3300048908 Bacteria 2657
232 Ga0496105_0532830 3300048908 Bacteria 919
233 Ga0496106_0065877 3300048909 Bacteria 2758
234 Ga0496108_0300761 3300048911 Bacteria 1398
235 Ga0496108_0322597 3300048911 Bacteria 1347
236 Ga0496109_0106229 3300048912 Bacteria 2608
237 Ga0496110_0231858 3300048913 Bacteria 1679
238 Ga0496111_0166113 3300048914 Bacteria 1639
239 Ga0496112_0002686 3300048915 Bacteria 14376
240 Ga0496113_0045271 3300048916 Bacteria 3263
241 Ga0496114_0103029 3300048917 Bacteria 2439
242 Ga0496114_0119918 3300048917 Bacteria 2262
243 Ga0496115_0062031 3300048918 Bacteria 3015
244 Ga0496115_0123060 3300048918 Bacteria 2135
245 Ga0501040_0064149 3300049576 Bacteria 2529
246 Ga0501041_0073447 3300049577 Bacteria 2102
247 Ga0501048_0077735 3300049582 Bacteria 2342
248 Ga0501071_0069641 3300049587 Bacteria 2562
249 Ga0501075_0155256 3300049591 Bacteria 1745
250 Ga0501076_0034410 3300049592 Bacteria 3960
251 nmdc:mga05p37_119345_c1 3300050507 Bacteria 3240
252 nmdc:mga08y16_519342_c1 3300050511 Bacteria 1208
253 nmdc:mga0n895_14758_c1 3300050512 Bacteria 7106
254 nmdc:mga0n895_301552_c1 3300050512 Bacteria 1624
255 nmdc:mga0n895_908_c1 3300050512 Bacteria 21366
256 nmdc:mga0rr50_93625_c1 3300050513 Bacteria 2345
257 Ga0495601_0007573 3300053077 Bacteria 6374
258 Ga0495595_0045196 3300053084 Unclassified 2025
259 Ga0495595_0064789 3300053084 Unclassified 1718
260 Ga0495619_0048724 3300053085 Bacteria 2792
261 Ga0495619_0081192 3300053085 Bacteria 2183
262 Ga0495619_0162317 3300053085 Bacteria 1544
263 Ga0501082_0222877 3300060353 Bacteria 1641
264 Ga0070714_100004786
265 Ga0070690_100038174
266 Ga0070690_100274406
267 Ga0070666_10003066
268 Ga0068868_100269281
269 Ga0070691_10182715
270 Ga0070669_100021137
271 Ga0070667_100024828
272 Ga0070709_10026855
273 Ga0070709_10030633
274 Ga0070709_10245770
275 Ga0070713_100004470
276 Ga0070713_100030081
277 Ga0070713_100076092
278 Ga0070710_10023762
279 Ga0070708_100109132
280 Ga0070708_100192664
281 Ga0070681_10054181
282 Ga0070681_10232303
283 Ga0070681_10444372
284 Ga0068867_100074692
285 Ga0070706_100017177
286 Ga0070707_100256129
287 Ga0070698_100074774
288 Ga0070697_100233452
289 Ga0068853_100060744
290 Ga0070672_100279187
291 Ga0070686_100000668
292 Ga0070686_100309216
293 Ga0070665_100111787
294 Ga0068856_100004088
295 Ga0068856_100070749
296 Ga0068859_100198393
297 Ga0068864_100001789
298 Ga0068864_100061137
299 Ga0068863_100043793
300 Ga0068863_100408491
301 Ga0068858_100004219
302 Ga0068858_100430103
303 Ga0068860_100021462
304 Ga0068862_100151221
305 Ga0068862_100299434
306 Ga0070717_10092050
307 Ga0070717_10147885
308 Ga0097621_100001625
309 Ga0097621_100012866
310 Ga0097621_100042068
311 Ga0097621_100222968
312 Ga0068871_100008133
313 Ga0068871_100166787
314 Ga0068871_100173877
315 Ga0068871_100287100
316 Ga0075431_100468969
317 Ga0075434_100049569
318 Ga0068865_100039729
319 Ga0075436_100169728
320 Ga0097620_100198416
321 Ga0075435_100000406
322 Ga0099795_10001124
323 Ga0105240_10054639
324 Ga0111539_10592966
325 Ga0105245_10005989
326 Ga0105245_10006911
327 Ga0105245_10014513
328 Ga0105245_10015516
329 Ga0105247_10009784
330 Ga0114129_10104125
331 Ga0105243_10012578
332 Ga0105243_10152395
333 Ga0105241_10002440
334 Ga0105241_10005631
335 Ga0105241_10276519
336 Ga0105242_10014487
337 Ga0105242_10026280
338 Ga0105242_10092933
339 Ga0105242_10153596
340 Ga0105248_10019769
341 Ga0105248_10032675
342 Ga0105248_10033978
343 Ga0105248_10051948
344 Ga0105248_10108534
345 Ga0105248_10295057
346 Ga0105248_10512398
347 Ga0105237_10014664
348 Ga0105238_10003506
349 Ga0105238_10027081
350 Ga0105239_10005545
351 Ga0105239_10037857
352 Ga0105246_10191112
353 Ga0157369_10027146
354 Ga0157374_10106071
355 Ga0157378_10013715
356 Ga0163162_10035282
357 Ga0163162_10126378
358 Ga0163162_10508376
359 Ga0157372_10366137
360 Ga0157372_10478892
361 Ga0157375_10038278
362 Ga0157375_10115285
363 Ga0157375_10156084
364 Ga0157375_10180282
365 Ga0157375_10652827
366 Ga0163163_10000335
367 Ga0163163_10010601
368 Ga0163163_10135585
369 Ga0163163_10254868
370 Ga0163163_10332333
371 Ga0157379_10186640
372 Ga0157376_10004782
373 Ga0157376_10095355
374 Ga0157376_10534833
375 Ga0213876_10005285
376 Ga0207710_10011912
377 Ga0207680_10001442
378 Ga0207680_10010030
379 Ga0207699_10080809
380 Ga0207684_10017592
381 Ga0207654_10011032
382 Ga0207707_10040772
383 Ga0207695_10075871
384 Ga0207695_10440057
385 Ga0207652_10432753
386 Ga0207646_10021099
387 Ga0207687_10044872
388 Ga0207700_10018892
389 Ga0207700_10145982
390 Ga0207664_10005048
391 Ga0207686_10063081
392 Ga0207709_10014587
393 Ga0207704_10159245
394 Ga0207691_10451295
395 Ga0207711_10024622
396 Ga0207711_10064848
397 Ga0207689_10186945
398 Ga0207651_10107317
399 Ga0207677_10196292
400 Ga0207677_10202242
401 Ga0207677_10373045
402 Ga0207703_10118112
403 Ga0207703_10340783
404 Ga0207702_10006565
405 Ga0207641_10019758
406 Ga0207641_10572672
407 Ga0207648_10069917
408 Ga0207676_10069769
409 Ga0207676_10099776
410 Ga0207674_10003616
411 Ga0207674_10017416
412 Ga0207698_10098485
413 Ga0209968_1009016
414 Ga0268266_10566387
415 Ga0268265_10308823
416 Ga0268264_10120612
417 Ga0265338_10065902
418 Ga0265314_10003433
419 Ga0373930_0001428
420 Ga0373948_0006385
421 Ga0373950_0002027
422 Ga0373959_0003319
423 Ga0373938_0014429
424 Ga0373928_0012234
425 Ga0373929_0001985
426 Ga0373944_0006598
427 Ga0373949_0001596
428 Ga0373932_0001459
429 Ga0373939_0000780
430 Ga0373941_0001005
431 Ga0373943_0015105
432 Ga0373943_0017516
433 Ga0373946_0092328
434 Ga0373955_0004248
435 Ga0373961_0001118
436 Ga0373962_0005679
437 Ga0373924_0038067
438 Ga0373935_0025900
439 Ga0373927_0002990
440 Ga0373947_0039320
441 Ga0373947_0050795
442 Ga0373937_0051978
443 Ga0373937_0112992
444 Ga0373937_0181901
445 Ga0373937_0226403
446 Ga0373925_0059901
447 Ga0373925_0083930
448 Ga0373925_0136346
449 Ga0373925_0153638
450 Ga0373925_0359996
451 Ga0436365_0877944
452 Ga0436365_1068316
453 Ga0436362_0018286
454 Ga0439435_0026144
455 Ga0439444_0006080
456 Ga0451576_0019295
457 Ga0451576_0495794
458 Ga0495651_0002970
459 Ga0495653_0017981
460 Ga0495580_0026597
461 Ga0495580_0071706
462 Ga0495580_0173171
463 Ga0495594_0174545
464 Ga0495608_0003827
465 Ga0495608_0027151
466 Ga0495618_0058466
467 Ga0495628_0002397
468 Ga0495630_0003116
469 Ga0495630_0038225
470 Ga0495630_0131759
471 Ga0495652_0012503
472 Ga0495665_0025528
473 Ga0495665_0188350
474 Ga0495587_0005471
475 Ga0495667_0007673
476 Ga0495634_0090627
477 Ga0495657_0006386
478 Ga0495599_0005597
479 Ga0495658_0132537
480 Ga0495613_0132953
481 Ga0495600_0003972
482 Ga0495581_0073177
483 Ga0495604_0014035
484 Ga0495604_0226944
485 Ga0495674_0015696
486 Ga0495680_0005662
487 Ga0495675_0000497
488 Ga0495675_0106590
489 Ga0495684_0000105
490 Ga0495602_0009806
491 Ga0496100_0153308
492 Ga0496102_0158856
493 Ga0496104_0016738
494 Ga0496105_0082414
495 Ga0496105_0532830
496 Ga0496106_0065877
497 Ga0496108_0300761
498 Ga0496108_0322597
499 Ga0496109_0106229
500 Ga0496110_0231858
501 Ga0496111_0166113
502 Ga0496112_0002686
503 Ga0496113_0045271
504 Ga0496114_0103029
505 Ga0496114_0119918
506 Ga0496115_0062031
507 Ga0496115_0123060
508 Ga0501040_0064149
509 Ga0501041_0073447
510 Ga0501048_0077735
511 Ga0501071_0069641
512 Ga0501075_0155256
513 Ga0501076_0034410
514 nmdc:mga05p37_119345_c1
515 nmdc:mga08y16_519342_c1
516 nmdc:mga0n895_14758_c1
517 nmdc:mga0n895_301552_c1
518 nmdc:mga0n895_908_c1
519 nmdc:mga0rr50_93625_c1
520 Ga0495601_0007573
521 Ga0495595_0045196
522 Ga0495595_0064789
523 Ga0495619_0048724
524 Ga0495619_0081192
525 Ga0495619_0162317
526 Ga0501082_0222877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8136 179 315
4naz-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with zn and sulfate at 1.15 angstrom resolution 0.81 178 315
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.778 232 315
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7753 233 315
8dtd-assembly1.cif.gz_A crystal structure of fosb from bacillus cereus with zinc and phosphonoformate 0.7749 178 315
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9125 266 311 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8991 268 313 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8421 264 315 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8356 266 315 3.30.720.110
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.81 178 315 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2G4JDY4-F1-model_v4 VOC domain-containing protein 0.9856 14 315
AF-A0A2V6Y5Z7-F1-model_v4 VOC domain-containing protein 0.9836 19 315
AF-A0A2V6V8L9-F1-model_v4 VOC domain-containing protein 0.9826 15 315
AF-A0A2V6ZWZ6-F1-model_v4 VOC domain-containing protein 0.9822 15 315
AF-A0A2V6UWJ2-F1-model_v4 VOC domain-containing protein 0.9812 63 315

Map