F371219

General Info

Members Datasets Scaffolds Average Seq Length
262 111 524 427

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0026065|Ga0373955_0026065_650_2053
Length 467
Sequence MAQIRMSILILNHEGRFSVVAAKRFRRFLNVITRFLAGASCAALIGLSMPVTAATSPELPRAQLQLSPSAVQAVDAFYASRGGSPLWLRSGADSNAARQLVGLLERAPLDGLESGPALAVQAEDLIVRAQSGDTAALAAADRLLSAAWVSYVQEIQRPPTGMVYADSWASPRQDSPMQILQRAAAAQSLSAHVRTVSEVNPLYAQIRDAGWAQMQSNGGAIDPRVLTSLDRAREHPFQNKYVMVDAAAARLYMIEDGQIVDSMKVVVGKAGPHTQTPMLASTIYYATLNPYWHVSDDLVQSLIAKNVLQQGLGYLKTHGYQVMPADKSDDQLLDPSKIDWHAVADGRLKVRVRELPGPANSMGRVKFGFPNAWDIYLHDTPVKELFAQGDRDLSHGCIRLQDAERLARWMFGSDPRAVSNEPEQNVTLPTPVPIYVTYLTAQAHDGQLSYVEDTYDRDSNSQVAALR

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.05
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 7.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0026065 3300035172 Bacteria 3007
2 JGI24740J21852_10001446 3300001979 Bacteria 10893
3 JGI24739J22299_10001065 3300001989 Bacteria 10210
4 JGI24738J21930_10001064 3300002075 Bacteria 7807
5 Ga0070658_10000130 3300005327 Bacteria 66295
6 Ga0070658_10006977 3300005327 Bacteria 9124
7 Ga0070658_10032306 3300005327 Bacteria 4208
8 Ga0070658_10038124 3300005327 Bacteria 3876
9 Ga0070658_10053931 3300005327 Bacteria 3264
10 Ga0070658_10063793 3300005327 Bacteria 3004
11 Ga0070658_10156152 3300005327 Bacteria 1913
12 Ga0070683_100000909 3300005329 Bacteria 22014
13 Ga0070670_100031596 3300005331 Bacteria 4560
14 Ga0070666_10000841 3300005335 Bacteria 18619
15 Ga0070680_100002095 3300005336 Bacteria 14733
16 Ga0070680_100008625 3300005336 Bacteria 7813
17 Ga0070680_100026281 3300005336 Bacteria 4655
18 Ga0070682_100060085 3300005337 Bacteria 2403
19 Ga0070660_100012983 3300005339 Bacteria 5961
20 Ga0070660_100022265 3300005339 Bacteria 4684
21 Ga0070660_100047002 3300005339 Bacteria 3310
22 Ga0070660_100155136 3300005339 Bacteria 1843
23 Ga0070661_100000206 3300005344 Bacteria 48811
24 Ga0070661_100021931 3300005344 Bacteria 4567
25 Ga0070661_100053217 3300005344 Bacteria 2962
26 Ga0070671_100001277 3300005355 Bacteria 18890
27 Ga0070671_100003890 3300005355 Bacteria 11740
28 Ga0070659_100000883 3300005366 Bacteria 21917
29 Ga0070659_100005750 3300005366 Bacteria 8923
30 Ga0070659_100013389 3300005366 Bacteria 6103
31 Ga0070659_100040767 3300005366 Unclassified 3629
32 Ga0070659_100058893 3300005366 Bacteria 3032
33 Ga0070659_100061359 3300005366 Bacteria 2971
34 Ga0070659_100064429 3300005366 Bacteria 2901
35 Ga0070659_100085352 3300005366 Bacteria 2525
36 Ga0070659_100183177 3300005366 Bacteria 1719
37 Ga0070667_100079031 3300005367 Bacteria 2811
38 Ga0070714_100031084 3300005435 Bacteria 4451
39 Ga0070714_100069410 3300005435 Unclassified 3043
40 Ga0070714_100140116 3300005435 Bacteria 2170
41 Ga0070663_100111775 3300005455 Bacteria 2054
42 Ga0070663_100116342 3300005455 Bacteria 2015
43 Ga0070662_100000107 3300005457 Bacteria 46051
44 Ga0070681_10011026 3300005458 Bacteria 8934
45 Ga0070681_10030936 3300005458 Bacteria 5372
46 Ga0070681_10053823 3300005458 Bacteria 4010
47 Ga0070679_100036459 3300005530 Bacteria 4880
48 Ga0070679_100100852 3300005530 Bacteria 2873
49 Ga0070679_100148487 3300005530 Bacteria 2321
50 Ga0070679_100151463 3300005530 Unclassified 2295
51 Ga0070684_100009041 3300005535 Bacteria 7830
52 Ga0068853_100000172 3300005539 Bacteria 45090
53 Ga0068853_100087150 3300005539 Bacteria 2739
54 Ga0070672_100059302 3300005543 Bacteria 3011
55 Ga0070693_100000773 3300005547 Bacteria 14093
56 Ga0070665_100001716 3300005548 Bacteria 25115
57 Ga0070665_100027460 3300005548 Bacteria 5733
58 Ga0068855_100013004 3300005563 Bacteria 10044
59 Ga0068855_100017589 3300005563 Bacteria 8596
60 Ga0068855_100155079 3300005563 Unclassified 2602
61 Ga0070664_100004526 3300005564 Bacteria 11156
62 Ga0070664_100030634 3300005564 Bacteria 4490
63 Ga0068857_100057142 3300005577 Bacteria 3463
64 Ga0068857_100091479 3300005577 Bacteria 2723
65 Ga0068857_100103784 3300005577 Unclassified 2552
66 Ga0068854_100008608 3300005578 Bacteria 6570
67 Ga0068854_100029958 3300005578 Bacteria 3772
68 Ga0068856_100000364 3300005614 Bacteria 49715
69 Ga0068856_100004427 3300005614 Bacteria 13984
70 Ga0068856_100008728 3300005614 Bacteria 9861
71 Ga0068856_100010867 3300005614 Bacteria 8839
72 Ga0068856_100102805 3300005614 Bacteria 2851
73 Ga0068856_100179622 3300005614 Bacteria 2129
74 Ga0068852_100002792 3300005616 Bacteria 12100
75 Ga0068852_100003430 3300005616 Bacteria 11074
76 Ga0068852_100018585 3300005616 Bacteria 5479
77 Ga0068852_100069264 3300005616 Bacteria 3091
78 Ga0068852_100080272 3300005616 Unclassified 2892
79 Ga0068852_100083096 3300005616 Bacteria 2847
80 Ga0068859_100011367 3300005617 Bacteria 8954
81 Ga0068864_100006117 3300005618 Bacteria 9874
82 Ga0068858_100004012 3300005842 Bacteria 14518
83 Ga0097620_100011367 3300006931 Bacteria 8954
84 Ga0105247_10061350 3300009101 Bacteria 2331
85 Ga0105248_10000238 3300009177 Bacteria 63658
86 Ga0105248_10001772 3300009177 Bacteria 24028
87 Ga0105248_10026868 3300009177 Bacteria 6402
88 Ga0105237_10062414 3300009545 Bacteria 3726
89 Ga0105238_10064009 3300009551 Bacteria 3678
90 Ga0105239_10143383 3300010375 Bacteria 2663
91 Ga0157373_10016284 3300013100 Bacteria 5425
92 Ga0157373_10019252 3300013100 Bacteria 4971
93 Ga0157373_10044752 3300013100 Bacteria 3160
94 Ga0157371_10009476 3300013102 Bacteria 7660
95 Ga0157371_10018713 3300013102 Bacteria 5119
96 Ga0157370_10021821 3300013104 Bacteria 6378
97 Ga0157370_10049004 3300013104 Bacteria 4045
98 Ga0157370_10182823 3300013104 Bacteria 1948
99 Ga0157369_10030569 3300013105 Bacteria 5939
100 Ga0157369_10032061 3300013105 Bacteria 5780
101 Ga0157369_10072616 3300013105 Bacteria 3694
102 Ga0157369_10102468 3300013105 Bacteria 3050
103 Ga0157372_10005972 3300013307 Bacteria 12943
104 Ga0157372_10031000 3300013307 Bacteria 5853
105 Ga0157372_10254050 3300013307 Bacteria 2041
106 Ga0157375_10215993 3300013308 Bacteria 2076
107 Ga0163163_10000543 3300014325 Bacteria 33382
108 Ga0206353_12047731 3300020082 Unclassified 1663
109 Ga0207710_10087651 3300025900 Bacteria 1452
110 Ga0207680_10001354 3300025903 Bacteria 11610
111 Ga0207647_10007595 3300025904 Bacteria 7814
112 Ga0207647_10025106 3300025904 Bacteria 3922
113 Ga0207705_10003366 3300025909 Bacteria 12152
114 Ga0207705_10007579 3300025909 Bacteria 7977
115 Ga0207705_10021877 3300025909 Bacteria 4562
116 Ga0207705_10054627 3300025909 Bacteria 2878
117 Ga0207705_10068452 3300025909 Bacteria 2570
118 Ga0207705_10102591 3300025909 Bacteria 2106
119 Ga0207707_10022063 3300025912 Bacteria 5565
120 Ga0207707_10114373 3300025912 Bacteria 2358
121 Ga0207695_10101972 3300025913 Bacteria 2863
122 Ga0207695_10267460 3300025913 Unclassified 1606
123 Ga0207660_10000486 3300025917 Bacteria 26452
124 Ga0207660_10000825 3300025917 Bacteria 20461
125 Ga0207660_10066419 3300025917 Bacteria 2609
126 Ga0207657_10000468 3300025919 Bacteria 42779
127 Ga0207657_10000643 3300025919 Bacteria 37091
128 Ga0207657_10001203 3300025919 Bacteria 27541
129 Ga0207657_10002853 3300025919 Bacteria 18578
130 Ga0207657_10008637 3300025919 Bacteria 10313
131 Ga0207657_10033289 3300025919 Bacteria 4647
132 Ga0207649_10000362 3300025920 Bacteria 34070
133 Ga0207652_10017131 3300025921 Bacteria 5926
134 Ga0207694_10000827 3300025924 Bacteria 27549
135 Ga0207694_10178454 3300025924 Bacteria 1721
136 Ga0207650_10046591 3300025925 Bacteria 3193
137 Ga0207664_10013114 3300025929 Bacteria 5942
138 Ga0207644_10013046 3300025931 Bacteria 5531
139 Ga0207690_10000062 3300025932 Bacteria 96511
140 Ga0207690_10000452 3300025932 Bacteria 26541
141 Ga0207690_10010569 3300025932 Bacteria 5492
142 Ga0207706_10000211 3300025933 Bacteria 63984
143 Ga0207706_10002307 3300025933 Bacteria 18608
144 Ga0207706_10052167 3300025933 Bacteria 3611
145 Ga0207711_10001908 3300025941 Bacteria 18939
146 Ga0207711_10004434 3300025941 Bacteria 11963
147 Ga0207711_10008094 3300025941 Bacteria 8800
148 Ga0207661_10003356 3300025944 Bacteria 11115
149 Ga0207661_10047616 3300025944 Bacteria 3404
150 Ga0207679_10077275 3300025945 Unclassified 2532
151 Ga0207667_10011157 3300025949 Bacteria 10459
152 Ga0207667_10097564 3300025949 Bacteria 3033
153 Ga0207667_10235204 3300025949 Unclassified 1875
154 Ga0207658_10022257 3300025986 Bacteria 4412
155 Ga0207703_10126247 3300026035 Bacteria 2203
156 Ga0207639_10002948 3300026041 Bacteria 11442
157 Ga0207639_10035692 3300026041 Bacteria 3680
158 Ga0207678_10001933 3300026067 Bacteria 18903
159 Ga0207678_10003976 3300026067 Bacteria 13301
160 Ga0207678_10031874 3300026067 Bacteria 4595
161 Ga0207678_10061938 3300026067 Bacteria 3218
162 Ga0207678_10108425 3300026067 Bacteria 2369
163 Ga0207702_10001681 3300026078 Bacteria 21845
164 Ga0207702_10013224 3300026078 Bacteria 6863
165 Ga0207676_10005052 3300026095 Bacteria 9333
166 Ga0207674_10010034 3300026116 Bacteria 10776
167 Ga0207674_10012782 3300026116 Bacteria 9376
168 Ga0207698_10000336 3300026142 Bacteria 27862
169 Ga0207698_10001039 3300026142 Bacteria 16159
170 Ga0207698_10052721 3300026142 Bacteria 3118
171 Ga0207698_10078875 3300026142 Bacteria 2646
172 Ga0268266_10003923 3300028379 Bacteria 14460
173 Ga0307408_100067670 3300031548 Unclassified 2628
174 Ga0307405_10025003 3300031731 Bacteria 3422
175 Ga0307413_10018090 3300031824 Bacteria 3688
176 Ga0307406_10047930 3300031901 Bacteria 2696
177 Ga0307407_10031068 3300031903 Bacteria 2889
178 Ga0307409_100003288 3300031995 Bacteria 8732
179 Ga0307415_100041185 3300032126 Bacteria 3065
180 Ga0373961_0009269 3300035241 Bacteria 2406
181 Ga0373933_0009752 3300035724 Bacteria 5256
182 Ga0373937_0015377 3300036401 Bacteria 6767
183 Ga0395899_0004311 3300037312 Bacteria 11107
184 Ga0395899_0010292 3300037312 Bacteria 7170
185 Ga0395899_0010947 3300037312 Bacteria 6951
186 Ga0395899_0019779 3300037312 Bacteria 5111
187 Ga0395899_0027375 3300037312 Bacteria 4299
188 Ga0395899_0060953 3300037312 Bacteria 2778
189 Ga0395899_0067082 3300037312 Bacteria 2633
190 Ga0395899_0078555 3300037312 Bacteria 2405
191 Ga0395899_0099576 3300037312 Bacteria 2100
192 Ga0395899_0105868 3300037312 Unclassified 2025
193 Ga0395899_0114988 3300037312 Bacteria 1932
194 Ga0395900_0000093 3300037418 Bacteria 166505
195 Ga0395900_0005309 3300037418 Bacteria 13501
196 Ga0395900_0012879 3300037418 Bacteria 8543
197 Ga0395900_0014214 3300037418 Bacteria 8125
198 Ga0395900_0038945 3300037418 Bacteria 4900
199 Ga0395900_0086924 3300037418 Bacteria 3213
200 Ga0395900_0164378 3300037418 Bacteria 2262
201 Ga0395900_0346638 3300037418 Bacteria 1459
202 Ga0395900_0417577 3300037418 Unclassified 1303
203 Ga0395898_0005334 3300037466 Bacteria 13898
204 Ga0395898_0013433 3300037466 Bacteria 8433
205 Ga0395898_0028302 3300037466 Bacteria 5617
206 Ga0395898_0042742 3300037466 Bacteria 4469
207 Ga0395898_0061103 3300037466 Bacteria 3660
208 Ga0395898_0149687 3300037466 Bacteria 2234
209 Ga0395898_0278433 3300037466 Bacteria 1596
210 Ga0395905_0001393 3300037471 Bacteria 29331
211 Ga0395905_0002517 3300037471 Bacteria 20238
212 Ga0395905_0014464 3300037471 Bacteria 7533
213 Ga0395905_0057569 3300037471 Bacteria 3636
214 Ga0395905_0058219 3300037471 Unclassified 3614
215 Ga0395905_0081595 3300037471 Bacteria 3030
216 Ga0395905_0149804 3300037471 Unclassified 2195
217 Ga0395905_0174941 3300037471 Bacteria 2015
218 Ga0395905_0209674 3300037471 Bacteria 1825
219 Ga0395901_0000140 3300038443 Bacteria 94487
220 Ga0395901_0002476 3300038443 Bacteria 18740
221 Ga0395901_0011922 3300038443 Bacteria 8815
222 Ga0395901_0038033 3300038443 Bacteria 4977
223 Ga0395901_0161135 3300038443 Unclassified 2356
224 Ga0395901_0394487 3300038443 Unclassified 1422
225 Ga0466969_0105246 3300044656 Bacteria 1325
226 Ga0466966_0000040 3300044684 Bacteria 97159
227 Ga0466966_0102333 3300044684 Bacteria 1771
228 Ga0466961_0030969 3300044693 Bacteria 3438
229 Ga0466961_0067144 3300044693 Unclassified 2278
230 Ga0466963_0080555 3300044694 Bacteria 2204
231 Ga0466963_0088234 3300044694 Bacteria 2110
232 Ga0466963_0123661 3300044694 Unclassified 1782
233 Ga0466971_0005583 3300044719 Bacteria 5467
234 Ga0466970_0006462 3300044765 Bacteria 5862
235 Ga0466970_0020421 3300044765 Bacteria 3441
236 Ga0466957_0001182 3300044842 Bacteria 13566
237 Ga0466957_0018323 3300044842 Bacteria 4111
238 Ga0466957_0159342 3300044842 Viruses 1465
239 Ga0466959_0059624 3300045049 Bacteria 2779
240 Ga0466959_0074178 3300045049 Bacteria 2460
241 Ga0466958_0006170 3300045836 Bacteria 6501
242 Ga0466967_0005331 3300045976 Bacteria 8884
243 Ga0466967_0010384 3300045976 Bacteria 6983
244 Ga0466967_0011818 3300045976 Bacteria 6639
245 Ga0466967_0014838 3300045976 Bacteria 6087
246 Ga0466967_0032266 3300045976 Unclassified 4420
247 Ga0466967_0035712 3300045976 Bacteria 4235
248 Ga0466967_0080048 3300045976 Bacteria 2947
249 Ga0466967_0135375 3300045976 Bacteria 2291
250 Ga0495668_0014049 3300046616 Bacteria 4704
251 Ga0495668_0022949 3300046616 Bacteria 3563
252 Ga0495669_0000540 3300046684 Bacteria 16965
253 Ga0495669_0000805 3300046684 Bacteria 13389
254 Ga0495669_0026909 3300046684 Bacteria 2514
255 Ga0496101_0045618 3300048904 Bacteria 3140
256 Ga0496107_0011168 3300048910 Bacteria 6252
257 Ga0496109_0002022 3300048912 Bacteria 16815
258 Ga0496110_0028987 3300048913 Bacteria 4758
259 Ga0496111_0006065 3300048914 Bacteria 7809
260 Ga0496112_0003026 3300048915 Bacteria 13744
261 Ga0496112_0048333 3300048915 Bacteria 4171
262 Ga0496113_0011123 3300048916 Bacteria 5987
263 Ga0373955_0026065
264 JGI24740J21852_10001446
265 JGI24739J22299_10001065
266 JGI24738J21930_10001064
267 Ga0070658_10000130
268 Ga0070658_10006977
269 Ga0070658_10032306
270 Ga0070658_10038124
271 Ga0070658_10053931
272 Ga0070658_10063793
273 Ga0070658_10156152
274 Ga0070683_100000909
275 Ga0070670_100031596
276 Ga0070666_10000841
277 Ga0070680_100002095
278 Ga0070680_100008625
279 Ga0070680_100026281
280 Ga0070682_100060085
281 Ga0070660_100012983
282 Ga0070660_100022265
283 Ga0070660_100047002
284 Ga0070660_100155136
285 Ga0070661_100000206
286 Ga0070661_100021931
287 Ga0070661_100053217
288 Ga0070671_100001277
289 Ga0070671_100003890
290 Ga0070659_100000883
291 Ga0070659_100005750
292 Ga0070659_100013389
293 Ga0070659_100040767
294 Ga0070659_100058893
295 Ga0070659_100061359
296 Ga0070659_100064429
297 Ga0070659_100085352
298 Ga0070659_100183177
299 Ga0070667_100079031
300 Ga0070714_100031084
301 Ga0070714_100069410
302 Ga0070714_100140116
303 Ga0070663_100111775
304 Ga0070663_100116342
305 Ga0070662_100000107
306 Ga0070681_10011026
307 Ga0070681_10030936
308 Ga0070681_10053823
309 Ga0070679_100036459
310 Ga0070679_100100852
311 Ga0070679_100148487
312 Ga0070679_100151463
313 Ga0070684_100009041
314 Ga0068853_100000172
315 Ga0068853_100087150
316 Ga0070672_100059302
317 Ga0070693_100000773
318 Ga0070665_100001716
319 Ga0070665_100027460
320 Ga0068855_100013004
321 Ga0068855_100017589
322 Ga0068855_100155079
323 Ga0070664_100004526
324 Ga0070664_100030634
325 Ga0068857_100057142
326 Ga0068857_100091479
327 Ga0068857_100103784
328 Ga0068854_100008608
329 Ga0068854_100029958
330 Ga0068856_100000364
331 Ga0068856_100004427
332 Ga0068856_100008728
333 Ga0068856_100010867
334 Ga0068856_100102805
335 Ga0068856_100179622
336 Ga0068852_100002792
337 Ga0068852_100003430
338 Ga0068852_100018585
339 Ga0068852_100069264
340 Ga0068852_100080272
341 Ga0068852_100083096
342 Ga0068859_100011367
343 Ga0068864_100006117
344 Ga0068858_100004012
345 Ga0097620_100011367
346 Ga0105247_10061350
347 Ga0105248_10000238
348 Ga0105248_10001772
349 Ga0105248_10026868
350 Ga0105237_10062414
351 Ga0105238_10064009
352 Ga0105239_10143383
353 Ga0157373_10016284
354 Ga0157373_10019252
355 Ga0157373_10044752
356 Ga0157371_10009476
357 Ga0157371_10018713
358 Ga0157370_10021821
359 Ga0157370_10049004
360 Ga0157370_10182823
361 Ga0157369_10030569
362 Ga0157369_10032061
363 Ga0157369_10072616
364 Ga0157369_10102468
365 Ga0157372_10005972
366 Ga0157372_10031000
367 Ga0157372_10254050
368 Ga0157375_10215993
369 Ga0163163_10000543
370 Ga0206353_12047731
371 Ga0207710_10087651
372 Ga0207680_10001354
373 Ga0207647_10007595
374 Ga0207647_10025106
375 Ga0207705_10003366
376 Ga0207705_10007579
377 Ga0207705_10021877
378 Ga0207705_10054627
379 Ga0207705_10068452
380 Ga0207705_10102591
381 Ga0207707_10022063
382 Ga0207707_10114373
383 Ga0207695_10101972
384 Ga0207695_10267460
385 Ga0207660_10000486
386 Ga0207660_10000825
387 Ga0207660_10066419
388 Ga0207657_10000468
389 Ga0207657_10000643
390 Ga0207657_10001203
391 Ga0207657_10002853
392 Ga0207657_10008637
393 Ga0207657_10033289
394 Ga0207649_10000362
395 Ga0207652_10017131
396 Ga0207694_10000827
397 Ga0207694_10178454
398 Ga0207650_10046591
399 Ga0207664_10013114
400 Ga0207644_10013046
401 Ga0207690_10000062
402 Ga0207690_10000452
403 Ga0207690_10010569
404 Ga0207706_10000211
405 Ga0207706_10002307
406 Ga0207706_10052167
407 Ga0207711_10001908
408 Ga0207711_10004434
409 Ga0207711_10008094
410 Ga0207661_10003356
411 Ga0207661_10047616
412 Ga0207679_10077275
413 Ga0207667_10011157
414 Ga0207667_10097564
415 Ga0207667_10235204
416 Ga0207658_10022257
417 Ga0207703_10126247
418 Ga0207639_10002948
419 Ga0207639_10035692
420 Ga0207678_10001933
421 Ga0207678_10003976
422 Ga0207678_10031874
423 Ga0207678_10061938
424 Ga0207678_10108425
425 Ga0207702_10001681
426 Ga0207702_10013224
427 Ga0207676_10005052
428 Ga0207674_10010034
429 Ga0207674_10012782
430 Ga0207698_10000336
431 Ga0207698_10001039
432 Ga0207698_10052721
433 Ga0207698_10078875
434 Ga0268266_10003923
435 Ga0307408_100067670
436 Ga0307405_10025003
437 Ga0307413_10018090
438 Ga0307406_10047930
439 Ga0307407_10031068
440 Ga0307409_100003288
441 Ga0307415_100041185
442 Ga0373961_0009269
443 Ga0373933_0009752
444 Ga0373937_0015377
445 Ga0395899_0004311
446 Ga0395899_0010292
447 Ga0395899_0010947
448 Ga0395899_0019779
449 Ga0395899_0027375
450 Ga0395899_0060953
451 Ga0395899_0067082
452 Ga0395899_0078555
453 Ga0395899_0099576
454 Ga0395899_0105868
455 Ga0395899_0114988
456 Ga0395900_0000093
457 Ga0395900_0005309
458 Ga0395900_0012879
459 Ga0395900_0014214
460 Ga0395900_0038945
461 Ga0395900_0086924
462 Ga0395900_0164378
463 Ga0395900_0346638
464 Ga0395900_0417577
465 Ga0395898_0005334
466 Ga0395898_0013433
467 Ga0395898_0028302
468 Ga0395898_0042742
469 Ga0395898_0061103
470 Ga0395898_0149687
471 Ga0395898_0278433
472 Ga0395905_0001393
473 Ga0395905_0002517
474 Ga0395905_0014464
475 Ga0395905_0057569
476 Ga0395905_0058219
477 Ga0395905_0081595
478 Ga0395905_0149804
479 Ga0395905_0174941
480 Ga0395905_0209674
481 Ga0395901_0000140
482 Ga0395901_0002476
483 Ga0395901_0011922
484 Ga0395901_0038033
485 Ga0395901_0161135
486 Ga0395901_0394487
487 Ga0466969_0105246
488 Ga0466966_0000040
489 Ga0466966_0102333
490 Ga0466961_0030969
491 Ga0466961_0067144
492 Ga0466963_0080555
493 Ga0466963_0088234
494 Ga0466963_0123661
495 Ga0466971_0005583
496 Ga0466970_0006462
497 Ga0466970_0020421
498 Ga0466957_0001182
499 Ga0466957_0018323
500 Ga0466957_0159342
501 Ga0466959_0059624
502 Ga0466959_0074178
503 Ga0466958_0006170
504 Ga0466967_0005331
505 Ga0466967_0010384
506 Ga0466967_0011818
507 Ga0466967_0014838
508 Ga0466967_0032266
509 Ga0466967_0035712
510 Ga0466967_0080048
511 Ga0466967_0135375
512 Ga0495668_0014049
513 Ga0495668_0022949
514 Ga0495669_0000540
515 Ga0495669_0000805
516 Ga0495669_0026909
517 Ga0496101_0045618
518 Ga0496107_0011168
519 Ga0496109_0002022
520 Ga0496110_0028987
521 Ga0496111_0006065
522 Ga0496112_0003026
523 Ga0496112_0048333
524 Ga0496113_0011123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20142

Scaffold

Scaffold domain

72

209

0.84

PF03734

YkuD

L,D-transpeptidase catalytic domain

239

434

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hkl-assembly3.cif.gz_C crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant 0.7075 180 377
6fj1-assembly2.cif.gz_B structure of the ldtfm-avibactam carbamoyl enzyme 0.697 177 377
7e1c-assembly1.cif.gz_A structure of mreb3 from spiroplasma eriocheiris 0.6835 179 204
3zgp-assembly1.cif.gz_A nmr structure of the catalytic domain from e. faecium l,d- transpeptidase acylated by ertapenem 0.6743 179 377
4lzh-assembly1.cif.gz_A l,d-transpeptidase from klebsiella pneumoniae 0.6715 181 389
ID Description Score Start End Superfamily
af_P22525_424_489_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.8634 234 299 2.40.330.10
af_P22525_424_489_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.8406 234 299 2.40.330.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7422 180 378 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7319 181 377 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7086 181 377 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A7Y3JQH3-F1-model_v4 L,D-transpeptidase family protein 0.9117 181 380 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A485CVN3-F1-model_v4 Murein L,D-transpeptidase 0.9117 185 353 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A7C3K165-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.891 181 407 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A090PGM4-F1-model_v4 deleted 0.8811 179 400
AF-A0A090TS32-F1-model_v4 L,D-transpeptidase YcbB 0.8737 172 341 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555

Map