F371168

General Info

Members Datasets Scaffolds Average Seq Length
262 132 524 330

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10054354|Ga0207683_100543542
Length 407
Sequence MDVIHFPEDSRPPRWSHPVLALGNFDGVHRGHRKILDRVRRVASERGATSVVMTFDPHPPRVVRPDKAPPLLMTTTQRLEAIEATGVQGTAIVRFTSEVSRWDPETFVKTVLVEKGCVVNSIYHYPTNMTFFTTPELLEIGNIPMTSLNDKPNRIEALKYYRKVADHYKLDVRQYERVDRIAGEDNAFEVYTTDKLECPHVYRARKIVLATGYYDVPNLLNVPGEDLPKVLHYYKEPHPYYNHDVAVIGAKNSAAIASLELFWTGARVTLIHRGEGISNSVKYWIKPNIENRIKVGEIRAYFQSQVLEILPNSIRIATPEGEISIQNDFVFALVGYRPDLEFLNATGITLEAESRRPRTNSETLESERKGIYLAGVIVAGMHTNEIFIENGRFHGQAIARDITAKLS

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 0
Rhizosphere 90.46
Stem 0
Stem Tuber 0
Unclassified 6.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10054354 3300026121 Bacteria 3512
2 Ga0070683_100000006 3300005329 Bacteria 361071
3 Ga0070683_100087366 3300005329 Bacteria 2924
4 Ga0070683_100115235 3300005329 Bacteria 2537
5 Ga0070683_100195721 3300005329 Bacteria 1919
6 Ga0070683_100473958 3300005329 Bacteria 1195
7 Ga0070660_100037780 3300005339 Bacteria 3661
8 Ga0070689_100094464 3300005340 Bacteria 2361
9 Ga0070661_100159767 3300005344 Bacteria 1706
10 Ga0070673_100098544 3300005364 Bacteria 2403
11 Ga0070714_100084768 3300005435 Bacteria 2766
12 Ga0070713_100127913 3300005436 Bacteria 2237
13 Ga0070708_100108895 3300005445 Bacteria 2545
14 Ga0070681_10247342 3300005458 Unclassified 1696
15 Ga0068867_100062597 3300005459 Bacteria 2765
16 Ga0068867_100118685 3300005459 Bacteria 2041
17 Ga0068867_100229720 3300005459 Unclassified 1499
18 Ga0070706_100105544 3300005467 Bacteria 2621
19 Ga0070679_100089538 3300005530 Bacteria 3064
20 Ga0070679_100162840 3300005530 Bacteria 2204
21 Ga0070679_100340062 3300005530 Bacteria 1449
22 Ga0070684_100000018 3300005535 Bacteria 136597
23 Ga0070684_100159995 3300005535 Bacteria 2042
24 Ga0070684_100184080 3300005535 Bacteria 1899
25 Ga0070697_100052451 3300005536 Bacteria 3314
26 Ga0068853_100184163 3300005539 Bacteria 1895
27 Ga0070665_100053416 3300005548 Bacteria 4052
28 Ga0070665_100056772 3300005548 Bacteria 3926
29 Ga0068855_100036912 3300005563 Bacteria 5814
30 Ga0068857_100006692 3300005577 Bacteria 9907
31 Ga0068856_100022522 3300005614 Bacteria 6126
32 Ga0068856_100161574 3300005614 Bacteria 2250
33 Ga0068856_100325528 3300005614 Bacteria 1554
34 Ga0068859_100198400 3300005617 Bacteria 2091
35 Ga0068859_100509004 3300005617 Bacteria 1299
36 Ga0068866_10083546 3300005718 Bacteria 1721
37 Ga0068858_100105160 3300005842 Bacteria 2634
38 Ga0068858_100353484 3300005842 Bacteria 1408
39 Ga0068860_100018968 3300005843 Bacteria 6682
40 Ga0097621_100027695 3300006237 Bacteria 4459
41 Ga0097621_100064618 3300006237 Bacteria 3010
42 Ga0068871_100060796 3300006358 Bacteria 3083
43 Ga0068871_100147928 3300006358 Bacteria 2002
44 Ga0068871_100232447 3300006358 Bacteria 1600
45 Ga0068865_100024329 3300006881 Bacteria 3972
46 Ga0097620_100198394 3300006931 Bacteria 2091
47 Ga0097620_100509018 3300006931 Bacteria 1299
48 Ga0105240_10001355 3300009093 Bacteria 42007
49 Ga0105240_10008205 3300009093 Bacteria 14968
50 Ga0105240_10021469 3300009093 Bacteria 8586
51 Ga0105240_10024478 3300009093 Bacteria 7954
52 Ga0105240_10068437 3300009093 Bacteria 4396
53 Ga0105240_10100597 3300009093 Bacteria 3517
54 Ga0105240_10172589 3300009093 Unclassified 2559
55 Ga0105240_10357730 3300009093 Bacteria 1655
56 Ga0105240_10643424 3300009093 Unclassified 1163
57 Ga0105245_10015115 3300009098 Bacteria 6723
58 Ga0105245_10042792 3300009098 Bacteria 4040
59 Ga0105245_10395444 3300009098 Bacteria 1380
60 Ga0105245_10494882 3300009098 Unclassified 1238
61 Ga0105243_10061203 3300009148 Bacteria 3010
62 Ga0105241_10062977 3300009174 Bacteria 2860
63 Ga0105241_10342559 3300009174 Bacteria 1295
64 Ga0105242_10019785 3300009176 Bacteria 5275
65 Ga0105242_10025224 3300009176 Unclassified 4702
66 Ga0105242_10037290 3300009176 Bacteria 3904
67 Ga0105242_10079378 3300009176 Bacteria 2741
68 Ga0105242_10151538 3300009176 Bacteria 2022
69 Ga0105242_10438351 3300009176 Unclassified 1228
70 Ga0105248_10043177 3300009177 Bacteria 5055
71 Ga0105248_10073266 3300009177 Bacteria 3849
72 Ga0105248_10352832 3300009177 Bacteria 1656
73 Ga0105237_10013502 3300009545 Bacteria 8559
74 Ga0105237_10027082 3300009545 Bacteria 5855
75 Ga0105237_10092152 3300009545 Bacteria 3020
76 Ga0105238_10011252 3300009551 Bacteria 9005
77 Ga0105238_10011831 3300009551 Bacteria 8791
78 Ga0105238_10034192 3300009551 Bacteria 5173
79 Ga0105238_10049641 3300009551 Bacteria 4225
80 Ga0105238_10156955 3300009551 Bacteria 2250
81 Ga0105238_10249955 3300009551 Unclassified 1751
82 Ga0105249_10006227 3300009553 Bacteria 10360
83 Ga0105249_10043958 3300009553 Bacteria 4063
84 Ga0105239_10045954 3300010375 Bacteria 4785
85 Ga0105239_10052755 3300010375 Bacteria 4460
86 Ga0105239_10308758 3300010375 Bacteria 1782
87 Ga0105239_10383769 3300010375 Bacteria 1588
88 Ga0105246_10435961 3300011119 Bacteria 1097
89 Ga0157370_10010195 3300013104 Bacteria 9923
90 Ga0157370_10046985 3300013104 Bacteria 4139
91 Ga0157370_10347908 3300013104 Unclassified 1366
92 Ga0157369_10004006 3300013105 Bacteria 17474
93 Ga0157369_10004827 3300013105 Bacteria 15826
94 Ga0157369_10042826 3300013105 Bacteria 4938
95 Ga0157369_10044767 3300013105 Bacteria 4816
96 Ga0157369_10044863 3300013105 Bacteria 4810
97 Ga0157369_10167643 3300013105 Unclassified 2315
98 Ga0157369_10313992 3300013105 Bacteria 1630
99 Ga0157369_10348873 3300013105 Bacteria 1537
100 Ga0157374_10089781 3300013296 Bacteria 2928
101 Ga0157374_10186508 3300013296 Bacteria 2028
102 Ga0157378_10017671 3300013297 Bacteria 6261
103 Ga0157378_10187038 3300013297 Bacteria 1951
104 Ga0163162_10072168 3300013306 Bacteria 3507
105 Ga0157372_10024416 3300013307 Bacteria 6565
106 Ga0157372_10030424 3300013307 Bacteria 5908
107 Ga0157372_10130465 3300013307 Bacteria 2892
108 Ga0157372_10305143 3300013307 Bacteria 1852
109 Ga0157375_10041469 3300013308 Bacteria 4445
110 Ga0157375_10374439 3300013308 Bacteria 1590
111 Ga0157375_10491380 3300013308 Bacteria 1392
112 Ga0157375_10657158 3300013308 Bacteria 1204
113 Ga0163163_10021102 3300014325 Bacteria 6144
114 Ga0163163_10126263 3300014325 Bacteria 2596
115 Ga0163163_10211540 3300014325 Bacteria 1988
116 Ga0157379_10402584 3300014968 Unclassified 1258
117 Ga0157376_10037669 3300014969 Bacteria 3929
118 Ga0213875_10000006 3300021388 Bacteria 579005
119 Ga0213875_10000065 3300021388 Bacteria 128682
120 Ga0213875_10008636 3300021388 Bacteria 5203
121 Ga0207680_10222655 3300025903 Bacteria 1294
122 Ga0207707_10022326 3300025912 Bacteria 5533
123 Ga0207707_10116441 3300025912 Bacteria 2335
124 Ga0207707_10279428 3300025912 Bacteria 1446
125 Ga0207707_10282836 3300025912 Unclassified 1436
126 Ga0207695_10000832 3300025913 Bacteria 57182
127 Ga0207695_10009196 3300025913 Bacteria 12252
128 Ga0207695_10038425 3300025913 Bacteria 5154
129 Ga0207695_10046366 3300025913 Bacteria 4607
130 Ga0207695_10051454 3300025913 Bacteria 4325
131 Ga0207695_10240281 3300025913 Bacteria 1713
132 Ga0207671_10027111 3300025914 Bacteria 4286
133 Ga0207671_10027759 3300025914 Bacteria 4232
134 Ga0207657_10016099 3300025919 Bacteria 7218
135 Ga0207652_10048297 3300025921 Bacteria 3638
136 Ga0207652_10060416 3300025921 Bacteria 3270
137 Ga0207652_10100648 3300025921 Bacteria 2551
138 Ga0207694_10061631 3300025924 Bacteria 2919
139 Ga0207694_10276168 3300025924 Bacteria 1379
140 Ga0207687_10001453 3300025927 Bacteria 16248
141 Ga0207687_10004256 3300025927 Bacteria 9574
142 Ga0207687_10004969 3300025927 Bacteria 8814
143 Ga0207700_10007709 3300025928 Bacteria 6610
144 Ga0207700_10084604 3300025928 Bacteria 2487
145 Ga0207664_10251427 3300025929 Bacteria 1543
146 Ga0207690_10398862 3300025932 Bacteria 1097
147 Ga0207670_10088000 3300025936 Bacteria 2189
148 Ga0207704_10037832 3300025938 Bacteria 2792
149 Ga0207711_10005712 3300025941 Bacteria 10498
150 Ga0207711_10017939 3300025941 Bacteria 5881
151 Ga0207689_10113111 3300025942 Bacteria 2231
152 Ga0207661_10000011 3300025944 Bacteria 361200
153 Ga0207661_10088606 3300025944 Bacteria 2573
154 Ga0207661_10251301 3300025944 Bacteria 1571
155 Ga0207661_10433713 3300025944 Bacteria 1195
156 Ga0207679_10044772 3300025945 Bacteria 3196
157 Ga0207667_10005656 3300025949 Bacteria 15243
158 Ga0207667_10008990 3300025949 Bacteria 11819
159 Ga0207667_10021257 3300025949 Bacteria 7193
160 Ga0207667_10069317 3300025949 Bacteria 3670
161 Ga0207667_10176115 3300025949 Bacteria 2197
162 Ga0207651_10421844 3300025960 Unclassified 1139
163 Ga0207712_10138350 3300025961 Bacteria 1865
164 Ga0207703_10084870 3300026035 Bacteria 2649
165 Ga0207703_10297974 3300026035 Bacteria 1470
166 Ga0207639_10394104 3300026041 Unclassified 1246
167 Ga0207678_10025424 3300026067 Bacteria 5168
168 Ga0207641_10042315 3300026088 Bacteria 3821
169 Ga0207641_10060552 3300026088 Bacteria 3227
170 Ga0207641_10360424 3300026088 Bacteria 1388
171 Ga0207648_10273783 3300026089 Unclassified 1509
172 Ga0207674_10005164 3300026116 Bacteria 15565
173 Ga0207698_10084870 3300026142 Bacteria 2569
174 Ga0268266_10320018 3300028379 Bacteria 1451
175 Ga0265324_10004774 3300029957 Bacteria 5999
176 Ga0265320_10000647 3300031240 Bacteria 26595
177 Ga0265325_10035496 3300031241 Bacteria 2648
178 Ga0265329_10008631 3300031242 Bacteria 3850
179 Ga0265331_10001135 3300031250 Bacteria 20316
180 Ga0265316_10004077 3300031344 Bacteria 14615
181 Ga0265316_10015655 3300031344 Bacteria 6620
182 Ga0265313_10016182 3300031595 Bacteria 4299
183 Ga0265314_10001730 3300031711 Bacteria 23665
184 Ga0265314_10011955 3300031711 Bacteria 7120
185 Ga0265314_10138876 3300031711 Bacteria 1505
186 Ga0265342_10058950 3300031712 Bacteria 2268
187 Ga0373953_0021746 3300035117 Unclassified 2411
188 Ga0373956_0013674 3300035119 Bacteria 3379
189 Ga0373935_0026012 3300035692 Bacteria 3608
190 Ga0373927_0009317 3300035695 Bacteria 6587
191 Ga0373933_0012343 3300035724 Bacteria 4718
192 Ga0373933_0015364 3300035724 Bacteria 4268
193 Ga0373933_0056372 3300035724 Bacteria 2359
194 Ga0373937_0007500 3300036401 Bacteria 9443
195 Ga0373937_0015248 3300036401 Bacteria 6795
196 Ga0373937_0235842 3300036401 Bacteria 1723
197 Ga0373925_0184720 3300037068 Bacteria 1652
198 Ga0395900_0026170 3300037418 Bacteria 5974
199 Ga0395900_0236213 3300037418 Bacteria 1836
200 Ga0436364_0291156 3300037853 Bacteria 10728
201 Ga0436364_0311100 3300037853 Bacteria 15423
202 Ga0436364_0441702 3300037853 Bacteria 7109
203 Ga0436364_0473919 3300037853 Bacteria 7916
204 Ga0436364_0478514 3300037853 Bacteria 578677
205 Ga0436364_0510106 3300037853 Bacteria 33937
206 Ga0436364_0774458 3300037853 Bacteria 3053
207 Ga0436364_0828992 3300037853 Bacteria 61632
208 Ga0436364_0952477 3300037853 Bacteria 2560
209 Ga0436364_0985415 3300037853 Bacteria 17796
210 Ga0436364_1139985 3300037853 Bacteria 13582
211 Ga0436364_1203093 3300037853 Bacteria 1932
212 Ga0436364_1399161 3300037853 Unclassified 1556
213 Ga0436365_0134068 3300039437 Bacteria 10247
214 Ga0436365_0175759 3300039437 Bacteria 1942
215 Ga0436365_1336900 3300039437 Bacteria 3975
216 Ga0436365_1503495 3300039437 Bacteria 2000
217 Ga0436365_1790374 3300039437 Bacteria 2033
218 Ga0436361_1158081 3300039447 Bacteria 5692
219 Ga0436363_0282669 3300039450 Bacteria 3336
220 Ga0436363_1540069 3300039450 Bacteria 2291
221 Ga0466963_0173500 3300044694 Bacteria 1504
222 Ga0466967_0155561 3300045976 Bacteria 2141
223 Ga0495592_0098247 3300046454 Bacteria 2090
224 Ga0495651_0030058 3300046462 Bacteria 4236
225 Ga0495580_0000579 3300046472 Bacteria 30897
226 Ga0495580_0034535 3300046472 Bacteria 3641
227 Ga0495580_0100857 3300046472 Bacteria 2008
228 Ga0495582_0024081 3300046473 Bacteria 3329
229 Ga0495664_0003358 3300046477 Bacteria 8701
230 Ga0495628_0033738 3300046516 Bacteria 4122
231 Ga0495630_0051738 3300046517 Bacteria 3074
232 Ga0495652_0095639 3300046529 Bacteria 2420
233 Ga0495665_0067978 3300046531 Bacteria 1879
234 Ga0495640_0021197 3300046533 Bacteria 4773
235 Ga0495587_0000924 3300046536 Bacteria 19326
236 Ga0495587_0031733 3300046536 Bacteria 3197
237 Ga0495645_0017108 3300046543 Bacteria 5192
238 Ga0495667_0034743 3300046559 Bacteria 3370
239 Ga0495634_0051306 3300046642 Bacteria 2768
240 Ga0495634_0082910 3300046642 Bacteria 2094
241 Ga0495635_0050660 3300046663 Bacteria 2862
242 Ga0495588_0105295 3300046674 Unclassified 1484
243 Ga0495599_0017234 3300046678 Bacteria 4490
244 Ga0495599_0021604 3300046678 Bacteria 4017
245 Ga0495613_0055958 3300046689 Bacteria 2897
246 Ga0495613_0074733 3300046689 Bacteria 2468
247 Ga0495600_0015970 3300046809 Bacteria 4758
248 Ga0495604_0058768 3300047317 Bacteria 2952
249 Ga0495674_0048532 3300047319 Bacteria 3756
250 Ga0495675_0070100 3300047444 Bacteria 2213
251 Ga0495675_0131100 3300047444 Bacteria 1558
252 Ga0495684_0052570 3300047471 Bacteria 3109
253 Ga0495602_0008339 3300048088 Bacteria 10824
254 Ga0495602_0048655 3300048088 Bacteria 3808
255 Ga0495602_0127580 3300048088 Bacteria 2035
256 Ga0496126_0022230 3300048929 Bacteria 6175
257 Ga0501038_0239537 3300049574 Bacteria 1441
258 Ga0501043_0055011 3300049579 Bacteria 3126
259 Ga0501047_0004284 3300049581 Bacteria 13428
260 Ga0501070_0067994 3300049586 Bacteria 2950
261 Ga0501044_0372021 3300049823 Bacteria 1345
262 Ga0500568_0000392 3300053139 Bacteria 33395
263 Ga0207683_10054354
264 Ga0070683_100000006
265 Ga0070683_100087366
266 Ga0070683_100115235
267 Ga0070683_100195721
268 Ga0070683_100473958
269 Ga0070660_100037780
270 Ga0070689_100094464
271 Ga0070661_100159767
272 Ga0070673_100098544
273 Ga0070714_100084768
274 Ga0070713_100127913
275 Ga0070708_100108895
276 Ga0070681_10247342
277 Ga0068867_100062597
278 Ga0068867_100118685
279 Ga0068867_100229720
280 Ga0070706_100105544
281 Ga0070679_100089538
282 Ga0070679_100162840
283 Ga0070679_100340062
284 Ga0070684_100000018
285 Ga0070684_100159995
286 Ga0070684_100184080
287 Ga0070697_100052451
288 Ga0068853_100184163
289 Ga0070665_100053416
290 Ga0070665_100056772
291 Ga0068855_100036912
292 Ga0068857_100006692
293 Ga0068856_100022522
294 Ga0068856_100161574
295 Ga0068856_100325528
296 Ga0068859_100198400
297 Ga0068859_100509004
298 Ga0068866_10083546
299 Ga0068858_100105160
300 Ga0068858_100353484
301 Ga0068860_100018968
302 Ga0097621_100027695
303 Ga0097621_100064618
304 Ga0068871_100060796
305 Ga0068871_100147928
306 Ga0068871_100232447
307 Ga0068865_100024329
308 Ga0097620_100198394
309 Ga0097620_100509018
310 Ga0105240_10001355
311 Ga0105240_10008205
312 Ga0105240_10021469
313 Ga0105240_10024478
314 Ga0105240_10068437
315 Ga0105240_10100597
316 Ga0105240_10172589
317 Ga0105240_10357730
318 Ga0105240_10643424
319 Ga0105245_10015115
320 Ga0105245_10042792
321 Ga0105245_10395444
322 Ga0105245_10494882
323 Ga0105243_10061203
324 Ga0105241_10062977
325 Ga0105241_10342559
326 Ga0105242_10019785
327 Ga0105242_10025224
328 Ga0105242_10037290
329 Ga0105242_10079378
330 Ga0105242_10151538
331 Ga0105242_10438351
332 Ga0105248_10043177
333 Ga0105248_10073266
334 Ga0105248_10352832
335 Ga0105237_10013502
336 Ga0105237_10027082
337 Ga0105237_10092152
338 Ga0105238_10011252
339 Ga0105238_10011831
340 Ga0105238_10034192
341 Ga0105238_10049641
342 Ga0105238_10156955
343 Ga0105238_10249955
344 Ga0105249_10006227
345 Ga0105249_10043958
346 Ga0105239_10045954
347 Ga0105239_10052755
348 Ga0105239_10308758
349 Ga0105239_10383769
350 Ga0105246_10435961
351 Ga0157370_10010195
352 Ga0157370_10046985
353 Ga0157370_10347908
354 Ga0157369_10004006
355 Ga0157369_10004827
356 Ga0157369_10042826
357 Ga0157369_10044767
358 Ga0157369_10044863
359 Ga0157369_10167643
360 Ga0157369_10313992
361 Ga0157369_10348873
362 Ga0157374_10089781
363 Ga0157374_10186508
364 Ga0157378_10017671
365 Ga0157378_10187038
366 Ga0163162_10072168
367 Ga0157372_10024416
368 Ga0157372_10030424
369 Ga0157372_10130465
370 Ga0157372_10305143
371 Ga0157375_10041469
372 Ga0157375_10374439
373 Ga0157375_10491380
374 Ga0157375_10657158
375 Ga0163163_10021102
376 Ga0163163_10126263
377 Ga0163163_10211540
378 Ga0157379_10402584
379 Ga0157376_10037669
380 Ga0213875_10000006
381 Ga0213875_10000065
382 Ga0213875_10008636
383 Ga0207680_10222655
384 Ga0207707_10022326
385 Ga0207707_10116441
386 Ga0207707_10279428
387 Ga0207707_10282836
388 Ga0207695_10000832
389 Ga0207695_10009196
390 Ga0207695_10038425
391 Ga0207695_10046366
392 Ga0207695_10051454
393 Ga0207695_10240281
394 Ga0207671_10027111
395 Ga0207671_10027759
396 Ga0207657_10016099
397 Ga0207652_10048297
398 Ga0207652_10060416
399 Ga0207652_10100648
400 Ga0207694_10061631
401 Ga0207694_10276168
402 Ga0207687_10001453
403 Ga0207687_10004256
404 Ga0207687_10004969
405 Ga0207700_10007709
406 Ga0207700_10084604
407 Ga0207664_10251427
408 Ga0207690_10398862
409 Ga0207670_10088000
410 Ga0207704_10037832
411 Ga0207711_10005712
412 Ga0207711_10017939
413 Ga0207689_10113111
414 Ga0207661_10000011
415 Ga0207661_10088606
416 Ga0207661_10251301
417 Ga0207661_10433713
418 Ga0207679_10044772
419 Ga0207667_10005656
420 Ga0207667_10008990
421 Ga0207667_10021257
422 Ga0207667_10069317
423 Ga0207667_10176115
424 Ga0207651_10421844
425 Ga0207712_10138350
426 Ga0207703_10084870
427 Ga0207703_10297974
428 Ga0207639_10394104
429 Ga0207678_10025424
430 Ga0207641_10042315
431 Ga0207641_10060552
432 Ga0207641_10360424
433 Ga0207648_10273783
434 Ga0207674_10005164
435 Ga0207698_10084870
436 Ga0268266_10320018
437 Ga0265324_10004774
438 Ga0265320_10000647
439 Ga0265325_10035496
440 Ga0265329_10008631
441 Ga0265331_10001135
442 Ga0265316_10004077
443 Ga0265316_10015655
444 Ga0265313_10016182
445 Ga0265314_10001730
446 Ga0265314_10011955
447 Ga0265314_10138876
448 Ga0265342_10058950
449 Ga0373953_0021746
450 Ga0373956_0013674
451 Ga0373935_0026012
452 Ga0373927_0009317
453 Ga0373933_0012343
454 Ga0373933_0015364
455 Ga0373933_0056372
456 Ga0373937_0007500
457 Ga0373937_0015248
458 Ga0373937_0235842
459 Ga0373925_0184720
460 Ga0395900_0026170
461 Ga0395900_0236213
462 Ga0436364_0291156
463 Ga0436364_0311100
464 Ga0436364_0441702
465 Ga0436364_0473919
466 Ga0436364_0478514
467 Ga0436364_0510106
468 Ga0436364_0774458
469 Ga0436364_0828992
470 Ga0436364_0952477
471 Ga0436364_0985415
472 Ga0436364_1139985
473 Ga0436364_1203093
474 Ga0436364_1399161
475 Ga0436365_0134068
476 Ga0436365_0175759
477 Ga0436365_1336900
478 Ga0436365_1503495
479 Ga0436365_1790374
480 Ga0436361_1158081
481 Ga0436363_0282669
482 Ga0436363_1540069
483 Ga0466963_0173500
484 Ga0466967_0155561
485 Ga0495592_0098247
486 Ga0495651_0030058
487 Ga0495580_0000579
488 Ga0495580_0034535
489 Ga0495580_0100857
490 Ga0495582_0024081
491 Ga0495664_0003358
492 Ga0495628_0033738
493 Ga0495630_0051738
494 Ga0495652_0095639
495 Ga0495665_0067978
496 Ga0495640_0021197
497 Ga0495587_0000924
498 Ga0495587_0031733
499 Ga0495645_0017108
500 Ga0495667_0034743
501 Ga0495634_0051306
502 Ga0495634_0082910
503 Ga0495635_0050660
504 Ga0495588_0105295
505 Ga0495599_0017234
506 Ga0495599_0021604
507 Ga0495613_0055958
508 Ga0495613_0074733
509 Ga0495600_0015970
510 Ga0495604_0058768
511 Ga0495674_0048532
512 Ga0495675_0070100
513 Ga0495675_0131100
514 Ga0495684_0052570
515 Ga0495602_0008339
516 Ga0495602_0048655
517 Ga0495602_0127580
518 Ga0496126_0022230
519 Ga0501038_0239537
520 Ga0501043_0055011
521 Ga0501047_0004284
522 Ga0501070_0067994
523 Ga0501044_0372021
524 Ga0500568_0000392

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06574

FAD_syn

FAD synthetase

11

122

0.96

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

104

375

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

109

390

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9566 6 37
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9493 5 37
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.9389 2 325
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.9334 2 325
7a7b-assembly1.cif.gz_D bacillithiol disulfide reductase bdr (ypda) from staphylococcus aureus 0.9297 2 327
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.011 6 36 3.50.50.60
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 6 35 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9472 6 35 3.40.50.720
af_Q2FYF3_1_146_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9388 2 152 3.50.50.60
af_Q4DB76_342_532_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 6 37 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A524LT09-F1-model_v4 FAD-binding protein 0.9754 5 103
AF-A0A0X8X2W0-F1-model_v4 Uncharacterized protein 0.9709 5 104
AF-A0A3N5L3B3-F1-model_v4 FAD-binding protein 0.9619 2 158 GO:0004497
GO:0050660
AF-A0A3N5L3B3-F1-model_v4 FAD-binding protein 0.956 2 158 GO:0004497
GO:0050660
AF-A0A525BWZ0-F1-model_v4 4Fe-4S binding protein 0.9517 138 267 GO:0005886
GO:0046872
GO:0051539

Map