F371155

General Info

Members Datasets Scaffolds Average Seq Length
262 161 262 225

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10829464|Ga0207689_108294641
Length 245
Sequence MAPRRRGASATAGAAKKKTPVPDFGPEDFAAKTGVSRETLARLKAYADVLTDWNARHNLVAKSTLPDLWQRHFWDSAQLTPLIPPTARSLADLGSGAGFPGLVLAAMIPGLAVTLHEATTKKCAFLRMAADRMAMPVAIQNARLEDLSPARFDVVTARALAPLPQLLGYAQNFVGPNSVCLFLKGQNVVAELTEAHKCWNIMASQVPSQTDPSAAIVIVRELGPRHVEPQKTTRPGRRQPKGRRR

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
121 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
154 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
155 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
160 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
161 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.4
Nodule 0
Rhizoplane 1.15
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10000400 3300003215 Bacteria 29140
3 Ga0070658_10004966 3300005327 Bacteria 10840
4 Ga0070676_10014055 3300005328 Bacteria 4393
5 Ga0070683_100011798 3300005329 Bacteria 7569
6 Ga0070677_10159496 3300005333 Bacteria 1057
7 Ga0068869_100029640 3300005334 Bacteria 3836
8 Ga0068869_100074355 3300005334 Bacteria 2522
9 Ga0070666_10008496 3300005335 Bacteria 6379
10 Ga0070666_10018216 3300005335 Bacteria 4512
11 Ga0070666_10184872 3300005335 Bacteria 1463
12 Ga0070660_100005320 3300005339 Bacteria 8907
13 Ga0070660_100035626 3300005339 Bacteria 3768
14 Ga0070661_100127291 3300005344 Bacteria 1911
15 Ga0070661_100428990 3300005344 Bacteria 1049
16 Ga0070675_100140071 3300005354 Bacteria 2067
17 Ga0070675_100589191 3300005354 Bacteria 1008
18 Ga0070673_100043356 3300005364 Bacteria 3476
19 Ga0070667_100041457 3300005367 Bacteria 3862
20 Ga0070714_100374570 3300005435 Bacteria 1341
21 Ga0070713_100372062 3300005436 Bacteria 1330
22 Ga0070678_100016278 3300005456 Bacteria 4752
23 Ga0070678_100055604 3300005456 Bacteria 2890
24 Ga0070678_100148428 3300005456 Bacteria 1885
25 Ga0070681_10115681 3300005458 Bacteria 2620
26 Ga0068867_100107903 3300005459 Bacteria 2134
27 Ga0068867_100503000 3300005459 Bacteria 1042
28 Ga0070685_10106146 3300005466 Bacteria 1723
29 Ga0070679_100022128 3300005530 Bacteria 6211
30 Ga0070679_100055123 3300005530 Bacteria 3959
31 Ga0070684_100237252 3300005535 Bacteria 1666
32 Ga0068853_100067294 3300005539 Bacteria 3112
33 Ga0068853_100498957 3300005539 Bacteria 1149
34 Ga0070672_100489415 3300005543 Bacteria 1063
35 Ga0070696_100140295 3300005546 Bacteria 1766
36 Ga0070665_100001302 3300005548 Bacteria 29816
37 Ga0070665_100015488 3300005548 Bacteria 7661
38 Ga0070665_100037444 3300005548 Bacteria 4879
39 Ga0070665_100085989 3300005548 Bacteria 3150
40 Ga0070665_100327291 3300005548 Bacteria 1537
41 Ga0068855_100157706 3300005563 Bacteria 2578
42 Ga0068855_100241800 3300005563 Bacteria 2017
43 Ga0068855_101041326 3300005563 Bacteria 858
44 Ga0068857_100385686 3300005577 Bacteria 1302
45 Ga0068854_100451929 3300005578 Bacteria 1073
46 Ga0068854_100967380 3300005578 Bacteria 752
47 Ga0068856_100032512 3300005614 Bacteria 5107
48 Ga0068856_100117989 3300005614 Bacteria 2654
49 Ga0070702_100127210 3300005615 Bacteria 1604
50 Ga0068866_10580550 3300005718 Bacteria 754
51 Ga0068858_100081098 3300005842 Bacteria 3015
52 Ga0068858_100233350 3300005842 Bacteria 1744
53 Ga0081455_10486585 3300005937 Bacteria 833
54 Ga0070712_100448316 3300006175 Bacteria 1074
55 Ga0097621_100000645 3300006237 Bacteria 24626
56 Ga0097621_100066057 3300006237 Bacteria 2978
57 Ga0097621_100105608 3300006237 Bacteria 2375
58 Ga0097621_100204057 3300006237 Bacteria 1717
59 Ga0097621_100208883 3300006237 Bacteria 1698
60 Ga0068871_100000378 3300006358 Bacteria 31128
61 Ga0068871_100027530 3300006358 Bacteria 4448
62 Ga0068871_100104128 3300006358 Bacteria 2380
63 Ga0068871_100148831 3300006358 Bacteria 1996
64 Ga0075431_100178991 3300006847 Bacteria 2176
65 Ga0068865_100006279 3300006881 Bacteria 7236
66 Ga0105240_10077628 3300009093 Bacteria 4091
67 Ga0105240_10506542 3300009093 Bacteria 1341
68 Ga0111539_10041076 3300009094 Bacteria 5564
69 Ga0105245_10078344 3300009098 Bacteria 3015
70 Ga0105245_10115561 3300009098 Bacteria 2501
71 Ga0105245_11044177 3300009098 Bacteria 862
72 Ga0105247_10210134 3300009101 Bacteria 1312
73 Ga0105243_10234736 3300009148 Bacteria 1629
74 Ga0105241_10246466 3300009174 Bacteria 1513
75 Ga0105241_10303208 3300009174 Bacteria 1372
76 Ga0105241_10556573 3300009174 Bacteria 1030
77 Ga0105242_10036250 3300009176 Bacteria 3956
78 Ga0105248_10069938 3300009177 Bacteria 3942
79 Ga0105248_10123720 3300009177 Bacteria 2917
80 Ga0105248_10587720 3300009177 Bacteria 1256
81 Ga0105248_10703864 3300009177 Bacteria 1140
82 Ga0105237_10490898 3300009545 Bacteria 1234
83 Ga0105237_10517950 3300009545 Bacteria 1199
84 Ga0105238_10492472 3300009551 Bacteria 1226
85 Ga0105249_10045079 3300009553 Bacteria 4010
86 Ga0105239_10226765 3300010375 Bacteria 2096
87 Ga0105239_10471675 3300010375 Bacteria 1425
88 Ga0105239_10540064 3300010375 Bacteria 1327
89 Ga0105246_10074464 3300011119 Bacteria 2400
90 Ga0105246_10596161 3300011119 Bacteria 954
91 Ga0157370_10248930 3300013104 Bacteria 1644
92 Ga0157374_10093368 3300013296 Bacteria 2873
93 Ga0157374_10121433 3300013296 Bacteria 2522
94 Ga0157374_11036560 3300013296 Bacteria 840
95 Ga0163162_10323591 3300013306 Bacteria 1674
96 Ga0163162_10699204 3300013306 Bacteria 1135
97 Ga0157372_10064885 3300013307 Bacteria 4098
98 Ga0157375_10124763 3300013308 Bacteria 2688
99 Ga0163163_10000012 3300014325 Bacteria 257369
100 Ga0163163_10470567 3300014325 Bacteria 1317
101 Ga0163163_10594883 3300014325 Bacteria 1169
102 Ga0163163_11126373 3300014325 Bacteria 848
103 Ga0157379_10005685 3300014968 Bacteria 10714
104 Ga0157379_10186146 3300014968 Bacteria 1876
105 Ga0163161_10121498 3300017792 Bacteria 1963
106 Ga0213874_10003449 3300021377 Bacteria 3506
107 Ga0209563_103628 3300025230 Bacteria 3142
108 Ga0207427_103499 3300025231 Bacteria 3250
109 Ga0209233_1000006 3300025261 Bacteria 1473685
110 Ga0209233_1000865 3300025261 Bacteria 13360
111 Ga0209758_1000008 3300025297 Bacteria 1215263
112 Ga0207642_10017611 3300025899 Bacteria 2722
113 Ga0207680_10119061 3300025903 Bacteria 1724
114 Ga0207645_10031942 3300025907 Bacteria 3385
115 Ga0207643_10122511 3300025908 Bacteria 1541
116 Ga0207705_10291884 3300025909 Bacteria 1249
117 Ga0207654_10025193 3300025911 Bacteria 3206
118 Ga0207707_10093420 3300025912 Bacteria 2628
119 Ga0207695_10088933 3300025913 Bacteria 3107
120 Ga0207695_10091373 3300025913 Bacteria 3058
121 Ga0207695_10153400 3300025913 Bacteria 2240
122 Ga0207671_10115307 3300025914 Bacteria 2048
123 Ga0207660_10307488 3300025917 Bacteria 1263
124 Ga0207657_10042476 3300025919 Bacteria 4011
125 Ga0207657_10367088 3300025919 Bacteria 1134
126 Ga0207649_10195878 3300025920 Bacteria 1424
127 Ga0207649_10669128 3300025920 Bacteria 803
128 Ga0207652_10484828 3300025921 Bacteria 1113
129 Ga0207694_10070248 3300025924 Bacteria 2736
130 Ga0207694_10091735 3300025924 Bacteria 2397
131 Ga0207694_10094137 3300025924 Bacteria 2367
132 Ga0207694_10149728 3300025924 Bacteria 1879
133 Ga0207659_10545188 3300025926 Bacteria 985
134 Ga0207687_10046119 3300025927 Bacteria 3016
135 Ga0207687_10093805 3300025927 Bacteria 2195
136 Ga0207664_10296848 3300025929 Bacteria 1421
137 Ga0207709_10008498 3300025935 Bacteria 5680
138 Ga0207670_10148435 3300025936 Bacteria 1737
139 Ga0207704_10047856 3300025938 Bacteria 2560
140 Ga0207711_10033196 3300025941 Bacteria 4366
141 Ga0207711_10234017 3300025941 Bacteria 1683
142 Ga0207689_10221133 3300025942 Bacteria 1565
143 Ga0207689_10805392 3300025942 Bacteria 793
144 Ga0207689_10829464 3300025942 Bacteria 780
145 Ga0207661_10043740 3300025944 Bacteria 3536
146 Ga0207667_10227659 3300025949 Bacteria 1910
147 Ga0207667_10494228 3300025949 Bacteria 1241
148 Ga0207667_10507559 3300025949 Bacteria 1223
149 Ga0207667_10741465 3300025949 Bacteria 982
150 Ga0207667_11097211 3300025949 Bacteria 779
151 Ga0207651_10331637 3300025960 Bacteria 1275
152 Ga0207712_10012522 3300025961 Bacteria 5420
153 Ga0207640_10528349 3300025981 Bacteria 987
154 Ga0207677_10634772 3300026023 Bacteria 941
155 Ga0207639_10987440 3300026041 Bacteria 788
156 Ga0207678_10596247 3300026067 Bacteria 968
157 Ga0207702_10092109 3300026078 Bacteria 2656
158 Ga0207702_10136092 3300026078 Bacteria 2217
159 Ga0207702_11012775 3300026078 Bacteria 824
160 Ga0207648_10004493 3300026089 Bacteria 14300
161 Ga0207674_10150614 3300026116 Bacteria 2283
162 Ga0207675_100140563 3300026118 Bacteria 2293
163 Ga0207683_10005405 3300026121 Bacteria 10945
164 Ga0207683_10009192 3300026121 Bacteria 8420
165 Ga0207683_10113746 3300026121 Bacteria 2424
166 Ga0268266_10010985 3300028379 Bacteria 7880
167 Ga0268266_10011368 3300028379 Bacteria 7741
168 Ga0268266_10096756 3300028379 Bacteria 2595
169 Ga0268266_10203367 3300028379 Bacteria 1813
170 Ga0268265_10297413 3300028380 Bacteria 1452
171 Ga0265338_10028600 3300028800 Bacteria 5554
172 Ga0265338_10039368 3300028800 Bacteria 4460
173 Ga0265330_10028733 3300031235 Bacteria 2504
174 Ga0265330_10075544 3300031235 Bacteria 1455
175 Ga0265320_10000034 3300031240 Bacteria 141117
176 Ga0265325_10024153 3300031241 Bacteria 3308
177 Ga0265325_10070860 3300031241 Bacteria 1750
178 Ga0265340_10000018 3300031247 Bacteria 90851
179 Ga0265340_10000091 3300031247 Bacteria 42465
180 Ga0265340_10083995 3300031247 Bacteria 1496
181 Ga0265340_10135783 3300031247 Bacteria 1126
182 Ga0265339_10013849 3300031249 Bacteria 4878
183 Ga0265339_10086095 3300031249 Bacteria 1654
184 Ga0265331_10061178 3300031250 Bacteria 1778
185 Ga0265316_10016839 3300031344 Bacteria 6326
186 Ga0265316_10037770 3300031344 Bacteria 3895
187 Ga0265316_10462806 3300031344 Bacteria 909
188 Ga0265313_10023219 3300031595 Bacteria 3346
189 Ga0265313_10128389 3300031595 Bacteria 1101
190 Ga0265314_10002412 3300031711 Bacteria 19188
191 Ga0265314_10012421 3300031711 Bacteria 6948
192 Ga0265314_10048105 3300031711 Bacteria 2996
193 Ga0265342_10002883 3300031712 Bacteria 14498
194 Ga0265342_10004869 3300031712 Bacteria 10396
195 Ga0265342_10086554 3300031712 Bacteria 1802
196 Ga0307516_10043599 3300031730 Bacteria 4444
197 Ga0373925_0115559 3300037068 Bacteria 2078
198 Ga0395899_0106783 3300037312 Bacteria 2016
199 Ga0395900_0029098 3300037418 Bacteria 5666
200 Ga0436365_0442500 3300039437 Bacteria 2725
201 Ga0436360_0011870 3300039438 Bacteria 1090
202 Ga0436363_0025868 3300039450 Bacteria 14745
203 Ga0451791_0226453 3300041451 Bacteria 1220
204 Ga0451800_1244775 3300041459 Bacteria 764
205 Ga0495629_0086074 3300046459 Bacteria 2193
206 Ga0495651_0167717 3300046462 Bacteria 1567
207 Ga0495606_0276388 3300046507 Bacteria 920
208 Ga0495652_0139143 3300046529 Bacteria 1911
209 Ga0495665_0015529 3300046531 Bacteria 4100
210 Ga0495621_0055866 3300046539 Bacteria 1422
211 Ga0495622_0195697 3300046557 Bacteria 902
212 Ga0495667_0263521 3300046559 Bacteria 1096
213 Ga0495625_0207376 3300046660 Bacteria 1290
214 Ga0495661_0109011 3300046665 Bacteria 1546
215 Ga0495581_0342437 3300047315 Bacteria 873
216 Ga0495636_0076008 3300047318 Bacteria 1440
217 Ga0495680_0344340 3300047322 Bacteria 1039
218 Ga0496106_0240349 3300048909 Bacteria 1447
219 Ga0501032_0124039 3300049569 Bacteria 1707
220 Ga0501033_0005496 3300049570 Bacteria 10035
221 Ga0501033_0069916 3300049570 Bacteria 2579
222 Ga0501033_0232322 3300049570 Bacteria 1310
223 Ga0501034_0140168 3300049571 Bacteria 2398
224 Ga0501034_0233228 3300049571 Bacteria 1789
225 Ga0501036_0179938 3300049572 Bacteria 1780
226 Ga0501037_0075890 3300049573 Bacteria 2441
227 Ga0501038_0229999 3300049574 Bacteria 1476
228 Ga0501043_0119867 3300049579 Bacteria 2063
229 Ga0501046_0005461 3300049580 Bacteria 11367
230 Ga0501046_0023123 3300049580 Bacteria 5118
231 Ga0501047_0007901 3300049581 Bacteria 10028
232 Ga0501047_0048409 3300049581 Bacteria 4105
233 Ga0501047_0053246 3300049581 Bacteria 3912
234 Ga0501047_0075430 3300049581 Bacteria 3245
235 Ga0501047_0535093 3300049581 Bacteria 997
236 Ga0501073_0050987 3300049589 Bacteria 2899
237 Ga0501035_0057063 3300049822 Bacteria 3482
238 Ga0501035_0112614 3300049822 Bacteria 2384
239 Ga0501035_0247967 3300049822 Bacteria 1513
240 Ga0501035_0365762 3300049822 Bacteria 1205
241 Ga0501044_0002877 3300049823 Bacteria 19588
242 Ga0501044_0005632 3300049823 Bacteria 13905
243 Ga0501044_0015414 3300049823 Bacteria 8232
244 Ga0501044_0067288 3300049823 Bacteria 3650
245 Ga0501044_0347487 3300049823 Bacteria 1403
246 nmdc:mga06r32_165217_c1 3300050510 Bacteria 2196
247 nmdc:mga08y16_122794_c1 3300050511 Bacteria 2702
248 Ga0500643_000027 3300053087 Bacteria 251062
249 Ga0500646_0018885 3300053090 Bacteria 1819
250 Ga0500641_0014919 3300053096 Bacteria 2874
251 Ga0500592_003771 3300053116 Bacteria 2416
252 Ga0500593_014470 3300053117 Bacteria 3386
253 Ga0500595_000673 3300053119 Bacteria 20517
254 Ga0500595_003175 3300053119 Bacteria 7779
255 Ga0500595_016692 3300053119 Bacteria 2729
256 Ga0500595_044973 3300053119 Bacteria 1397
257 Ga0500559_0156515 3300053136 Bacteria 1070
258 Ga0500568_0015926 3300053139 Bacteria 3354
259 Ga0500573_0000961 3300053140 Bacteria 13173
260 Ga0500588_0162745 3300053146 Bacteria 813
261 Ga0500639_130404 3300053163 Bacteria 1192
262 Ga0500645_007365 3300053730 Bacteria 3841

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10041076 Ga0111539_100410764 185
2 3300041451 Ga0451791_0226453 Ga0451791_0226453_492_1145 192
3 3300031247 Ga0265340_10000018 Ga0265340_1000001814 205
4 3300031247 Ga0265340_10000091 Ga0265340_1000009144 205
5 3300031249 Ga0265339_10013849 Ga0265339_100138492 205
6 3300031249 Ga0265339_10086095 Ga0265339_100860952 205
7 3300031344 Ga0265316_10016839 Ga0265316_100168393 205
8 3300031711 Ga0265314_10002412 Ga0265314_100024128 205
9 3300031712 Ga0265342_10002883 Ga0265342_1000288311 205
10 3300006175 Ga0070712_100448316 Ga0070712_1004483162 206
11 3300013296 Ga0157374_10093368 Ga0157374_100933682 206
12 3300031344 Ga0265316_10462806 Ga0265316_104628062 206
13 3300041459 Ga0451800_1244775 Ga0451800_1244775_24_644 206
14 3300005435 Ga0070714_100374570 Ga0070714_1003745702 207
15 3300010375 Ga0105239_10471675 Ga0105239_104716752 207
16 3300025929 Ga0207664_10296848 Ga0207664_102968482 207
17 3300031235 Ga0265330_10028733 Ga0265330_100287333 207
18 3300031247 Ga0265340_10135783 Ga0265340_101357832 207
19 3300031595 Ga0265313_10023219 Ga0265313_100232193 207
20 3300031711 Ga0265314_10048105 Ga0265314_100481054 207
21 3300031712 Ga0265342_10004869 Ga0265342_100048695 207
22 3300046462 Ga0495651_0167717 Ga0495651_0167717_586_1230 207
23 3300046529 Ga0495652_0139143 Ga0495652_0139143_1173_1817 207
24 3300046559 Ga0495667_0263521 Ga0495667_0263521_207_851 207
25 3300047322 Ga0495680_0344340 Ga0495680_0344340_11_655 207
26 3300005563 Ga0068855_100157706 Ga0068855_1001577062 210
27 3300025949 Ga0207667_10494228 Ga0207667_104942282 210
28 3300031240 Ga0265320_10000034 Ga0265320_10000034144 211
29 3300031241 Ga0265325_10070860 Ga0265325_100708602 211
30 3300031595 Ga0265313_10128389 Ga0265313_101283892 211
31 3300031711 Ga0265314_10012421 Ga0265314_100124217 211
32 3300005328 Ga0070676_10014055 Ga0070676_100140553 212
33 3300005334 Ga0068869_100029640 Ga0068869_1000296404 212
34 3300005459 Ga0068867_100107903 Ga0068867_1001079032 212
35 3300005577 Ga0068857_100385686 Ga0068857_1003856862 212
36 3300005718 Ga0068866_10580550 Ga0068866_105805501 212
37 3300009098 Ga0105245_10115561 Ga0105245_101155612 212
38 3300009148 Ga0105243_10234736 Ga0105243_102347362 212
39 3300011119 Ga0105246_10596161 Ga0105246_105961612 212
40 3300025899 Ga0207642_10017611 Ga0207642_100176112 212
41 3300025907 Ga0207645_10031942 Ga0207645_100319423 212
42 3300025927 Ga0207687_10093805 Ga0207687_100938053 212
43 3300025935 Ga0207709_10008498 Ga0207709_100084986 212
44 3300025936 Ga0207670_10148435 Ga0207670_101484353 212
45 3300025942 Ga0207689_10221133 Ga0207689_102211332 212
46 3300026023 Ga0207677_10634772 Ga0207677_106347722 212
47 3300026089 Ga0207648_10004493 Ga0207648_100044936 212
48 3300026116 Ga0207674_10150614 Ga0207674_101506142 212
49 3300031241 Ga0265325_10024153 Ga0265325_100241532 213
50 3300005546 Ga0070696_100140295 Ga0070696_1001402952 214
51 3300006847 Ga0075431_100178991 Ga0075431_1001789912 214
52 3300009551 Ga0105238_10492472 Ga0105238_104924722 214
53 3300025924 Ga0207694_10091735 Ga0207694_100917353 214
54 3300037068 Ga0373925_0115559 Ga0373925_0115559_609_1271 214
55 3300046531 Ga0495665_0015529 Ga0495665_0015529_698_1360 214
56 3300047315 Ga0495581_0342437 Ga0495581_0342437_77_739 214
57 3300050510 nmdc:mga06r32_165217_c1 nmdc:mga06r32_165217_c1_906_1580 214
58 3300050511 nmdc:mga08y16_122794_c1 nmdc:mga08y16_122794_c1_1102_1776 214
59 3300006358 Ga0068871_100104128 Ga0068871_1001041283 216
60 3300009098 Ga0105245_11044177 Ga0105245_110441772 216
61 3300028800 Ga0265338_10039368 Ga0265338_100393686 216
62 3300009093 Ga0105240_10506542 Ga0105240_105065422 218
63 3300021377 Ga0213874_10003449 Ga0213874_100034494 218
64 3300025913 Ga0207695_10091373 Ga0207695_100913733 218
65 3300039450 Ga0436363_0025868 Ga0436363_0025868_8374_9033 218
66 3300005456 Ga0070678_100016278 Ga0070678_1000162782 222
67 3300005548 Ga0070665_100327291 Ga0070665_1003272911 222
68 3300005842 Ga0068858_100233350 Ga0068858_1002333502 222
69 3300009553 Ga0105249_10045079 Ga0105249_100450792 222
70 3300025230 Ga0209563_103628 Ga0209563_1036282 222
71 3300025909 Ga0207705_10291884 Ga0207705_102918842 222
72 3300025921 Ga0207652_10484828 Ga0207652_104848282 222
73 3300025961 Ga0207712_10012522 Ga0207712_100125227 222
74 3300026121 Ga0207683_10113746 Ga0207683_101137462 222
75 3300046660 Ga0495625_0207376 Ga0495625_0207376_293_961 222
76 3300053087 Ga0500643_000027 Ga0500643_000027_22653_23321 222
77 3300053090 Ga0500646_0018885 Ga0500646_0018885_333_1028 222
78 3300053116 Ga0500592_003771 Ga0500592_003771_443_1111 222
79 3300053117 Ga0500593_014470 Ga0500593_014470_1522_2190 222
80 3300053139 Ga0500568_0015926 Ga0500568_0015926_1008_1676 222
81 3300053163 Ga0500639_130404 Ga0500639_130404_113_787 222
82 3300053730 Ga0500645_007365 Ga0500645_007365_1205_1873 222
83 3300053096 Ga0500641_0014919 Ga0500641_0014919_2030_2701 223
84 3300005327 Ga0070658_10004966 Ga0070658_100049669 224
85 3300005329 Ga0070683_100011798 Ga0070683_1000117986 224
86 3300005333 Ga0070677_10159496 Ga0070677_101594962 224
87 3300005339 Ga0070660_100035626 Ga0070660_1000356264 224
88 3300005344 Ga0070661_100428990 Ga0070661_1004289901 224
89 3300005354 Ga0070675_100140071 Ga0070675_1001400712 224
90 3300005436 Ga0070713_100372062 Ga0070713_1003720622 224
91 3300005458 Ga0070681_10115681 Ga0070681_101156812 224
92 3300005530 Ga0070679_100055123 Ga0070679_1000551232 224
93 3300005535 Ga0070684_100237252 Ga0070684_1002372522 224
94 3300005539 Ga0068853_100067294 Ga0068853_1000672942 224
95 3300005548 Ga0070665_100001302 Ga0070665_1000013025 224
96 3300005563 Ga0068855_100241800 Ga0068855_1002418002 224
97 3300005578 Ga0068854_100451929 Ga0068854_1004519292 224
98 3300005614 Ga0068856_100117989 Ga0068856_1001179892 224
99 3300025261 Ga0209233_1000865 Ga0209233_10008654 224
100 3300025911 Ga0207654_10025193 Ga0207654_100251932 224
101 3300025912 Ga0207707_10093420 Ga0207707_100934202 224
102 3300025913 Ga0207695_10153400 Ga0207695_101534002 224
103 3300025917 Ga0207660_10307488 Ga0207660_103074881 224
104 3300025919 Ga0207657_10042476 Ga0207657_100424764 224
105 3300025920 Ga0207649_10669128 Ga0207649_106691281 224
106 3300025924 Ga0207694_10070248 Ga0207694_100702483 224
107 3300025924 Ga0207694_10094137 Ga0207694_100941372 224
108 3300025924 Ga0207694_10149728 Ga0207694_101497282 224
109 3300025944 Ga0207661_10043740 Ga0207661_100437402 224
110 3300025949 Ga0207667_10507559 Ga0207667_105075592 224
111 3300025949 Ga0207667_11097211 Ga0207667_110972112 224
112 3300025981 Ga0207640_10528349 Ga0207640_105283492 224
113 3300026041 Ga0207639_10987440 Ga0207639_109874401 224
114 3300026078 Ga0207702_10136092 Ga0207702_101360922 224
115 3300028379 Ga0268266_10096756 Ga0268266_100967562 224
116 3300028800 Ga0265338_10028600 Ga0265338_100286004 224
117 3300031235 Ga0265330_10075544 Ga0265330_100755442 224
118 3300031247 Ga0265340_10083995 Ga0265340_100839952 224
119 3300031250 Ga0265331_10061178 Ga0265331_100611782 224
120 3300031344 Ga0265316_10037770 Ga0265316_100377702 224
121 3300031712 Ga0265342_10086554 Ga0265342_100865542 224
122 3300037312 Ga0395899_0106783 Ga0395899_0106783_795_1469 224
123 3300037418 Ga0395900_0029098 Ga0395900_0029098_3150_3824 224
124 3300039437 Ga0436365_0442500 Ga0436365_0442500_1098_1778 224
125 3300049570 Ga0501033_0005496 Ga0501033_0005496_7998_8687 224
126 3300049571 Ga0501034_0233228 Ga0501034_0233228_92_790 224
127 3300049572 Ga0501036_0179938 Ga0501036_0179938_74_772 224
128 3300049573 Ga0501037_0075890 Ga0501037_0075890_1626_2306 224
129 3300049579 Ga0501043_0119867 Ga0501043_0119867_1362_2036 224
130 3300049580 Ga0501046_0005461 Ga0501046_0005461_6379_7077 224
131 3300049581 Ga0501047_0053246 Ga0501047_0053246_1528_2208 224
132 3300049589 Ga0501073_0050987 Ga0501073_0050987_1551_2231 224
133 3300049822 Ga0501035_0112614 Ga0501035_0112614_65_754 224
134 3300049823 Ga0501044_0002877 Ga0501044_0002877_4525_5199 224
135 3300049823 Ga0501044_0015414 Ga0501044_0015414_7395_8075 224
136 3300005335 Ga0070666_10008496 Ga0070666_100084963 225
137 3300005335 Ga0070666_10018216 Ga0070666_100182162 225
138 3300005339 Ga0070660_100005320 Ga0070660_1000053208 225
139 3300005344 Ga0070661_100127291 Ga0070661_1001272913 225
140 3300005367 Ga0070667_100041457 Ga0070667_1000414575 225
141 3300005456 Ga0070678_100148428 Ga0070678_1001484282 225
142 3300005466 Ga0070685_10106146 Ga0070685_101061462 225
143 3300005530 Ga0070679_100022128 Ga0070679_1000221286 225
144 3300005539 Ga0068853_100498957 Ga0068853_1004989572 225
145 3300005548 Ga0070665_100015488 Ga0070665_1000154887 225
146 3300005548 Ga0070665_100037444 Ga0070665_1000374442 225
147 3300005548 Ga0070665_100085989 Ga0070665_1000859892 225
148 3300005563 Ga0068855_101041326 Ga0068855_1010413262 225
149 3300005578 Ga0068854_100967380 Ga0068854_1009673801 225
150 3300005614 Ga0068856_100032512 Ga0068856_1000325126 225
151 3300005842 Ga0068858_100081098 Ga0068858_1000810982 225
152 3300006237 Ga0097621_100000645 Ga0097621_1000006457 225
153 3300006237 Ga0097621_100066057 Ga0097621_1000660572 225
154 3300006237 Ga0097621_100105608 Ga0097621_1001056082 225
155 3300006237 Ga0097621_100204057 Ga0097621_1002040572 225
156 3300006358 Ga0068871_100000378 Ga0068871_1000003782 225
157 3300006881 Ga0068865_100006279 Ga0068865_1000062796 225
158 3300009093 Ga0105240_10077628 Ga0105240_100776285 225
159 3300009174 Ga0105241_10303208 Ga0105241_103032081 225
160 3300009177 Ga0105248_10069938 Ga0105248_100699383 225
161 3300013104 Ga0157370_10248930 Ga0157370_102489302 225
162 3300013296 Ga0157374_10121433 Ga0157374_101214333 225
163 3300013296 Ga0157374_11036560 Ga0157374_110365602 225
164 3300013306 Ga0163162_10323591 Ga0163162_103235912 225
165 3300013307 Ga0157372_10064885 Ga0157372_100648852 225
166 3300013308 Ga0157375_10124763 Ga0157375_101247632 225
167 3300014325 Ga0163163_11126373 Ga0163163_111263732 225
168 3300025903 Ga0207680_10119061 Ga0207680_101190612 225
169 3300025913 Ga0207695_10088933 Ga0207695_100889335 225
170 3300025919 Ga0207657_10367088 Ga0207657_103670881 225
171 3300025920 Ga0207649_10195878 Ga0207649_101958782 225
172 3300025938 Ga0207704_10047856 Ga0207704_100478562 225
173 3300025941 Ga0207711_10033196 Ga0207711_100331963 225
174 3300025942 Ga0207689_10829464 Ga0207689_108294641 225
175 3300025949 Ga0207667_10227659 Ga0207667_102276593 225
176 3300025949 Ga0207667_10741465 Ga0207667_107414652 225
177 3300026067 Ga0207678_10596247 Ga0207678_105962472 225
178 3300026078 Ga0207702_10092109 Ga0207702_100921093 225
179 3300026121 Ga0207683_10009192 Ga0207683_100091927 225
180 3300028379 Ga0268266_10010985 Ga0268266_100109852 225
181 3300028379 Ga0268266_10203367 Ga0268266_102033672 225
182 3300028380 Ga0268265_10297413 Ga0268265_102974132 225
183 3300046459 Ga0495629_0086074 Ga0495629_0086074_776_1453 225
184 3300046539 Ga0495621_0055866 Ga0495621_0055866_424_1116 225
185 3300046557 Ga0495622_0195697 Ga0495622_0195697_43_720 225
186 3300046665 Ga0495661_0109011 Ga0495661_0109011_507_1199 225
187 3300047318 Ga0495636_0076008 Ga0495636_0076008_11_703 225
188 3300049571 Ga0501034_0140168 Ga0501034_0140168_615_1295 225
189 3300049823 Ga0501044_0067288 Ga0501044_0067288_1228_1905 225
190 3300053119 Ga0500595_003175 Ga0500595_003175_2752_3429 225
191 3300053119 Ga0500595_016692 Ga0500595_016692_1896_2573 225
192 3300053136 Ga0500559_0156515 Ga0500559_0156515_185_862 225
193 3300053146 Ga0500588_0162745 Ga0500588_0162745_78_755 225
194 3300005334 Ga0068869_100074355 Ga0068869_1000743552 226
195 3300005354 Ga0070675_100589191 Ga0070675_1005891912 226
196 3300005364 Ga0070673_100043356 Ga0070673_1000433562 226
197 3300005456 Ga0070678_100055604 Ga0070678_1000556042 226
198 3300005543 Ga0070672_100489415 Ga0070672_1004894152 226
199 3300005615 Ga0070702_100127210 Ga0070702_1001272102 226
200 3300006358 Ga0068871_100027530 Ga0068871_1000275302 226
201 3300009098 Ga0105245_10078344 Ga0105245_100783443 226
202 3300009177 Ga0105248_10703864 Ga0105248_107038642 226
203 3300011119 Ga0105246_10074464 Ga0105246_100744642 226
204 3300013306 Ga0163162_10699204 Ga0163162_106992042 226
205 3300014325 Ga0163163_10000012 Ga0163163_1000001297 226
206 3300014968 Ga0157379_10005685 Ga0157379_100056858 226
207 3300014968 Ga0157379_10186146 Ga0157379_101861462 226
208 3300025908 Ga0207643_10122511 Ga0207643_101225112 226
209 3300025926 Ga0207659_10545188 Ga0207659_105451881 226
210 3300025927 Ga0207687_10046119 Ga0207687_100461193 226
211 3300025942 Ga0207689_10805392 Ga0207689_108053922 226
212 3300025960 Ga0207651_10331637 Ga0207651_103316372 226
213 3300026078 Ga0207702_11012775 Ga0207702_110127752 226
214 3300026121 Ga0207683_10005405 Ga0207683_100054057 226
215 3300039438 Ga0436360_0011870 Ga0436360_0011870_205_885 226
216 3300046507 Ga0495606_0276388 Ga0495606_0276388_137_823 226
217 3300049569 Ga0501032_0124039 Ga0501032_0124039_312_992 226
218 3300049570 Ga0501033_0069916 Ga0501033_0069916_686_1366 226
219 3300049570 Ga0501033_0232322 Ga0501033_0232322_483_1169 226
220 3300049574 Ga0501038_0229999 Ga0501038_0229999_418_1098 226
221 3300049581 Ga0501047_0007901 Ga0501047_0007901_5241_5921 226
222 3300049581 Ga0501047_0075430 Ga0501047_0075430_495_1250 226
223 3300049581 Ga0501047_0535093 Ga0501047_0535093_266_946 226
224 3300049822 Ga0501035_0247967 Ga0501035_0247967_53_808 226
225 3300049822 Ga0501035_0365762 Ga0501035_0365762_41_727 226
226 3300049823 Ga0501044_0005632 Ga0501044_0005632_7392_8072 226
227 3300049823 Ga0501044_0347487 Ga0501044_0347487_80_766 226
228 3300053119 Ga0500595_000673 Ga0500595_000673_8266_8961 226
229 3300053140 Ga0500573_0000961 Ga0500573_0000961_10068_10763 226
230 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035124 227
231 3300003215 JGI25153J46596_10000400 JGI25153J46596_1000040031 227
232 3300005335 Ga0070666_10184872 Ga0070666_101848722 227
233 3300005459 Ga0068867_100503000 Ga0068867_1005030001 227
234 3300005937 Ga0081455_10486585 Ga0081455_104865851 227
235 3300006237 Ga0097621_100208883 Ga0097621_1002088832 227
236 3300006358 Ga0068871_100148831 Ga0068871_1001488313 227
237 3300009101 Ga0105247_10210134 Ga0105247_102101342 227
238 3300009174 Ga0105241_10246466 Ga0105241_102464662 227
239 3300009174 Ga0105241_10556573 Ga0105241_105565732 227
240 3300009176 Ga0105242_10036250 Ga0105242_100362502 227
241 3300009177 Ga0105248_10123720 Ga0105248_101237202 227
242 3300009177 Ga0105248_10587720 Ga0105248_105877202 227
243 3300009545 Ga0105237_10490898 Ga0105237_104908982 227
244 3300009545 Ga0105237_10517950 Ga0105237_105179502 227
245 3300010375 Ga0105239_10226765 Ga0105239_102267652 227
246 3300010375 Ga0105239_10540064 Ga0105239_105400642 227
247 3300014325 Ga0163163_10470567 Ga0163163_104705672 227
248 3300014325 Ga0163163_10594883 Ga0163163_105948831 227
249 3300017792 Ga0163161_10121498 Ga0163161_101214983 227
250 3300025231 Ga0207427_103499 Ga0207427_1034993 227
251 3300025261 Ga0209233_1000006 Ga0209233_1000006617 227
252 3300025297 Ga0209758_1000008 Ga0209758_1000008323 227
253 3300025914 Ga0207671_10115307 Ga0207671_101153072 227
254 3300025941 Ga0207711_10234017 Ga0207711_102340172 227
255 3300026118 Ga0207675_100140563 Ga0207675_1001405632 227
256 3300028379 Ga0268266_10011368 Ga0268266_100113683 227
257 3300031730 Ga0307516_10043599 Ga0307516_100435995 227
258 3300048909 Ga0496106_0240349 Ga0496106_0240349_278_985 227
259 3300049580 Ga0501046_0023123 Ga0501046_0023123_2514_3206 227
260 3300049581 Ga0501047_0048409 Ga0501047_0048409_2987_3679 227
261 3300049822 Ga0501035_0057063 Ga0501035_0057063_921_1613 227
262 3300053119 Ga0500595_044973 Ga0500595_044973_574_1275 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

39

217

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.8828 5 201
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.8812 8 202
6gkz-assembly1.cif.gz_D crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8564 58 168
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.856 65 168
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8559 10 206
ID Description Score Start End Superfamily
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9131 40 129 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9085 17 201 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8812 8 202 3.40.50.150
af_A0A2R8RIC7_223_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8474 51 177 3.40.50.150
af_A0A0R0FLN9_30_232_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8444 60 201 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5B9DU91-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9775 19 207 GO:0005829
GO:0070043
AF-A0A7C1TUJ4-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9766 6 208 GO:0005829
GO:0070043
AF-R5QR77-F1-model_v4 deleted 0.9753 9 209
AF-A0A257PGB3-F1-model_v4 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG 0.975 54 206 GO:0005829
GO:0070043
AF-A0A858RAG7-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9744 6 207 GO:0005829
GO:0070043

Feature Viewer

pLDDT pTM Quality
89.84 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map