F371155
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 262 | 161 | 262 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300025942|Ga0207689_10829464|Ga0207689_108294641 |
| Length | 245 |
| Sequence | MAPRRRGASATAGAAKKKTPVPDFGPEDFAAKTGVSRETLARLKAYADVLTDWNARHNLVAKSTLPDLWQRHFWDSAQLTPLIPPTARSLADLGSGAGFPGLVLAAMIPGLAVTLHEATTKKCAFLRMAADRMAMPVAIQNARLEDLSPARFDVVTARALAPLPQLLGYAQNFVGPNSVCLFLKGQNVVAELTEAHKCWNIMASQVPSQTDPSAAIVIVRELGPRHVEPQKTTRPGRRQPKGRRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 61 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 118 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 119 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 120 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 122 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 151 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 152 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 153 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 154 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 155 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 156 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 157 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 158 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 159 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 160 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 161 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.4 |
| Nodule | 0 |
| Rhizoplane | 1.15 |
| Rhizosphere | 88.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 2 | JGI25153J46596_10000400 | 3300003215 | Bacteria | 29140 |
| 3 | Ga0070658_10004966 | 3300005327 | Bacteria | 10840 |
| 4 | Ga0070676_10014055 | 3300005328 | Bacteria | 4393 |
| 5 | Ga0070683_100011798 | 3300005329 | Bacteria | 7569 |
| 6 | Ga0070677_10159496 | 3300005333 | Bacteria | 1057 |
| 7 | Ga0068869_100029640 | 3300005334 | Bacteria | 3836 |
| 8 | Ga0068869_100074355 | 3300005334 | Bacteria | 2522 |
| 9 | Ga0070666_10008496 | 3300005335 | Bacteria | 6379 |
| 10 | Ga0070666_10018216 | 3300005335 | Bacteria | 4512 |
| 11 | Ga0070666_10184872 | 3300005335 | Bacteria | 1463 |
| 12 | Ga0070660_100005320 | 3300005339 | Bacteria | 8907 |
| 13 | Ga0070660_100035626 | 3300005339 | Bacteria | 3768 |
| 14 | Ga0070661_100127291 | 3300005344 | Bacteria | 1911 |
| 15 | Ga0070661_100428990 | 3300005344 | Bacteria | 1049 |
| 16 | Ga0070675_100140071 | 3300005354 | Bacteria | 2067 |
| 17 | Ga0070675_100589191 | 3300005354 | Bacteria | 1008 |
| 18 | Ga0070673_100043356 | 3300005364 | Bacteria | 3476 |
| 19 | Ga0070667_100041457 | 3300005367 | Bacteria | 3862 |
| 20 | Ga0070714_100374570 | 3300005435 | Bacteria | 1341 |
| 21 | Ga0070713_100372062 | 3300005436 | Bacteria | 1330 |
| 22 | Ga0070678_100016278 | 3300005456 | Bacteria | 4752 |
| 23 | Ga0070678_100055604 | 3300005456 | Bacteria | 2890 |
| 24 | Ga0070678_100148428 | 3300005456 | Bacteria | 1885 |
| 25 | Ga0070681_10115681 | 3300005458 | Bacteria | 2620 |
| 26 | Ga0068867_100107903 | 3300005459 | Bacteria | 2134 |
| 27 | Ga0068867_100503000 | 3300005459 | Bacteria | 1042 |
| 28 | Ga0070685_10106146 | 3300005466 | Bacteria | 1723 |
| 29 | Ga0070679_100022128 | 3300005530 | Bacteria | 6211 |
| 30 | Ga0070679_100055123 | 3300005530 | Bacteria | 3959 |
| 31 | Ga0070684_100237252 | 3300005535 | Bacteria | 1666 |
| 32 | Ga0068853_100067294 | 3300005539 | Bacteria | 3112 |
| 33 | Ga0068853_100498957 | 3300005539 | Bacteria | 1149 |
| 34 | Ga0070672_100489415 | 3300005543 | Bacteria | 1063 |
| 35 | Ga0070696_100140295 | 3300005546 | Bacteria | 1766 |
| 36 | Ga0070665_100001302 | 3300005548 | Bacteria | 29816 |
| 37 | Ga0070665_100015488 | 3300005548 | Bacteria | 7661 |
| 38 | Ga0070665_100037444 | 3300005548 | Bacteria | 4879 |
| 39 | Ga0070665_100085989 | 3300005548 | Bacteria | 3150 |
| 40 | Ga0070665_100327291 | 3300005548 | Bacteria | 1537 |
| 41 | Ga0068855_100157706 | 3300005563 | Bacteria | 2578 |
| 42 | Ga0068855_100241800 | 3300005563 | Bacteria | 2017 |
| 43 | Ga0068855_101041326 | 3300005563 | Bacteria | 858 |
| 44 | Ga0068857_100385686 | 3300005577 | Bacteria | 1302 |
| 45 | Ga0068854_100451929 | 3300005578 | Bacteria | 1073 |
| 46 | Ga0068854_100967380 | 3300005578 | Bacteria | 752 |
| 47 | Ga0068856_100032512 | 3300005614 | Bacteria | 5107 |
| 48 | Ga0068856_100117989 | 3300005614 | Bacteria | 2654 |
| 49 | Ga0070702_100127210 | 3300005615 | Bacteria | 1604 |
| 50 | Ga0068866_10580550 | 3300005718 | Bacteria | 754 |
| 51 | Ga0068858_100081098 | 3300005842 | Bacteria | 3015 |
| 52 | Ga0068858_100233350 | 3300005842 | Bacteria | 1744 |
| 53 | Ga0081455_10486585 | 3300005937 | Bacteria | 833 |
| 54 | Ga0070712_100448316 | 3300006175 | Bacteria | 1074 |
| 55 | Ga0097621_100000645 | 3300006237 | Bacteria | 24626 |
| 56 | Ga0097621_100066057 | 3300006237 | Bacteria | 2978 |
| 57 | Ga0097621_100105608 | 3300006237 | Bacteria | 2375 |
| 58 | Ga0097621_100204057 | 3300006237 | Bacteria | 1717 |
| 59 | Ga0097621_100208883 | 3300006237 | Bacteria | 1698 |
| 60 | Ga0068871_100000378 | 3300006358 | Bacteria | 31128 |
| 61 | Ga0068871_100027530 | 3300006358 | Bacteria | 4448 |
| 62 | Ga0068871_100104128 | 3300006358 | Bacteria | 2380 |
| 63 | Ga0068871_100148831 | 3300006358 | Bacteria | 1996 |
| 64 | Ga0075431_100178991 | 3300006847 | Bacteria | 2176 |
| 65 | Ga0068865_100006279 | 3300006881 | Bacteria | 7236 |
| 66 | Ga0105240_10077628 | 3300009093 | Bacteria | 4091 |
| 67 | Ga0105240_10506542 | 3300009093 | Bacteria | 1341 |
| 68 | Ga0111539_10041076 | 3300009094 | Bacteria | 5564 |
| 69 | Ga0105245_10078344 | 3300009098 | Bacteria | 3015 |
| 70 | Ga0105245_10115561 | 3300009098 | Bacteria | 2501 |
| 71 | Ga0105245_11044177 | 3300009098 | Bacteria | 862 |
| 72 | Ga0105247_10210134 | 3300009101 | Bacteria | 1312 |
| 73 | Ga0105243_10234736 | 3300009148 | Bacteria | 1629 |
| 74 | Ga0105241_10246466 | 3300009174 | Bacteria | 1513 |
| 75 | Ga0105241_10303208 | 3300009174 | Bacteria | 1372 |
| 76 | Ga0105241_10556573 | 3300009174 | Bacteria | 1030 |
| 77 | Ga0105242_10036250 | 3300009176 | Bacteria | 3956 |
| 78 | Ga0105248_10069938 | 3300009177 | Bacteria | 3942 |
| 79 | Ga0105248_10123720 | 3300009177 | Bacteria | 2917 |
| 80 | Ga0105248_10587720 | 3300009177 | Bacteria | 1256 |
| 81 | Ga0105248_10703864 | 3300009177 | Bacteria | 1140 |
| 82 | Ga0105237_10490898 | 3300009545 | Bacteria | 1234 |
| 83 | Ga0105237_10517950 | 3300009545 | Bacteria | 1199 |
| 84 | Ga0105238_10492472 | 3300009551 | Bacteria | 1226 |
| 85 | Ga0105249_10045079 | 3300009553 | Bacteria | 4010 |
| 86 | Ga0105239_10226765 | 3300010375 | Bacteria | 2096 |
| 87 | Ga0105239_10471675 | 3300010375 | Bacteria | 1425 |
| 88 | Ga0105239_10540064 | 3300010375 | Bacteria | 1327 |
| 89 | Ga0105246_10074464 | 3300011119 | Bacteria | 2400 |
| 90 | Ga0105246_10596161 | 3300011119 | Bacteria | 954 |
| 91 | Ga0157370_10248930 | 3300013104 | Bacteria | 1644 |
| 92 | Ga0157374_10093368 | 3300013296 | Bacteria | 2873 |
| 93 | Ga0157374_10121433 | 3300013296 | Bacteria | 2522 |
| 94 | Ga0157374_11036560 | 3300013296 | Bacteria | 840 |
| 95 | Ga0163162_10323591 | 3300013306 | Bacteria | 1674 |
| 96 | Ga0163162_10699204 | 3300013306 | Bacteria | 1135 |
| 97 | Ga0157372_10064885 | 3300013307 | Bacteria | 4098 |
| 98 | Ga0157375_10124763 | 3300013308 | Bacteria | 2688 |
| 99 | Ga0163163_10000012 | 3300014325 | Bacteria | 257369 |
| 100 | Ga0163163_10470567 | 3300014325 | Bacteria | 1317 |
| 101 | Ga0163163_10594883 | 3300014325 | Bacteria | 1169 |
| 102 | Ga0163163_11126373 | 3300014325 | Bacteria | 848 |
| 103 | Ga0157379_10005685 | 3300014968 | Bacteria | 10714 |
| 104 | Ga0157379_10186146 | 3300014968 | Bacteria | 1876 |
| 105 | Ga0163161_10121498 | 3300017792 | Bacteria | 1963 |
| 106 | Ga0213874_10003449 | 3300021377 | Bacteria | 3506 |
| 107 | Ga0209563_103628 | 3300025230 | Bacteria | 3142 |
| 108 | Ga0207427_103499 | 3300025231 | Bacteria | 3250 |
| 109 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 110 | Ga0209233_1000865 | 3300025261 | Bacteria | 13360 |
| 111 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 112 | Ga0207642_10017611 | 3300025899 | Bacteria | 2722 |
| 113 | Ga0207680_10119061 | 3300025903 | Bacteria | 1724 |
| 114 | Ga0207645_10031942 | 3300025907 | Bacteria | 3385 |
| 115 | Ga0207643_10122511 | 3300025908 | Bacteria | 1541 |
| 116 | Ga0207705_10291884 | 3300025909 | Bacteria | 1249 |
| 117 | Ga0207654_10025193 | 3300025911 | Bacteria | 3206 |
| 118 | Ga0207707_10093420 | 3300025912 | Bacteria | 2628 |
| 119 | Ga0207695_10088933 | 3300025913 | Bacteria | 3107 |
| 120 | Ga0207695_10091373 | 3300025913 | Bacteria | 3058 |
| 121 | Ga0207695_10153400 | 3300025913 | Bacteria | 2240 |
| 122 | Ga0207671_10115307 | 3300025914 | Bacteria | 2048 |
| 123 | Ga0207660_10307488 | 3300025917 | Bacteria | 1263 |
| 124 | Ga0207657_10042476 | 3300025919 | Bacteria | 4011 |
| 125 | Ga0207657_10367088 | 3300025919 | Bacteria | 1134 |
| 126 | Ga0207649_10195878 | 3300025920 | Bacteria | 1424 |
| 127 | Ga0207649_10669128 | 3300025920 | Bacteria | 803 |
| 128 | Ga0207652_10484828 | 3300025921 | Bacteria | 1113 |
| 129 | Ga0207694_10070248 | 3300025924 | Bacteria | 2736 |
| 130 | Ga0207694_10091735 | 3300025924 | Bacteria | 2397 |
| 131 | Ga0207694_10094137 | 3300025924 | Bacteria | 2367 |
| 132 | Ga0207694_10149728 | 3300025924 | Bacteria | 1879 |
| 133 | Ga0207659_10545188 | 3300025926 | Bacteria | 985 |
| 134 | Ga0207687_10046119 | 3300025927 | Bacteria | 3016 |
| 135 | Ga0207687_10093805 | 3300025927 | Bacteria | 2195 |
| 136 | Ga0207664_10296848 | 3300025929 | Bacteria | 1421 |
| 137 | Ga0207709_10008498 | 3300025935 | Bacteria | 5680 |
| 138 | Ga0207670_10148435 | 3300025936 | Bacteria | 1737 |
| 139 | Ga0207704_10047856 | 3300025938 | Bacteria | 2560 |
| 140 | Ga0207711_10033196 | 3300025941 | Bacteria | 4366 |
| 141 | Ga0207711_10234017 | 3300025941 | Bacteria | 1683 |
| 142 | Ga0207689_10221133 | 3300025942 | Bacteria | 1565 |
| 143 | Ga0207689_10805392 | 3300025942 | Bacteria | 793 |
| 144 | Ga0207689_10829464 | 3300025942 | Bacteria | 780 |
| 145 | Ga0207661_10043740 | 3300025944 | Bacteria | 3536 |
| 146 | Ga0207667_10227659 | 3300025949 | Bacteria | 1910 |
| 147 | Ga0207667_10494228 | 3300025949 | Bacteria | 1241 |
| 148 | Ga0207667_10507559 | 3300025949 | Bacteria | 1223 |
| 149 | Ga0207667_10741465 | 3300025949 | Bacteria | 982 |
| 150 | Ga0207667_11097211 | 3300025949 | Bacteria | 779 |
| 151 | Ga0207651_10331637 | 3300025960 | Bacteria | 1275 |
| 152 | Ga0207712_10012522 | 3300025961 | Bacteria | 5420 |
| 153 | Ga0207640_10528349 | 3300025981 | Bacteria | 987 |
| 154 | Ga0207677_10634772 | 3300026023 | Bacteria | 941 |
| 155 | Ga0207639_10987440 | 3300026041 | Bacteria | 788 |
| 156 | Ga0207678_10596247 | 3300026067 | Bacteria | 968 |
| 157 | Ga0207702_10092109 | 3300026078 | Bacteria | 2656 |
| 158 | Ga0207702_10136092 | 3300026078 | Bacteria | 2217 |
| 159 | Ga0207702_11012775 | 3300026078 | Bacteria | 824 |
| 160 | Ga0207648_10004493 | 3300026089 | Bacteria | 14300 |
| 161 | Ga0207674_10150614 | 3300026116 | Bacteria | 2283 |
| 162 | Ga0207675_100140563 | 3300026118 | Bacteria | 2293 |
| 163 | Ga0207683_10005405 | 3300026121 | Bacteria | 10945 |
| 164 | Ga0207683_10009192 | 3300026121 | Bacteria | 8420 |
| 165 | Ga0207683_10113746 | 3300026121 | Bacteria | 2424 |
| 166 | Ga0268266_10010985 | 3300028379 | Bacteria | 7880 |
| 167 | Ga0268266_10011368 | 3300028379 | Bacteria | 7741 |
| 168 | Ga0268266_10096756 | 3300028379 | Bacteria | 2595 |
| 169 | Ga0268266_10203367 | 3300028379 | Bacteria | 1813 |
| 170 | Ga0268265_10297413 | 3300028380 | Bacteria | 1452 |
| 171 | Ga0265338_10028600 | 3300028800 | Bacteria | 5554 |
| 172 | Ga0265338_10039368 | 3300028800 | Bacteria | 4460 |
| 173 | Ga0265330_10028733 | 3300031235 | Bacteria | 2504 |
| 174 | Ga0265330_10075544 | 3300031235 | Bacteria | 1455 |
| 175 | Ga0265320_10000034 | 3300031240 | Bacteria | 141117 |
| 176 | Ga0265325_10024153 | 3300031241 | Bacteria | 3308 |
| 177 | Ga0265325_10070860 | 3300031241 | Bacteria | 1750 |
| 178 | Ga0265340_10000018 | 3300031247 | Bacteria | 90851 |
| 179 | Ga0265340_10000091 | 3300031247 | Bacteria | 42465 |
| 180 | Ga0265340_10083995 | 3300031247 | Bacteria | 1496 |
| 181 | Ga0265340_10135783 | 3300031247 | Bacteria | 1126 |
| 182 | Ga0265339_10013849 | 3300031249 | Bacteria | 4878 |
| 183 | Ga0265339_10086095 | 3300031249 | Bacteria | 1654 |
| 184 | Ga0265331_10061178 | 3300031250 | Bacteria | 1778 |
| 185 | Ga0265316_10016839 | 3300031344 | Bacteria | 6326 |
| 186 | Ga0265316_10037770 | 3300031344 | Bacteria | 3895 |
| 187 | Ga0265316_10462806 | 3300031344 | Bacteria | 909 |
| 188 | Ga0265313_10023219 | 3300031595 | Bacteria | 3346 |
| 189 | Ga0265313_10128389 | 3300031595 | Bacteria | 1101 |
| 190 | Ga0265314_10002412 | 3300031711 | Bacteria | 19188 |
| 191 | Ga0265314_10012421 | 3300031711 | Bacteria | 6948 |
| 192 | Ga0265314_10048105 | 3300031711 | Bacteria | 2996 |
| 193 | Ga0265342_10002883 | 3300031712 | Bacteria | 14498 |
| 194 | Ga0265342_10004869 | 3300031712 | Bacteria | 10396 |
| 195 | Ga0265342_10086554 | 3300031712 | Bacteria | 1802 |
| 196 | Ga0307516_10043599 | 3300031730 | Bacteria | 4444 |
| 197 | Ga0373925_0115559 | 3300037068 | Bacteria | 2078 |
| 198 | Ga0395899_0106783 | 3300037312 | Bacteria | 2016 |
| 199 | Ga0395900_0029098 | 3300037418 | Bacteria | 5666 |
| 200 | Ga0436365_0442500 | 3300039437 | Bacteria | 2725 |
| 201 | Ga0436360_0011870 | 3300039438 | Bacteria | 1090 |
| 202 | Ga0436363_0025868 | 3300039450 | Bacteria | 14745 |
| 203 | Ga0451791_0226453 | 3300041451 | Bacteria | 1220 |
| 204 | Ga0451800_1244775 | 3300041459 | Bacteria | 764 |
| 205 | Ga0495629_0086074 | 3300046459 | Bacteria | 2193 |
| 206 | Ga0495651_0167717 | 3300046462 | Bacteria | 1567 |
| 207 | Ga0495606_0276388 | 3300046507 | Bacteria | 920 |
| 208 | Ga0495652_0139143 | 3300046529 | Bacteria | 1911 |
| 209 | Ga0495665_0015529 | 3300046531 | Bacteria | 4100 |
| 210 | Ga0495621_0055866 | 3300046539 | Bacteria | 1422 |
| 211 | Ga0495622_0195697 | 3300046557 | Bacteria | 902 |
| 212 | Ga0495667_0263521 | 3300046559 | Bacteria | 1096 |
| 213 | Ga0495625_0207376 | 3300046660 | Bacteria | 1290 |
| 214 | Ga0495661_0109011 | 3300046665 | Bacteria | 1546 |
| 215 | Ga0495581_0342437 | 3300047315 | Bacteria | 873 |
| 216 | Ga0495636_0076008 | 3300047318 | Bacteria | 1440 |
| 217 | Ga0495680_0344340 | 3300047322 | Bacteria | 1039 |
| 218 | Ga0496106_0240349 | 3300048909 | Bacteria | 1447 |
| 219 | Ga0501032_0124039 | 3300049569 | Bacteria | 1707 |
| 220 | Ga0501033_0005496 | 3300049570 | Bacteria | 10035 |
| 221 | Ga0501033_0069916 | 3300049570 | Bacteria | 2579 |
| 222 | Ga0501033_0232322 | 3300049570 | Bacteria | 1310 |
| 223 | Ga0501034_0140168 | 3300049571 | Bacteria | 2398 |
| 224 | Ga0501034_0233228 | 3300049571 | Bacteria | 1789 |
| 225 | Ga0501036_0179938 | 3300049572 | Bacteria | 1780 |
| 226 | Ga0501037_0075890 | 3300049573 | Bacteria | 2441 |
| 227 | Ga0501038_0229999 | 3300049574 | Bacteria | 1476 |
| 228 | Ga0501043_0119867 | 3300049579 | Bacteria | 2063 |
| 229 | Ga0501046_0005461 | 3300049580 | Bacteria | 11367 |
| 230 | Ga0501046_0023123 | 3300049580 | Bacteria | 5118 |
| 231 | Ga0501047_0007901 | 3300049581 | Bacteria | 10028 |
| 232 | Ga0501047_0048409 | 3300049581 | Bacteria | 4105 |
| 233 | Ga0501047_0053246 | 3300049581 | Bacteria | 3912 |
| 234 | Ga0501047_0075430 | 3300049581 | Bacteria | 3245 |
| 235 | Ga0501047_0535093 | 3300049581 | Bacteria | 997 |
| 236 | Ga0501073_0050987 | 3300049589 | Bacteria | 2899 |
| 237 | Ga0501035_0057063 | 3300049822 | Bacteria | 3482 |
| 238 | Ga0501035_0112614 | 3300049822 | Bacteria | 2384 |
| 239 | Ga0501035_0247967 | 3300049822 | Bacteria | 1513 |
| 240 | Ga0501035_0365762 | 3300049822 | Bacteria | 1205 |
| 241 | Ga0501044_0002877 | 3300049823 | Bacteria | 19588 |
| 242 | Ga0501044_0005632 | 3300049823 | Bacteria | 13905 |
| 243 | Ga0501044_0015414 | 3300049823 | Bacteria | 8232 |
| 244 | Ga0501044_0067288 | 3300049823 | Bacteria | 3650 |
| 245 | Ga0501044_0347487 | 3300049823 | Bacteria | 1403 |
| 246 | nmdc:mga06r32_165217_c1 | 3300050510 | Bacteria | 2196 |
| 247 | nmdc:mga08y16_122794_c1 | 3300050511 | Bacteria | 2702 |
| 248 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 249 | Ga0500646_0018885 | 3300053090 | Bacteria | 1819 |
| 250 | Ga0500641_0014919 | 3300053096 | Bacteria | 2874 |
| 251 | Ga0500592_003771 | 3300053116 | Bacteria | 2416 |
| 252 | Ga0500593_014470 | 3300053117 | Bacteria | 3386 |
| 253 | Ga0500595_000673 | 3300053119 | Bacteria | 20517 |
| 254 | Ga0500595_003175 | 3300053119 | Bacteria | 7779 |
| 255 | Ga0500595_016692 | 3300053119 | Bacteria | 2729 |
| 256 | Ga0500595_044973 | 3300053119 | Bacteria | 1397 |
| 257 | Ga0500559_0156515 | 3300053136 | Bacteria | 1070 |
| 258 | Ga0500568_0015926 | 3300053139 | Bacteria | 3354 |
| 259 | Ga0500573_0000961 | 3300053140 | Bacteria | 13173 |
| 260 | Ga0500588_0162745 | 3300053146 | Bacteria | 813 |
| 261 | Ga0500639_130404 | 3300053163 | Bacteria | 1192 |
| 262 | Ga0500645_007365 | 3300053730 | Bacteria | 3841 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10041076 | Ga0111539_100410764 | 185 |
| 2 | 3300041451 | Ga0451791_0226453 | Ga0451791_0226453_492_1145 | 192 |
| 3 | 3300031247 | Ga0265340_10000018 | Ga0265340_1000001814 | 205 |
| 4 | 3300031247 | Ga0265340_10000091 | Ga0265340_1000009144 | 205 |
| 5 | 3300031249 | Ga0265339_10013849 | Ga0265339_100138492 | 205 |
| 6 | 3300031249 | Ga0265339_10086095 | Ga0265339_100860952 | 205 |
| 7 | 3300031344 | Ga0265316_10016839 | Ga0265316_100168393 | 205 |
| 8 | 3300031711 | Ga0265314_10002412 | Ga0265314_100024128 | 205 |
| 9 | 3300031712 | Ga0265342_10002883 | Ga0265342_1000288311 | 205 |
| 10 | 3300006175 | Ga0070712_100448316 | Ga0070712_1004483162 | 206 |
| 11 | 3300013296 | Ga0157374_10093368 | Ga0157374_100933682 | 206 |
| 12 | 3300031344 | Ga0265316_10462806 | Ga0265316_104628062 | 206 |
| 13 | 3300041459 | Ga0451800_1244775 | Ga0451800_1244775_24_644 | 206 |
| 14 | 3300005435 | Ga0070714_100374570 | Ga0070714_1003745702 | 207 |
| 15 | 3300010375 | Ga0105239_10471675 | Ga0105239_104716752 | 207 |
| 16 | 3300025929 | Ga0207664_10296848 | Ga0207664_102968482 | 207 |
| 17 | 3300031235 | Ga0265330_10028733 | Ga0265330_100287333 | 207 |
| 18 | 3300031247 | Ga0265340_10135783 | Ga0265340_101357832 | 207 |
| 19 | 3300031595 | Ga0265313_10023219 | Ga0265313_100232193 | 207 |
| 20 | 3300031711 | Ga0265314_10048105 | Ga0265314_100481054 | 207 |
| 21 | 3300031712 | Ga0265342_10004869 | Ga0265342_100048695 | 207 |
| 22 | 3300046462 | Ga0495651_0167717 | Ga0495651_0167717_586_1230 | 207 |
| 23 | 3300046529 | Ga0495652_0139143 | Ga0495652_0139143_1173_1817 | 207 |
| 24 | 3300046559 | Ga0495667_0263521 | Ga0495667_0263521_207_851 | 207 |
| 25 | 3300047322 | Ga0495680_0344340 | Ga0495680_0344340_11_655 | 207 |
| 26 | 3300005563 | Ga0068855_100157706 | Ga0068855_1001577062 | 210 |
| 27 | 3300025949 | Ga0207667_10494228 | Ga0207667_104942282 | 210 |
| 28 | 3300031240 | Ga0265320_10000034 | Ga0265320_10000034144 | 211 |
| 29 | 3300031241 | Ga0265325_10070860 | Ga0265325_100708602 | 211 |
| 30 | 3300031595 | Ga0265313_10128389 | Ga0265313_101283892 | 211 |
| 31 | 3300031711 | Ga0265314_10012421 | Ga0265314_100124217 | 211 |
| 32 | 3300005328 | Ga0070676_10014055 | Ga0070676_100140553 | 212 |
| 33 | 3300005334 | Ga0068869_100029640 | Ga0068869_1000296404 | 212 |
| 34 | 3300005459 | Ga0068867_100107903 | Ga0068867_1001079032 | 212 |
| 35 | 3300005577 | Ga0068857_100385686 | Ga0068857_1003856862 | 212 |
| 36 | 3300005718 | Ga0068866_10580550 | Ga0068866_105805501 | 212 |
| 37 | 3300009098 | Ga0105245_10115561 | Ga0105245_101155612 | 212 |
| 38 | 3300009148 | Ga0105243_10234736 | Ga0105243_102347362 | 212 |
| 39 | 3300011119 | Ga0105246_10596161 | Ga0105246_105961612 | 212 |
| 40 | 3300025899 | Ga0207642_10017611 | Ga0207642_100176112 | 212 |
| 41 | 3300025907 | Ga0207645_10031942 | Ga0207645_100319423 | 212 |
| 42 | 3300025927 | Ga0207687_10093805 | Ga0207687_100938053 | 212 |
| 43 | 3300025935 | Ga0207709_10008498 | Ga0207709_100084986 | 212 |
| 44 | 3300025936 | Ga0207670_10148435 | Ga0207670_101484353 | 212 |
| 45 | 3300025942 | Ga0207689_10221133 | Ga0207689_102211332 | 212 |
| 46 | 3300026023 | Ga0207677_10634772 | Ga0207677_106347722 | 212 |
| 47 | 3300026089 | Ga0207648_10004493 | Ga0207648_100044936 | 212 |
| 48 | 3300026116 | Ga0207674_10150614 | Ga0207674_101506142 | 212 |
| 49 | 3300031241 | Ga0265325_10024153 | Ga0265325_100241532 | 213 |
| 50 | 3300005546 | Ga0070696_100140295 | Ga0070696_1001402952 | 214 |
| 51 | 3300006847 | Ga0075431_100178991 | Ga0075431_1001789912 | 214 |
| 52 | 3300009551 | Ga0105238_10492472 | Ga0105238_104924722 | 214 |
| 53 | 3300025924 | Ga0207694_10091735 | Ga0207694_100917353 | 214 |
| 54 | 3300037068 | Ga0373925_0115559 | Ga0373925_0115559_609_1271 | 214 |
| 55 | 3300046531 | Ga0495665_0015529 | Ga0495665_0015529_698_1360 | 214 |
| 56 | 3300047315 | Ga0495581_0342437 | Ga0495581_0342437_77_739 | 214 |
| 57 | 3300050510 | nmdc:mga06r32_165217_c1 | nmdc:mga06r32_165217_c1_906_1580 | 214 |
| 58 | 3300050511 | nmdc:mga08y16_122794_c1 | nmdc:mga08y16_122794_c1_1102_1776 | 214 |
| 59 | 3300006358 | Ga0068871_100104128 | Ga0068871_1001041283 | 216 |
| 60 | 3300009098 | Ga0105245_11044177 | Ga0105245_110441772 | 216 |
| 61 | 3300028800 | Ga0265338_10039368 | Ga0265338_100393686 | 216 |
| 62 | 3300009093 | Ga0105240_10506542 | Ga0105240_105065422 | 218 |
| 63 | 3300021377 | Ga0213874_10003449 | Ga0213874_100034494 | 218 |
| 64 | 3300025913 | Ga0207695_10091373 | Ga0207695_100913733 | 218 |
| 65 | 3300039450 | Ga0436363_0025868 | Ga0436363_0025868_8374_9033 | 218 |
| 66 | 3300005456 | Ga0070678_100016278 | Ga0070678_1000162782 | 222 |
| 67 | 3300005548 | Ga0070665_100327291 | Ga0070665_1003272911 | 222 |
| 68 | 3300005842 | Ga0068858_100233350 | Ga0068858_1002333502 | 222 |
| 69 | 3300009553 | Ga0105249_10045079 | Ga0105249_100450792 | 222 |
| 70 | 3300025230 | Ga0209563_103628 | Ga0209563_1036282 | 222 |
| 71 | 3300025909 | Ga0207705_10291884 | Ga0207705_102918842 | 222 |
| 72 | 3300025921 | Ga0207652_10484828 | Ga0207652_104848282 | 222 |
| 73 | 3300025961 | Ga0207712_10012522 | Ga0207712_100125227 | 222 |
| 74 | 3300026121 | Ga0207683_10113746 | Ga0207683_101137462 | 222 |
| 75 | 3300046660 | Ga0495625_0207376 | Ga0495625_0207376_293_961 | 222 |
| 76 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_22653_23321 | 222 |
| 77 | 3300053090 | Ga0500646_0018885 | Ga0500646_0018885_333_1028 | 222 |
| 78 | 3300053116 | Ga0500592_003771 | Ga0500592_003771_443_1111 | 222 |
| 79 | 3300053117 | Ga0500593_014470 | Ga0500593_014470_1522_2190 | 222 |
| 80 | 3300053139 | Ga0500568_0015926 | Ga0500568_0015926_1008_1676 | 222 |
| 81 | 3300053163 | Ga0500639_130404 | Ga0500639_130404_113_787 | 222 |
| 82 | 3300053730 | Ga0500645_007365 | Ga0500645_007365_1205_1873 | 222 |
| 83 | 3300053096 | Ga0500641_0014919 | Ga0500641_0014919_2030_2701 | 223 |
| 84 | 3300005327 | Ga0070658_10004966 | Ga0070658_100049669 | 224 |
| 85 | 3300005329 | Ga0070683_100011798 | Ga0070683_1000117986 | 224 |
| 86 | 3300005333 | Ga0070677_10159496 | Ga0070677_101594962 | 224 |
| 87 | 3300005339 | Ga0070660_100035626 | Ga0070660_1000356264 | 224 |
| 88 | 3300005344 | Ga0070661_100428990 | Ga0070661_1004289901 | 224 |
| 89 | 3300005354 | Ga0070675_100140071 | Ga0070675_1001400712 | 224 |
| 90 | 3300005436 | Ga0070713_100372062 | Ga0070713_1003720622 | 224 |
| 91 | 3300005458 | Ga0070681_10115681 | Ga0070681_101156812 | 224 |
| 92 | 3300005530 | Ga0070679_100055123 | Ga0070679_1000551232 | 224 |
| 93 | 3300005535 | Ga0070684_100237252 | Ga0070684_1002372522 | 224 |
| 94 | 3300005539 | Ga0068853_100067294 | Ga0068853_1000672942 | 224 |
| 95 | 3300005548 | Ga0070665_100001302 | Ga0070665_1000013025 | 224 |
| 96 | 3300005563 | Ga0068855_100241800 | Ga0068855_1002418002 | 224 |
| 97 | 3300005578 | Ga0068854_100451929 | Ga0068854_1004519292 | 224 |
| 98 | 3300005614 | Ga0068856_100117989 | Ga0068856_1001179892 | 224 |
| 99 | 3300025261 | Ga0209233_1000865 | Ga0209233_10008654 | 224 |
| 100 | 3300025911 | Ga0207654_10025193 | Ga0207654_100251932 | 224 |
| 101 | 3300025912 | Ga0207707_10093420 | Ga0207707_100934202 | 224 |
| 102 | 3300025913 | Ga0207695_10153400 | Ga0207695_101534002 | 224 |
| 103 | 3300025917 | Ga0207660_10307488 | Ga0207660_103074881 | 224 |
| 104 | 3300025919 | Ga0207657_10042476 | Ga0207657_100424764 | 224 |
| 105 | 3300025920 | Ga0207649_10669128 | Ga0207649_106691281 | 224 |
| 106 | 3300025924 | Ga0207694_10070248 | Ga0207694_100702483 | 224 |
| 107 | 3300025924 | Ga0207694_10094137 | Ga0207694_100941372 | 224 |
| 108 | 3300025924 | Ga0207694_10149728 | Ga0207694_101497282 | 224 |
| 109 | 3300025944 | Ga0207661_10043740 | Ga0207661_100437402 | 224 |
| 110 | 3300025949 | Ga0207667_10507559 | Ga0207667_105075592 | 224 |
| 111 | 3300025949 | Ga0207667_11097211 | Ga0207667_110972112 | 224 |
| 112 | 3300025981 | Ga0207640_10528349 | Ga0207640_105283492 | 224 |
| 113 | 3300026041 | Ga0207639_10987440 | Ga0207639_109874401 | 224 |
| 114 | 3300026078 | Ga0207702_10136092 | Ga0207702_101360922 | 224 |
| 115 | 3300028379 | Ga0268266_10096756 | Ga0268266_100967562 | 224 |
| 116 | 3300028800 | Ga0265338_10028600 | Ga0265338_100286004 | 224 |
| 117 | 3300031235 | Ga0265330_10075544 | Ga0265330_100755442 | 224 |
| 118 | 3300031247 | Ga0265340_10083995 | Ga0265340_100839952 | 224 |
| 119 | 3300031250 | Ga0265331_10061178 | Ga0265331_100611782 | 224 |
| 120 | 3300031344 | Ga0265316_10037770 | Ga0265316_100377702 | 224 |
| 121 | 3300031712 | Ga0265342_10086554 | Ga0265342_100865542 | 224 |
| 122 | 3300037312 | Ga0395899_0106783 | Ga0395899_0106783_795_1469 | 224 |
| 123 | 3300037418 | Ga0395900_0029098 | Ga0395900_0029098_3150_3824 | 224 |
| 124 | 3300039437 | Ga0436365_0442500 | Ga0436365_0442500_1098_1778 | 224 |
| 125 | 3300049570 | Ga0501033_0005496 | Ga0501033_0005496_7998_8687 | 224 |
| 126 | 3300049571 | Ga0501034_0233228 | Ga0501034_0233228_92_790 | 224 |
| 127 | 3300049572 | Ga0501036_0179938 | Ga0501036_0179938_74_772 | 224 |
| 128 | 3300049573 | Ga0501037_0075890 | Ga0501037_0075890_1626_2306 | 224 |
| 129 | 3300049579 | Ga0501043_0119867 | Ga0501043_0119867_1362_2036 | 224 |
| 130 | 3300049580 | Ga0501046_0005461 | Ga0501046_0005461_6379_7077 | 224 |
| 131 | 3300049581 | Ga0501047_0053246 | Ga0501047_0053246_1528_2208 | 224 |
| 132 | 3300049589 | Ga0501073_0050987 | Ga0501073_0050987_1551_2231 | 224 |
| 133 | 3300049822 | Ga0501035_0112614 | Ga0501035_0112614_65_754 | 224 |
| 134 | 3300049823 | Ga0501044_0002877 | Ga0501044_0002877_4525_5199 | 224 |
| 135 | 3300049823 | Ga0501044_0015414 | Ga0501044_0015414_7395_8075 | 224 |
| 136 | 3300005335 | Ga0070666_10008496 | Ga0070666_100084963 | 225 |
| 137 | 3300005335 | Ga0070666_10018216 | Ga0070666_100182162 | 225 |
| 138 | 3300005339 | Ga0070660_100005320 | Ga0070660_1000053208 | 225 |
| 139 | 3300005344 | Ga0070661_100127291 | Ga0070661_1001272913 | 225 |
| 140 | 3300005367 | Ga0070667_100041457 | Ga0070667_1000414575 | 225 |
| 141 | 3300005456 | Ga0070678_100148428 | Ga0070678_1001484282 | 225 |
| 142 | 3300005466 | Ga0070685_10106146 | Ga0070685_101061462 | 225 |
| 143 | 3300005530 | Ga0070679_100022128 | Ga0070679_1000221286 | 225 |
| 144 | 3300005539 | Ga0068853_100498957 | Ga0068853_1004989572 | 225 |
| 145 | 3300005548 | Ga0070665_100015488 | Ga0070665_1000154887 | 225 |
| 146 | 3300005548 | Ga0070665_100037444 | Ga0070665_1000374442 | 225 |
| 147 | 3300005548 | Ga0070665_100085989 | Ga0070665_1000859892 | 225 |
| 148 | 3300005563 | Ga0068855_101041326 | Ga0068855_1010413262 | 225 |
| 149 | 3300005578 | Ga0068854_100967380 | Ga0068854_1009673801 | 225 |
| 150 | 3300005614 | Ga0068856_100032512 | Ga0068856_1000325126 | 225 |
| 151 | 3300005842 | Ga0068858_100081098 | Ga0068858_1000810982 | 225 |
| 152 | 3300006237 | Ga0097621_100000645 | Ga0097621_1000006457 | 225 |
| 153 | 3300006237 | Ga0097621_100066057 | Ga0097621_1000660572 | 225 |
| 154 | 3300006237 | Ga0097621_100105608 | Ga0097621_1001056082 | 225 |
| 155 | 3300006237 | Ga0097621_100204057 | Ga0097621_1002040572 | 225 |
| 156 | 3300006358 | Ga0068871_100000378 | Ga0068871_1000003782 | 225 |
| 157 | 3300006881 | Ga0068865_100006279 | Ga0068865_1000062796 | 225 |
| 158 | 3300009093 | Ga0105240_10077628 | Ga0105240_100776285 | 225 |
| 159 | 3300009174 | Ga0105241_10303208 | Ga0105241_103032081 | 225 |
| 160 | 3300009177 | Ga0105248_10069938 | Ga0105248_100699383 | 225 |
| 161 | 3300013104 | Ga0157370_10248930 | Ga0157370_102489302 | 225 |
| 162 | 3300013296 | Ga0157374_10121433 | Ga0157374_101214333 | 225 |
| 163 | 3300013296 | Ga0157374_11036560 | Ga0157374_110365602 | 225 |
| 164 | 3300013306 | Ga0163162_10323591 | Ga0163162_103235912 | 225 |
| 165 | 3300013307 | Ga0157372_10064885 | Ga0157372_100648852 | 225 |
| 166 | 3300013308 | Ga0157375_10124763 | Ga0157375_101247632 | 225 |
| 167 | 3300014325 | Ga0163163_11126373 | Ga0163163_111263732 | 225 |
| 168 | 3300025903 | Ga0207680_10119061 | Ga0207680_101190612 | 225 |
| 169 | 3300025913 | Ga0207695_10088933 | Ga0207695_100889335 | 225 |
| 170 | 3300025919 | Ga0207657_10367088 | Ga0207657_103670881 | 225 |
| 171 | 3300025920 | Ga0207649_10195878 | Ga0207649_101958782 | 225 |
| 172 | 3300025938 | Ga0207704_10047856 | Ga0207704_100478562 | 225 |
| 173 | 3300025941 | Ga0207711_10033196 | Ga0207711_100331963 | 225 |
| 174 | 3300025942 | Ga0207689_10829464 | Ga0207689_108294641 | 225 |
| 175 | 3300025949 | Ga0207667_10227659 | Ga0207667_102276593 | 225 |
| 176 | 3300025949 | Ga0207667_10741465 | Ga0207667_107414652 | 225 |
| 177 | 3300026067 | Ga0207678_10596247 | Ga0207678_105962472 | 225 |
| 178 | 3300026078 | Ga0207702_10092109 | Ga0207702_100921093 | 225 |
| 179 | 3300026121 | Ga0207683_10009192 | Ga0207683_100091927 | 225 |
| 180 | 3300028379 | Ga0268266_10010985 | Ga0268266_100109852 | 225 |
| 181 | 3300028379 | Ga0268266_10203367 | Ga0268266_102033672 | 225 |
| 182 | 3300028380 | Ga0268265_10297413 | Ga0268265_102974132 | 225 |
| 183 | 3300046459 | Ga0495629_0086074 | Ga0495629_0086074_776_1453 | 225 |
| 184 | 3300046539 | Ga0495621_0055866 | Ga0495621_0055866_424_1116 | 225 |
| 185 | 3300046557 | Ga0495622_0195697 | Ga0495622_0195697_43_720 | 225 |
| 186 | 3300046665 | Ga0495661_0109011 | Ga0495661_0109011_507_1199 | 225 |
| 187 | 3300047318 | Ga0495636_0076008 | Ga0495636_0076008_11_703 | 225 |
| 188 | 3300049571 | Ga0501034_0140168 | Ga0501034_0140168_615_1295 | 225 |
| 189 | 3300049823 | Ga0501044_0067288 | Ga0501044_0067288_1228_1905 | 225 |
| 190 | 3300053119 | Ga0500595_003175 | Ga0500595_003175_2752_3429 | 225 |
| 191 | 3300053119 | Ga0500595_016692 | Ga0500595_016692_1896_2573 | 225 |
| 192 | 3300053136 | Ga0500559_0156515 | Ga0500559_0156515_185_862 | 225 |
| 193 | 3300053146 | Ga0500588_0162745 | Ga0500588_0162745_78_755 | 225 |
| 194 | 3300005334 | Ga0068869_100074355 | Ga0068869_1000743552 | 226 |
| 195 | 3300005354 | Ga0070675_100589191 | Ga0070675_1005891912 | 226 |
| 196 | 3300005364 | Ga0070673_100043356 | Ga0070673_1000433562 | 226 |
| 197 | 3300005456 | Ga0070678_100055604 | Ga0070678_1000556042 | 226 |
| 198 | 3300005543 | Ga0070672_100489415 | Ga0070672_1004894152 | 226 |
| 199 | 3300005615 | Ga0070702_100127210 | Ga0070702_1001272102 | 226 |
| 200 | 3300006358 | Ga0068871_100027530 | Ga0068871_1000275302 | 226 |
| 201 | 3300009098 | Ga0105245_10078344 | Ga0105245_100783443 | 226 |
| 202 | 3300009177 | Ga0105248_10703864 | Ga0105248_107038642 | 226 |
| 203 | 3300011119 | Ga0105246_10074464 | Ga0105246_100744642 | 226 |
| 204 | 3300013306 | Ga0163162_10699204 | Ga0163162_106992042 | 226 |
| 205 | 3300014325 | Ga0163163_10000012 | Ga0163163_1000001297 | 226 |
| 206 | 3300014968 | Ga0157379_10005685 | Ga0157379_100056858 | 226 |
| 207 | 3300014968 | Ga0157379_10186146 | Ga0157379_101861462 | 226 |
| 208 | 3300025908 | Ga0207643_10122511 | Ga0207643_101225112 | 226 |
| 209 | 3300025926 | Ga0207659_10545188 | Ga0207659_105451881 | 226 |
| 210 | 3300025927 | Ga0207687_10046119 | Ga0207687_100461193 | 226 |
| 211 | 3300025942 | Ga0207689_10805392 | Ga0207689_108053922 | 226 |
| 212 | 3300025960 | Ga0207651_10331637 | Ga0207651_103316372 | 226 |
| 213 | 3300026078 | Ga0207702_11012775 | Ga0207702_110127752 | 226 |
| 214 | 3300026121 | Ga0207683_10005405 | Ga0207683_100054057 | 226 |
| 215 | 3300039438 | Ga0436360_0011870 | Ga0436360_0011870_205_885 | 226 |
| 216 | 3300046507 | Ga0495606_0276388 | Ga0495606_0276388_137_823 | 226 |
| 217 | 3300049569 | Ga0501032_0124039 | Ga0501032_0124039_312_992 | 226 |
| 218 | 3300049570 | Ga0501033_0069916 | Ga0501033_0069916_686_1366 | 226 |
| 219 | 3300049570 | Ga0501033_0232322 | Ga0501033_0232322_483_1169 | 226 |
| 220 | 3300049574 | Ga0501038_0229999 | Ga0501038_0229999_418_1098 | 226 |
| 221 | 3300049581 | Ga0501047_0007901 | Ga0501047_0007901_5241_5921 | 226 |
| 222 | 3300049581 | Ga0501047_0075430 | Ga0501047_0075430_495_1250 | 226 |
| 223 | 3300049581 | Ga0501047_0535093 | Ga0501047_0535093_266_946 | 226 |
| 224 | 3300049822 | Ga0501035_0247967 | Ga0501035_0247967_53_808 | 226 |
| 225 | 3300049822 | Ga0501035_0365762 | Ga0501035_0365762_41_727 | 226 |
| 226 | 3300049823 | Ga0501044_0005632 | Ga0501044_0005632_7392_8072 | 226 |
| 227 | 3300049823 | Ga0501044_0347487 | Ga0501044_0347487_80_766 | 226 |
| 228 | 3300053119 | Ga0500595_000673 | Ga0500595_000673_8266_8961 | 226 |
| 229 | 3300053140 | Ga0500573_0000961 | Ga0500573_0000961_10068_10763 | 226 |
| 230 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_1000035124 | 227 |
| 231 | 3300003215 | JGI25153J46596_10000400 | JGI25153J46596_1000040031 | 227 |
| 232 | 3300005335 | Ga0070666_10184872 | Ga0070666_101848722 | 227 |
| 233 | 3300005459 | Ga0068867_100503000 | Ga0068867_1005030001 | 227 |
| 234 | 3300005937 | Ga0081455_10486585 | Ga0081455_104865851 | 227 |
| 235 | 3300006237 | Ga0097621_100208883 | Ga0097621_1002088832 | 227 |
| 236 | 3300006358 | Ga0068871_100148831 | Ga0068871_1001488313 | 227 |
| 237 | 3300009101 | Ga0105247_10210134 | Ga0105247_102101342 | 227 |
| 238 | 3300009174 | Ga0105241_10246466 | Ga0105241_102464662 | 227 |
| 239 | 3300009174 | Ga0105241_10556573 | Ga0105241_105565732 | 227 |
| 240 | 3300009176 | Ga0105242_10036250 | Ga0105242_100362502 | 227 |
| 241 | 3300009177 | Ga0105248_10123720 | Ga0105248_101237202 | 227 |
| 242 | 3300009177 | Ga0105248_10587720 | Ga0105248_105877202 | 227 |
| 243 | 3300009545 | Ga0105237_10490898 | Ga0105237_104908982 | 227 |
| 244 | 3300009545 | Ga0105237_10517950 | Ga0105237_105179502 | 227 |
| 245 | 3300010375 | Ga0105239_10226765 | Ga0105239_102267652 | 227 |
| 246 | 3300010375 | Ga0105239_10540064 | Ga0105239_105400642 | 227 |
| 247 | 3300014325 | Ga0163163_10470567 | Ga0163163_104705672 | 227 |
| 248 | 3300014325 | Ga0163163_10594883 | Ga0163163_105948831 | 227 |
| 249 | 3300017792 | Ga0163161_10121498 | Ga0163161_101214983 | 227 |
| 250 | 3300025231 | Ga0207427_103499 | Ga0207427_1034993 | 227 |
| 251 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006617 | 227 |
| 252 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008323 | 227 |
| 253 | 3300025914 | Ga0207671_10115307 | Ga0207671_101153072 | 227 |
| 254 | 3300025941 | Ga0207711_10234017 | Ga0207711_102340172 | 227 |
| 255 | 3300026118 | Ga0207675_100140563 | Ga0207675_1001405632 | 227 |
| 256 | 3300028379 | Ga0268266_10011368 | Ga0268266_100113683 | 227 |
| 257 | 3300031730 | Ga0307516_10043599 | Ga0307516_100435995 | 227 |
| 258 | 3300048909 | Ga0496106_0240349 | Ga0496106_0240349_278_985 | 227 |
| 259 | 3300049580 | Ga0501046_0023123 | Ga0501046_0023123_2514_3206 | 227 |
| 260 | 3300049581 | Ga0501047_0048409 | Ga0501047_0048409_2987_3679 | 227 |
| 261 | 3300049822 | Ga0501035_0057063 | Ga0501035_0057063_921_1613 | 227 |
| 262 | 3300053119 | Ga0500595_044973 | Ga0500595_044973_574_1275 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdz-assembly1.cif.gz_A | crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg | 0.8828 | 5 | 201 |
| 1jsx-assembly1.cif.gz_A | crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) | 0.8812 | 8 | 202 |
| 6gkz-assembly1.cif.gz_D | crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah | 0.8564 | 58 | 168 |
| 3mgg-assembly1.cif.gz_A | crystal structure of methyl transferase from methanosarcina mazei | 0.856 | 65 | 168 |
| 3g8b-assembly1.cif.gz_A | t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 | 0.8559 | 10 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q67VB2_1_103_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9131 | 40 | 129 | 3.40.50.150 |
| af_I1JZW8_31_274_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9085 | 17 | 201 | 3.40.50.150 |
| 1jsxA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8812 | 8 | 202 | 3.40.50.150 |
| af_A0A2R8RIC7_223_404_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8474 | 51 | 177 | 3.40.50.150 |
| af_A0A0R0FLN9_30_232_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8444 | 60 | 201 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B9DU91-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.9775 | 19 | 207 |
GO:0005829
GO:0070043 |
| AF-A0A7C1TUJ4-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.9766 | 6 | 208 |
GO:0005829
GO:0070043 |
| AF-R5QR77-F1-model_v4 | deleted | 0.9753 | 9 | 209 |
|
| AF-A0A257PGB3-F1-model_v4 | 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG | 0.975 | 54 | 206 |
GO:0005829
GO:0070043 |
| AF-A0A858RAG7-F1-model_v4 | Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) | 0.9744 | 6 | 207 |
GO:0005829
GO:0070043 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar