F371096

General Info

Members Datasets Scaffolds Average Seq Length
262 154 524 119

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10637051|Ga0157375_106370512
Length 119
Sequence MPFTALDAEDIEPTWGTFRMVRHALGGTAFGLNQIDFPPGKVGPEHDELESGQEEIYYCISGSGTLTIDGEAVALRPGRYVLVSADAKRHPEAGPNGLSFIGVGGVPGGVYEPWAPPEE

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 16.41
Rhizosphere 79.01
Stem 0
Stem Tuber 0
Unclassified 14.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10637051 3300013308 Bacteria 1223
2 Ga0068869_100135315 3300005334 Bacteria 1898
3 Ga0070680_100118858 3300005336 Bacteria 2205
4 Ga0070682_100024526 3300005337 Bacteria 3590
5 Ga0068868_100980895 3300005338 Bacteria 772
6 Ga0070674_100167350 3300005356 Bacteria 1673
7 Ga0070674_100278826 3300005356 Bacteria 1324
8 Ga0070667_100898993 3300005367 Bacteria 824
9 Ga0070714_100443939 3300005435 Bacteria 1232
10 Ga0070714_100681654 3300005435 Bacteria 991
11 Ga0070714_101167527 3300005435 Bacteria 751
12 Ga0070713_100076948 3300005436 Bacteria 2836
13 Ga0070713_101174308 3300005436 Bacteria 743
14 Ga0070710_11148178 3300005437 Unclassified 572
15 Ga0070710_11258070 3300005437 Bacteria 549
16 Ga0070700_100831532 3300005441 Bacteria 746
17 Ga0070694_101884895 3300005444 Unclassified 510
18 Ga0070678_100010036 3300005456 Bacteria 5764
19 Ga0070681_10047786 3300005458 Bacteria 4278
20 Ga0070681_10868597 3300005458 Bacteria 820
21 Ga0070706_100334209 3300005467 Bacteria 1413
22 Ga0070679_100108493 3300005530 Bacteria 2762
23 Ga0070679_100239027 3300005530 Bacteria 1774
24 Ga0070684_100004813 3300005535 Bacteria 10317
25 Ga0070684_100351859 3300005535 Bacteria 1355
26 Ga0070696_100107207 3300005546 Bacteria 2009
27 Ga0070693_100009810 3300005547 Bacteria 4775
28 Ga0070664_101242624 3300005564 Bacteria 703
29 Ga0068854_100612266 3300005578 Unclassified 931
30 Ga0068854_101694781 3300005578 Unclassified 578
31 Ga0068856_100064671 3300005614 Bacteria 3614
32 Ga0068856_100119629 3300005614 Bacteria 2635
33 Ga0068856_100388734 3300005614 Bacteria 1415
34 Ga0070702_100591700 3300005615 Unclassified 830
35 Ga0068858_101599206 3300005842 Bacteria 643
36 Ga0081455_10003479 3300005937 Bacteria 18088
37 Ga0070717_10117814 3300006028 Bacteria 2272
38 Ga0070717_10166457 3300006028 Bacteria 1915
39 Ga0070717_10505854 3300006028 Unclassified 1092
40 Ga0070717_11186342 3300006028 Bacteria 695
41 Ga0070712_100103522 3300006175 Bacteria 2111
42 Ga0070712_102035319 3300006175 Unclassified 503
43 Ga0097621_100276693 3300006237 Bacteria 1477
44 Ga0068871_101662640 3300006358 Unclassified 605
45 Ga0075433_10137447 3300006852 Bacteria 2172
46 Ga0068865_101095243 3300006881 Bacteria 701
47 Ga0105240_12592652 3300009093 Unclassified 524
48 Ga0105245_10007430 3300009098 Bacteria 9596
49 Ga0105245_10308874 3300009098 Bacteria 1554
50 Ga0105245_10503412 3300009098 Bacteria 1228
51 Ga0105242_13113543 3300009176 Unclassified 514
52 Ga0105248_10816239 3300009177 Bacteria 1053
53 Ga0105237_10685418 3300009545 Bacteria 1031
54 Ga0105249_10391236 3300009553 Bacteria 1418
55 Ga0105249_10564153 3300009553 Bacteria 1190
56 Ga0105239_10107162 3300010375 Bacteria 3096
57 Ga0105239_10517795 3300010375 Bacteria 1357
58 Ga0105246_10191267 3300011119 Bacteria 1584
59 Ga0105246_11055013 3300011119 Unclassified 739
60 Ga0157374_12934668 3300013296 Unclassified 504
61 Ga0157375_10652642 3300013308 Unclassified 1208
62 Ga0157375_10714993 3300013308 Bacteria 1155
63 Ga0157375_11184215 3300013308 Bacteria 896
64 Ga0163163_10238314 3300014325 Bacteria 1869
65 Ga0163163_11523998 3300014325 Bacteria 730
66 Ga0157377_10166397 3300014745 Bacteria 1375
67 Ga0157377_10612098 3300014745 Unclassified 779
68 Ga0157376_10177790 3300014969 Bacteria 1943
69 Ga0213876_10003139 3300021384 Bacteria 9536
70 Ga0213875_10000837 3300021388 Bacteria 22838
71 Ga0213875_10020079 3300021388 Bacteria 3207
72 Ga0213875_10261949 3300021388 Bacteria 816
73 Ga0207643_10047450 3300025908 Bacteria 2430
74 Ga0207707_10069196 3300025912 Bacteria 3076
75 Ga0207707_10516527 3300025912 Bacteria 1017
76 Ga0207693_10179956 3300025915 Bacteria 1663
77 Ga0207663_10734886 3300025916 Bacteria 783
78 Ga0207660_10062988 3300025917 Bacteria 2673
79 Ga0207657_10083611 3300025919 Bacteria 2678
80 Ga0207652_10045446 3300025921 Bacteria 3744
81 Ga0207694_10117088 3300025924 Bacteria 2124
82 Ga0207687_10018992 3300025927 Bacteria 4547
83 Ga0207687_10037099 3300025927 Bacteria 3323
84 Ga0207687_10415481 3300025927 Bacteria 1109
85 Ga0207700_10641711 3300025928 Bacteria 946
86 Ga0207664_10294459 3300025929 Bacteria 1427
87 Ga0207664_10655091 3300025929 Bacteria 944
88 Ga0207664_11100418 3300025929 Bacteria 710
89 Ga0207664_11152747 3300025929 Bacteria 692
90 Ga0207664_11653067 3300025929 Unclassified 563
91 Ga0207664_11878555 3300025929 Bacteria 521
92 Ga0207669_10106049 3300025937 Bacteria 1871
93 Ga0207704_11197083 3300025938 Bacteria 648
94 Ga0207661_10058081 3300025944 Bacteria 3113
95 Ga0207679_10218635 3300025945 Bacteria 1602
96 Ga0207679_10422271 3300025945 Bacteria 1177
97 Ga0207667_12138979 3300025949 Bacteria 518
98 Ga0207651_10684035 3300025960 Bacteria 903
99 Ga0207712_10911702 3300025961 Unclassified 777
100 Ga0207668_11178970 3300025972 Bacteria 688
101 Ga0207640_10462741 3300025981 Unclassified 1048
102 Ga0207640_11629928 3300025981 Unclassified 582
103 Ga0207658_10335531 3300025986 Bacteria 1313
104 Ga0207677_10980190 3300026023 Bacteria 766
105 Ga0207703_11818330 3300026035 Bacteria 585
106 Ga0207702_10216056 3300026078 Bacteria 1785
107 Ga0207702_10438662 3300026078 Bacteria 1265
108 Ga0207675_100490231 3300026118 Bacteria 1222
109 Ga0207683_10017315 3300026121 Bacteria 6140
110 Ga0207683_10446395 3300026121 Bacteria 1192
111 Ga0207683_10470592 3300026121 Bacteria 1159
112 Ga0265337_1063478 3300028556 Bacteria 1021
113 Ga0265334_10153009 3300028573 Unclassified 813
114 Ga0265318_10001748 3300028577 Bacteria 12396
115 Ga0265318_10045007 3300028577 Bacteria 1669
116 Ga0265318_10197977 3300028577 Unclassified 735
117 Ga0265338_10016119 3300028800 Bacteria 8152
118 Ga0265338_10048366 3300028800 Bacteria 3869
119 Ga0265330_10043007 3300031235 Bacteria 2000
120 Ga0265328_10055821 3300031239 Bacteria 1450
121 Ga0265320_10050742 3300031240 Bacteria 2015
122 Ga0265320_10218883 3300031240 Bacteria 848
123 Ga0265340_10059113 3300031247 Unclassified 1839
124 Ga0265327_10024030 3300031251 Bacteria 3590
125 Ga0265316_10041027 3300031344 Bacteria 3707
126 Ga0265314_10003426 3300031711 Bacteria 15331
127 Ga0265342_10006780 3300031712 Bacteria 8484
128 Ga0307409_100151113 3300031995 Bacteria 2016
129 Ga0307416_100542512 3300032002 Bacteria 1235
130 Ga0373960_0427052 3300035121 Unclassified 515
131 Ga0373943_0033389 3300035170 Bacteria 2451
132 Ga0373931_1049003 3300035691 Unclassified 553
133 Ga0373935_0188960 3300035692 Bacteria 1418
134 Ga0373935_0601262 3300035692 Bacteria 804
135 Ga0373927_0029551 3300035695 Bacteria 3573
136 Ga0373947_0008047 3300035725 Bacteria 6082
137 Ga0395899_0044330 3300037312 Bacteria 3315
138 Ga0395900_0003618 3300037418 Bacteria 16615
139 Ga0395898_0040373 3300037466 Bacteria 4615
140 Ga0395898_1079704 3300037466 Unclassified 737
141 Ga0395905_0005406 3300037471 Bacteria 13054
142 Ga0436364_0178530 3300037853 Bacteria 1355
143 Ga0436364_0275445 3300037853 Bacteria 3846
144 Ga0436364_1025953 3300037853 Bacteria 28685
145 Ga0436364_1519846 3300037853 Bacteria 2073
146 Ga0395901_0005688 3300038443 Bacteria 12616
147 Ga0436365_1396317 3300039437 Bacteria 14894
148 Ga0436365_1687566 3300039437 Bacteria 1529
149 Ga0436365_1784397 3300039437 Bacteria 1147
150 Ga0466969_0001830 3300044656 Bacteria 11354
151 Ga0466972_0252243 3300044658 Bacteria 825
152 Ga0466965_0093082 3300044683 Bacteria 1535
153 Ga0466966_0201175 3300044684 Bacteria 1205
154 Ga0466961_0436025 3300044693 Bacteria 793
155 Ga0466963_0028048 3300044694 Bacteria 3611
156 Ga0466963_0069517 3300044694 Bacteria 2367
157 Ga0466963_0381524 3300044694 Bacteria 993
158 Ga0466964_0001244 3300044706 Bacteria 8644
159 Ga0466964_0007807 3300044706 Bacteria 4006
160 Ga0466964_0384600 3300044706 Bacteria 729
161 Ga0466971_0092874 3300044719 Bacteria 1383
162 Ga0466971_0154914 3300044719 Unclassified 1071
163 Ga0466968_0003400 3300044735 Bacteria 5884
164 Ga0466968_0012299 3300044735 Bacteria 3347
165 Ga0466968_0084914 3300044735 Bacteria 1396
166 Ga0466970_0201799 3300044765 Bacteria 1106
167 Ga0466970_0620179 3300044765 Bacteria 628
168 Ga0466957_0001239 3300044842 Bacteria 13301
169 Ga0466957_0243326 3300044842 Bacteria 1194
170 Ga0466957_0781075 3300044842 Bacteria 678
171 Ga0466960_0010198 3300044901 Bacteria 3898
172 Ga0466960_0046645 3300044901 Bacteria 2075
173 Ga0466959_0028520 3300045049 Bacteria 4139
174 Ga0466959_0063403 3300045049 Bacteria 2684
175 Ga0466958_0191172 3300045836 Unclassified 1301
176 Ga0466958_0202809 3300045836 Bacteria 1262
177 Ga0466958_0394152 3300045836 Bacteria 893
178 Ga0466958_0641454 3300045836 Bacteria 691
179 Ga0466967_0130094 3300045976 Bacteria 2335
180 Ga0466967_0196182 3300045976 Bacteria 1910
181 Ga0466967_0197982 3300045976 Unclassified 1901
182 Ga0466967_0203696 3300045976 Bacteria 1875
183 Ga0466967_0465635 3300045976 Bacteria 1237
184 Ga0466967_0869350 3300045976 Bacteria 896
185 Ga0466967_0992979 3300045976 Bacteria 836
186 Ga0466967_1330650 3300045976 Unclassified 715
187 Ga0466967_2048115 3300045976 Unclassified 569
188 Ga0466967_2392386 3300045976 Unclassified 523
189 Ga0495592_0278516 3300046454 Bacteria 1095
190 Ga0495603_0209439 3300046455 Bacteria 1126
191 Ga0495641_0084424 3300046461 Bacteria 1422
192 Ga0495653_0202112 3300046463 Bacteria 1348
193 Ga0495582_0208883 3300046473 Bacteria 1116
194 Ga0495639_0103650 3300046475 Bacteria 1345
195 Ga0495594_0493936 3300046499 Bacteria 695
196 Ga0495618_0357085 3300046514 Bacteria 900
197 Ga0495640_0117407 3300046533 Bacteria 1732
198 Ga0495598_0329791 3300046537 Unclassified 583
199 Ga0495656_0048443 3300046615 Bacteria 1806
200 Ga0495656_0147944 3300046615 Unclassified 1132
201 Ga0495634_0086538 3300046642 Bacteria 2041
202 Ga0495588_0671716 3300046674 Bacteria 542
203 Ga0495646_0191509 3300046680 Bacteria 1118
204 Ga0495589_0155237 3300046794 Bacteria 1092
205 Ga0495581_0245895 3300047315 Bacteria 1046
206 Ga0495676_0046253 3300047321 Bacteria 3534
207 Ga0495680_0144601 3300047322 Bacteria 1738
208 Ga0495593_0099437 3300047673 Bacteria 1493
209 Ga0496100_0003667 3300048903 Bacteria 8036
210 Ga0496100_0286801 3300048903 Bacteria 1229
211 Ga0496100_1604397 3300048903 Unclassified 514
212 Ga0496101_0063612 3300048904 Bacteria 2686
213 Ga0496101_0397871 3300048904 Bacteria 1084
214 Ga0496101_0583746 3300048904 Bacteria 884
215 Ga0496102_0004040 3300048905 Bacteria 12436
216 Ga0496102_0012759 3300048905 Bacteria 7275
217 Ga0496102_0189944 3300048905 Bacteria 1935
218 Ga0496103_0062749 3300048906 Bacteria 2313
219 Ga0496103_0308990 3300048906 Bacteria 1017
220 Ga0496104_0001044 3300048907 Bacteria 23662
221 Ga0496104_0051412 3300048907 Bacteria 3890
222 Ga0496104_0150445 3300048907 Bacteria 2235
223 Ga0496104_0465768 3300048907 Bacteria 1175
224 Ga0496105_0004351 3300048908 Bacteria 10665
225 Ga0496105_0447294 3300048908 Bacteria 1020
226 Ga0496105_0899379 3300048908 Bacteria 667
227 Ga0496106_0011906 3300048909 Bacteria 6421
228 Ga0496106_0101915 3300048909 Bacteria 2227
229 Ga0496107_0013281 3300048910 Bacteria 5755
230 Ga0496107_0155662 3300048910 Bacteria 1692
231 Ga0496107_0184310 3300048910 Bacteria 1550
232 Ga0496108_0282195 3300048911 Bacteria 1446
233 Ga0496108_0288614 3300048911 Unclassified 1428
234 Ga0496108_0730459 3300048911 Bacteria 857
235 Ga0496109_0001066 3300048912 Bacteria 22721
236 Ga0496109_0237423 3300048912 Bacteria 1715
237 Ga0496110_0001591 3300048913 Bacteria 16592
238 Ga0496110_0036081 3300048913 Bacteria 4292
239 Ga0496110_0092734 3300048913 Bacteria 2703
240 Ga0496111_0000567 3300048914 Bacteria 19290
241 Ga0496111_0010548 3300048914 Bacteria 6207
242 Ga0496111_0137890 3300048914 Bacteria 1808
243 Ga0496112_0108395 3300048915 Bacteria 2747
244 Ga0496112_1937848 3300048915 Bacteria 500
245 Ga0496114_0000621 3300048917 Bacteria 26198
246 Ga0496114_0006255 3300048917 Bacteria 9372
247 Ga0496114_0179612 3300048917 Bacteria 1848
248 Ga0496114_0467937 3300048917 Bacteria 1116
249 Ga0496114_0845630 3300048917 Bacteria 795
250 Ga0496115_0164390 3300048918 Bacteria 1835
251 Ga0496115_0649982 3300048918 Bacteria 833
252 nmdc:mga06z11_789842_c1 3300050494 Unclassified 578
253 nmdc:mga0n895_2147408_c1 3300050512 Unclassified 514
254 nmdc:mga0n895_632555_c1 3300050512 Unclassified 1070
255 nmdc:mga0rr50_1491276_c1 3300050513 Bacteria 572
256 Ga0495601_0251199 3300053077 Bacteria 1155
257 Ga0495601_0506933 3300053077 Bacteria 778
258 Ga0495655_0197023 3300053083 Bacteria 657
259 Ga0495595_0022258 3300053084 Bacteria 2781
260 Ga0495595_0058998 3300053084 Bacteria 1793
261 Ga0495619_0025894 3300053085 Bacteria 3771
262 Ga0495619_0365760 3300053085 Bacteria 997
263 Ga0157375_10637051
264 Ga0068869_100135315
265 Ga0070680_100118858
266 Ga0070682_100024526
267 Ga0068868_100980895
268 Ga0070674_100167350
269 Ga0070674_100278826
270 Ga0070667_100898993
271 Ga0070714_100443939
272 Ga0070714_100681654
273 Ga0070714_101167527
274 Ga0070713_100076948
275 Ga0070713_101174308
276 Ga0070710_11148178
277 Ga0070710_11258070
278 Ga0070700_100831532
279 Ga0070694_101884895
280 Ga0070678_100010036
281 Ga0070681_10047786
282 Ga0070681_10868597
283 Ga0070706_100334209
284 Ga0070679_100108493
285 Ga0070679_100239027
286 Ga0070684_100004813
287 Ga0070684_100351859
288 Ga0070696_100107207
289 Ga0070693_100009810
290 Ga0070664_101242624
291 Ga0068854_100612266
292 Ga0068854_101694781
293 Ga0068856_100064671
294 Ga0068856_100119629
295 Ga0068856_100388734
296 Ga0070702_100591700
297 Ga0068858_101599206
298 Ga0081455_10003479
299 Ga0070717_10117814
300 Ga0070717_10166457
301 Ga0070717_10505854
302 Ga0070717_11186342
303 Ga0070712_100103522
304 Ga0070712_102035319
305 Ga0097621_100276693
306 Ga0068871_101662640
307 Ga0075433_10137447
308 Ga0068865_101095243
309 Ga0105240_12592652
310 Ga0105245_10007430
311 Ga0105245_10308874
312 Ga0105245_10503412
313 Ga0105242_13113543
314 Ga0105248_10816239
315 Ga0105237_10685418
316 Ga0105249_10391236
317 Ga0105249_10564153
318 Ga0105239_10107162
319 Ga0105239_10517795
320 Ga0105246_10191267
321 Ga0105246_11055013
322 Ga0157374_12934668
323 Ga0157375_10652642
324 Ga0157375_10714993
325 Ga0157375_11184215
326 Ga0163163_10238314
327 Ga0163163_11523998
328 Ga0157377_10166397
329 Ga0157377_10612098
330 Ga0157376_10177790
331 Ga0213876_10003139
332 Ga0213875_10000837
333 Ga0213875_10020079
334 Ga0213875_10261949
335 Ga0207643_10047450
336 Ga0207707_10069196
337 Ga0207707_10516527
338 Ga0207693_10179956
339 Ga0207663_10734886
340 Ga0207660_10062988
341 Ga0207657_10083611
342 Ga0207652_10045446
343 Ga0207694_10117088
344 Ga0207687_10018992
345 Ga0207687_10037099
346 Ga0207687_10415481
347 Ga0207700_10641711
348 Ga0207664_10294459
349 Ga0207664_10655091
350 Ga0207664_11100418
351 Ga0207664_11152747
352 Ga0207664_11653067
353 Ga0207664_11878555
354 Ga0207669_10106049
355 Ga0207704_11197083
356 Ga0207661_10058081
357 Ga0207679_10218635
358 Ga0207679_10422271
359 Ga0207667_12138979
360 Ga0207651_10684035
361 Ga0207712_10911702
362 Ga0207668_11178970
363 Ga0207640_10462741
364 Ga0207640_11629928
365 Ga0207658_10335531
366 Ga0207677_10980190
367 Ga0207703_11818330
368 Ga0207702_10216056
369 Ga0207702_10438662
370 Ga0207675_100490231
371 Ga0207683_10017315
372 Ga0207683_10446395
373 Ga0207683_10470592
374 Ga0265337_1063478
375 Ga0265334_10153009
376 Ga0265318_10001748
377 Ga0265318_10045007
378 Ga0265318_10197977
379 Ga0265338_10016119
380 Ga0265338_10048366
381 Ga0265330_10043007
382 Ga0265328_10055821
383 Ga0265320_10050742
384 Ga0265320_10218883
385 Ga0265340_10059113
386 Ga0265327_10024030
387 Ga0265316_10041027
388 Ga0265314_10003426
389 Ga0265342_10006780
390 Ga0307409_100151113
391 Ga0307416_100542512
392 Ga0373960_0427052
393 Ga0373943_0033389
394 Ga0373931_1049003
395 Ga0373935_0188960
396 Ga0373935_0601262
397 Ga0373927_0029551
398 Ga0373947_0008047
399 Ga0395899_0044330
400 Ga0395900_0003618
401 Ga0395898_0040373
402 Ga0395898_1079704
403 Ga0395905_0005406
404 Ga0436364_0178530
405 Ga0436364_0275445
406 Ga0436364_1025953
407 Ga0436364_1519846
408 Ga0395901_0005688
409 Ga0436365_1396317
410 Ga0436365_1687566
411 Ga0436365_1784397
412 Ga0466969_0001830
413 Ga0466972_0252243
414 Ga0466965_0093082
415 Ga0466966_0201175
416 Ga0466961_0436025
417 Ga0466963_0028048
418 Ga0466963_0069517
419 Ga0466963_0381524
420 Ga0466964_0001244
421 Ga0466964_0007807
422 Ga0466964_0384600
423 Ga0466971_0092874
424 Ga0466971_0154914
425 Ga0466968_0003400
426 Ga0466968_0012299
427 Ga0466968_0084914
428 Ga0466970_0201799
429 Ga0466970_0620179
430 Ga0466957_0001239
431 Ga0466957_0243326
432 Ga0466957_0781075
433 Ga0466960_0010198
434 Ga0466960_0046645
435 Ga0466959_0028520
436 Ga0466959_0063403
437 Ga0466958_0191172
438 Ga0466958_0202809
439 Ga0466958_0394152
440 Ga0466958_0641454
441 Ga0466967_0130094
442 Ga0466967_0196182
443 Ga0466967_0197982
444 Ga0466967_0203696
445 Ga0466967_0465635
446 Ga0466967_0869350
447 Ga0466967_0992979
448 Ga0466967_1330650
449 Ga0466967_2048115
450 Ga0466967_2392386
451 Ga0495592_0278516
452 Ga0495603_0209439
453 Ga0495641_0084424
454 Ga0495653_0202112
455 Ga0495582_0208883
456 Ga0495639_0103650
457 Ga0495594_0493936
458 Ga0495618_0357085
459 Ga0495640_0117407
460 Ga0495598_0329791
461 Ga0495656_0048443
462 Ga0495656_0147944
463 Ga0495634_0086538
464 Ga0495588_0671716
465 Ga0495646_0191509
466 Ga0495589_0155237
467 Ga0495581_0245895
468 Ga0495676_0046253
469 Ga0495680_0144601
470 Ga0495593_0099437
471 Ga0496100_0003667
472 Ga0496100_0286801
473 Ga0496100_1604397
474 Ga0496101_0063612
475 Ga0496101_0397871
476 Ga0496101_0583746
477 Ga0496102_0004040
478 Ga0496102_0012759
479 Ga0496102_0189944
480 Ga0496103_0062749
481 Ga0496103_0308990
482 Ga0496104_0001044
483 Ga0496104_0051412
484 Ga0496104_0150445
485 Ga0496104_0465768
486 Ga0496105_0004351
487 Ga0496105_0447294
488 Ga0496105_0899379
489 Ga0496106_0011906
490 Ga0496106_0101915
491 Ga0496107_0013281
492 Ga0496107_0155662
493 Ga0496107_0184310
494 Ga0496108_0282195
495 Ga0496108_0288614
496 Ga0496108_0730459
497 Ga0496109_0001066
498 Ga0496109_0237423
499 Ga0496110_0001591
500 Ga0496110_0036081
501 Ga0496110_0092734
502 Ga0496111_0000567
503 Ga0496111_0010548
504 Ga0496111_0137890
505 Ga0496112_0108395
506 Ga0496112_1937848
507 Ga0496114_0000621
508 Ga0496114_0006255
509 Ga0496114_0179612
510 Ga0496114_0467937
511 Ga0496114_0845630
512 Ga0496115_0164390
513 Ga0496115_0649982
514 nmdc:mga06z11_789842_c1
515 nmdc:mga0n895_2147408_c1
516 nmdc:mga0n895_632555_c1
517 nmdc:mga0rr50_1491276_c1
518 Ga0495601_0251199
519 Ga0495601_0506933
520 Ga0495655_0197023
521 Ga0495595_0022258
522 Ga0495595_0058998
523 Ga0495619_0025894
524 Ga0495619_0365760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

33

94

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9535 31 107
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.9261 31 107
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9261 31 107
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.914 29 108
2d40-assembly1.cif.gz_A crystal structure of z3393 from escherichia coli o157:h7 0.9058 31 107
ID Description Score Start End Superfamily
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9164 32 106 2.60.120.10
3cewA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9125 19 114 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9122 31 107 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9096 31 107 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9072 29 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538CV03-F1-model_v4 Cupin domain-containing protein 0.9982 1 98
AF-A0A538CV03-F1-model_v4 Cupin domain-containing protein 0.9882 1 98
AF-A0A538MVR0-F1-model_v4 Cupin domain-containing protein 0.9754 1 118
AF-Q5V344-F1-model_v4 Cupin type-2 domain-containing protein 0.9718 21 107
AF-A0A1F6NVT4-F1-model_v4 Cupin type-2 domain-containing protein 0.9685 30 107

Map