F370998

General Info

Members Datasets Scaffolds Average Seq Length
262 160 524 257

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100343118|Ga0075431_1003431182
Length 258
Sequence VNLIDSHCHLDDKQFAADREAVIERAQSAGVSRLMAIGTGDGPPDLETAIRLADTYPAFYATVGVHPHDAAKATPATFDQLRDLLQHPKVLALGEIGLDYHYDFSPRDTQRSVFIRQLELAQEAGKPIVIHTREAWTDTTEILREHYTGGGIFHCFTGGPAQATEALELGFHLSFGGVLTFPKAEPVREAARLAPLERILIETDAPYLAPVPHRGKRNEPAFVLETARKLAEIRLISVEAAAEATTRNFERLCLRYTG

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.76
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100343118 3300006847 Viruses 1503
2 Ga0070683_100003433 3300005329 Bacteria 12866
3 Ga0070683_100033508 3300005329 Bacteria 4684
4 Ga0070683_100082382 3300005329 Bacteria 3013
5 Ga0070683_100123018 3300005329 Unclassified 2451
6 Ga0070690_100171517 3300005330 Bacteria 1493
7 Ga0068869_100077845 3300005334 Bacteria 2468
8 Ga0068869_100153886 3300005334 Bacteria 1785
9 Ga0070691_10062606 3300005341 Bacteria 1792
10 Ga0070671_100275177 3300005355 Bacteria 1431
11 Ga0070673_100169953 3300005364 Bacteria 1860
12 Ga0070659_100541652 3300005366 Bacteria 996
13 Ga0070714_100002125 3300005435 Bacteria 14556
14 Ga0070713_100002298 3300005436 Bacteria 12436
15 Ga0070713_100200777 3300005436 Bacteria 1801
16 Ga0070694_100001996 3300005444 Bacteria 12119
17 Ga0070678_100047324 3300005456 Bacteria 3089
18 Ga0070662_100074379 3300005457 Bacteria 2513
19 Ga0070681_10000429 3300005458 Bacteria 34168
20 Ga0070679_100002104 3300005530 Bacteria 17923
21 Ga0070684_100031570 3300005535 Bacteria 4510
22 Ga0070684_100053189 3300005535 Bacteria 3523
23 Ga0068853_100026483 3300005539 Bacteria 4869
24 Ga0068853_100180666 3300005539 Bacteria 1913
25 Ga0070686_100307237 3300005544 Bacteria 1178
26 Ga0070693_100087048 3300005547 Bacteria 1875
27 Ga0068855_100006647 3300005563 Bacteria 14046
28 Ga0068855_100050211 3300005563 Bacteria 4917
29 Ga0068855_100291708 3300005563 Bacteria 1808
30 Ga0070664_100069784 3300005564 Bacteria 3007
31 Ga0070664_100325135 3300005564 Bacteria 1394
32 Ga0068857_100011881 3300005577 Bacteria 7576
33 Ga0068857_100016708 3300005577 Bacteria 6430
34 Ga0068856_100005596 3300005614 Bacteria 12362
35 Ga0068852_100406533 3300005616 Bacteria 1340
36 Ga0068852_100687405 3300005616 Bacteria 1033
37 Ga0068859_100973008 3300005617 Bacteria 931
38 Ga0068864_100473623 3300005618 Unclassified 1201
39 Ga0068863_100158440 3300005841 Bacteria 2168
40 Ga0068858_100094156 3300005842 Bacteria 2790
41 Ga0068858_100508544 3300005842 Bacteria 1164
42 Ga0068860_100240029 3300005843 Bacteria 1762
43 Ga0070717_10007639 3300006028 Bacteria 8037
44 Ga0070717_10017951 3300006028 Bacteria 5518
45 Ga0070717_10028102 3300006028 Bacteria 4499
46 Ga0097621_100113503 3300006237 Bacteria 2292
47 Ga0068871_100017464 3300006358 Bacteria 5430
48 Ga0075428_100058040 3300006844 Bacteria 4237
49 Ga0075431_100016553 3300006847 Bacteria 7485
50 Ga0075431_100036222 3300006847 Bacteria 5082
51 Ga0097620_100973173 3300006931 Bacteria 931
52 Ga0075435_100706723 3300007076 Bacteria 876
53 Ga0105240_10029723 3300009093 Bacteria 7111
54 Ga0105240_10069321 3300009093 Bacteria 4365
55 Ga0105240_10115824 3300009093 Bacteria 3234
56 Ga0105245_10001662 3300009098 Bacteria 20242
57 Ga0105245_10003315 3300009098 Bacteria 14459
58 Ga0105245_10043099 3300009098 Bacteria 4026
59 Ga0105245_10475620 3300009098 Bacteria 1262
60 Ga0114129_10225320 3300009147 Bacteria 2527
61 Ga0105243_10078342 3300009148 Bacteria 2690
62 Ga0105241_10003601 3300009174 Bacteria 11524
63 Ga0105241_10439712 3300009174 Unclassified 1152
64 Ga0105242_10022749 3300009176 Bacteria 4935
65 Ga0105242_10434284 3300009176 Bacteria 1234
66 Ga0105248_10170040 3300009177 Bacteria 2456
67 Ga0105248_10176095 3300009177 Bacteria 2410
68 Ga0105248_10452526 3300009177 Bacteria 1447
69 Ga0105248_10702202 3300009177 Bacteria 1141
70 Ga0105237_10007542 3300009545 Bacteria 11888
71 Ga0105237_10109246 3300009545 Bacteria 2757
72 Ga0105237_10111210 3300009545 Bacteria 2731
73 Ga0105237_10621945 3300009545 Bacteria 1087
74 Ga0105238_10001038 3300009551 Bacteria 28173
75 Ga0105238_10182194 3300009551 Bacteria 2077
76 Ga0105238_10287595 3300009551 Bacteria 1626
77 Ga0105238_10329901 3300009551 Unclassified 1512
78 Ga0105249_10158801 3300009553 Bacteria 2183
79 Ga0105239_10001581 3300010375 Bacteria 30064
80 Ga0105239_10102704 3300010375 Bacteria 3164
81 Ga0105239_10526682 3300010375 Unclassified 1345
82 Ga0105239_10741410 3300010375 Bacteria 1124
83 Ga0157370_10002314 3300013104 Bacteria 23063
84 Ga0157370_10016203 3300013104 Bacteria 7553
85 Ga0157369_10006442 3300013105 Bacteria 13607
86 Ga0157369_10273825 3300013105 Bacteria 1759
87 Ga0157374_10501725 3300013296 Bacteria 1218
88 Ga0163162_10199649 3300013306 Bacteria 2129
89 Ga0157372_10002263 3300013307 Bacteria 20862
90 Ga0157372_10228844 3300013307 Unclassified 2155
91 Ga0157375_10756832 3300013308 Bacteria 1122
92 Ga0157375_10959718 3300013308 Bacteria 996
93 Ga0213875_10081619 3300021388 Bacteria 1508
94 Ga0213875_10158535 3300021388 Unclassified 1061
95 Ga0207645_10080050 3300025907 Bacteria 2094
96 Ga0207654_10020547 3300025911 Bacteria 3502
97 Ga0207695_10008704 3300025913 Bacteria 12657
98 Ga0207695_10093120 3300025913 Bacteria 3023
99 Ga0207695_10096377 3300025913 Bacteria 2960
100 Ga0207695_10108599 3300025913 Bacteria 2758
101 Ga0207671_10030080 3300025914 Bacteria 4050
102 Ga0207671_10199272 3300025914 Unclassified 1563
103 Ga0207663_10187414 3300025916 Unclassified 1483
104 Ga0207663_10343700 3300025916 Bacteria 1128
105 Ga0207660_10035446 3300025917 Bacteria 3465
106 Ga0207652_10037871 3300025921 Bacteria 4084
107 Ga0207694_10288622 3300025924 Bacteria 1349
108 Ga0207687_10002248 3300025927 Bacteria 13153
109 Ga0207687_10003155 3300025927 Bacteria 11183
110 Ga0207687_10007425 3300025927 Bacteria 7218
111 Ga0207687_10338790 3300025927 Bacteria 1222
112 Ga0207700_10068389 3300025928 Bacteria 2722
113 Ga0207700_10189143 3300025928 Bacteria 1729
114 Ga0207664_10002633 3300025929 Bacteria 11887
115 Ga0207690_10176579 3300025932 Bacteria 1605
116 Ga0207686_10037605 3300025934 Bacteria 2922
117 Ga0207686_10207198 3300025934 Bacteria 1408
118 Ga0207686_10220500 3300025934 Bacteria 1369
119 Ga0207709_10193452 3300025935 Bacteria 1447
120 Ga0207704_10141623 3300025938 Bacteria 1683
121 Ga0207711_10106970 3300025941 Bacteria 2483
122 Ga0207711_10405396 3300025941 Bacteria 1267
123 Ga0207689_10244364 3300025942 Bacteria 1484
124 Ga0207689_10252306 3300025942 Bacteria 1459
125 Ga0207689_10266411 3300025942 Bacteria 1418
126 Ga0207689_10606714 3300025942 Bacteria 921
127 Ga0207661_10002897 3300025944 Bacteria 11857
128 Ga0207661_10014185 3300025944 Bacteria 5833
129 Ga0207661_10070817 3300025944 Bacteria 2847
130 Ga0207661_10104185 3300025944 Bacteria 2388
131 Ga0207661_10248290 3300025944 Bacteria 1581
132 Ga0207679_10175491 3300025945 Bacteria 1768
133 Ga0207679_10287615 3300025945 Bacteria 1412
134 Ga0207667_10001646 3300025949 Bacteria 28149
135 Ga0207667_10006490 3300025949 Bacteria 14150
136 Ga0207667_10056655 3300025949 Bacteria 4116
137 Ga0207651_10308194 3300025960 Bacteria 1319
138 Ga0207640_10080153 3300025981 Bacteria 2228
139 Ga0207677_10175642 3300026023 Bacteria 1680
140 Ga0207703_10029467 3300026035 Bacteria 4331
141 Ga0207703_10065500 3300026035 Bacteria 2986
142 Ga0207703_10263049 3300026035 Bacteria 1560
143 Ga0207702_10042635 3300026078 Bacteria 3807
144 Ga0207648_10107015 3300026089 Bacteria 2454
145 Ga0207674_10001061 3300026116 Bacteria 35743
146 Ga0207674_10024980 3300026116 Bacteria 6377
147 Ga0207683_10109652 3300026121 Bacteria 2471
148 Ga0207698_10194373 3300026142 Bacteria 1811
149 Ga0268264_10021256 3300028381 Bacteria 5301
150 Ga0265338_10154136 3300028800 Bacteria 1782
151 Ga0265332_10093260 3300031238 Bacteria 1272
152 Ga0265325_10002043 3300031241 Bacteria 13861
153 Ga0265325_10104713 3300031241 Bacteria 1381
154 Ga0265313_10003103 3300031595 Bacteria 13757
155 Ga0265314_10054078 3300031711 Bacteria 2780
156 Ga0373926_0008556 3300035083 Unclassified 3409
157 Ga0373926_0022230 3300035083 Bacteria 2200
158 Ga0373934_0005224 3300035086 Bacteria 4801
159 Ga0373934_0013418 3300035086 Bacteria 3098
160 Ga0373923_0079195 3300035111 Bacteria 1423
161 Ga0373945_0071148 3300035116 Unclassified 1317
162 Ga0373945_0090037 3300035116 Bacteria 1187
163 Ga0373953_0005803 3300035117 Bacteria 4035
164 Ga0373954_0019341 3300035118 Bacteria 3071
165 Ga0373954_0053122 3300035118 Bacteria 1904
166 Ga0373957_0142453 3300035120 Unclassified 981
167 Ga0373946_0178584 3300035171 Bacteria 1006
168 Ga0373955_0015621 3300035172 Bacteria 3722
169 Ga0373955_0069666 3300035172 Bacteria 1963
170 Ga0373935_0070707 3300035692 Bacteria 2250
171 Ga0373927_0001114 3300035695 Bacteria 20394
172 Ga0373927_0002765 3300035695 Bacteria 12810
173 Ga0373927_0005002 3300035695 Bacteria 9182
174 Ga0373927_0015169 3300035695 Bacteria 5094
175 Ga0373933_0139756 3300035724 Bacteria 1529
176 Ga0373933_0142279 3300035724 Unclassified 1515
177 Ga0373933_0157320 3300035724 Bacteria 1442
178 Ga0373933_0182500 3300035724 Bacteria 1339
179 Ga0373947_0000247 3300035725 Bacteria 30557
180 Ga0373947_0059553 3300035725 Bacteria 2315
181 Ga0373947_0200640 3300035725 Unclassified 1305
182 Ga0373937_0034609 3300036401 Bacteria 4595
183 Ga0373937_0037344 3300036401 Bacteria 4426
184 Ga0373937_0083749 3300036401 Bacteria 2950
185 Ga0373937_0281287 3300036401 Bacteria 1571
186 Ga0373937_0659996 3300036401 Unclassified 991
187 Ga0373925_0000742 3300037068 Bacteria 29951
188 Ga0373925_0000927 3300037068 Bacteria 26693
189 Ga0373925_0010841 3300037068 Bacteria 6610
190 Ga0373925_0014043 3300037068 Bacteria 5797
191 Ga0373925_0133610 3300037068 Bacteria 1937
192 Ga0373925_0207344 3300037068 Unclassified 1560
193 Ga0436364_0687922 3300037853 Unclassified 2076
194 Ga0436364_1557422 3300037853 Bacteria 2936
195 Ga0436365_1132402 3300039437 Bacteria 5169
196 Ga0436363_0035222 3300039450 Bacteria 1345
197 Ga0466967_0249061 3300045976 Bacteria 1697
198 Ga0495629_0000010 3300046459 Bacteria 340114
199 Ga0495580_0014079 3300046472 Bacteria 6081
200 Ga0495580_0068535 3300046472 Bacteria 2481
201 Ga0495580_0144806 3300046472 Bacteria 1647
202 Ga0495580_0185385 3300046472 Bacteria 1436
203 Ga0495582_0002236 3300046473 Bacteria 10840
204 Ga0495639_0000443 3300046475 Bacteria 19716
205 Ga0495628_0350135 3300046516 Bacteria 1086
206 Ga0495630_0466202 3300046517 Bacteria 968
207 Ga0495666_0000818 3300046526 Bacteria 14396
208 Ga0495652_0049713 3300046529 Bacteria 3588
209 Ga0495652_0485839 3300046529 Bacteria 859
210 Ga0495665_0029183 3300046531 Bacteria 2956
211 Ga0495640_0233650 3300046533 Bacteria 1156
212 Ga0495586_0000580 3300046535 Bacteria 21199
213 Ga0495586_0042422 3300046535 Bacteria 2450
214 Ga0495622_0037489 3300046557 Bacteria 2258
215 Ga0495635_0010572 3300046663 Bacteria 6460
216 Ga0495635_0267935 3300046663 Unclassified 1149
217 Ga0495588_0089509 3300046674 Bacteria 1612
218 Ga0495588_0148171 3300046674 Bacteria 1240
219 Ga0495599_0000451 3300046678 Bacteria 23440
220 Ga0495599_0157440 3300046678 Bacteria 1405
221 Ga0495658_0003567 3300046683 Bacteria 7702
222 Ga0495624_0082429 3300046690 Bacteria 1990
223 Ga0495581_0172619 3300047315 Bacteria 1264
224 Ga0495674_0039280 3300047319 Bacteria 4244
225 Ga0495674_0158595 3300047319 Bacteria 1894
226 Ga0495676_0038879 3300047321 Bacteria 3947
227 Ga0495680_0003587 3300047322 Bacteria 15200
228 Ga0495675_0130829 3300047444 Bacteria 1560
229 Ga0495684_0009569 3300047471 Bacteria 7472
230 Ga0495684_0032285 3300047471 Bacteria 4019
231 Ga0495684_0331104 3300047471 Bacteria 1086
232 Ga0495602_0050620 3300048088 Bacteria 3709
233 Ga0495602_0236542 3300048088 Unclassified 1369
234 Ga0496106_0162446 3300048909 Bacteria 1767
235 Ga0496108_0847106 3300048911 Bacteria 787
236 Ga0501032_0034713 3300049569 Bacteria 3451
237 Ga0501034_0008364 3300049571 Bacteria 10941
238 Ga0501036_0000814 3300049572 Bacteria 23171
239 Ga0501037_0004060 3300049573 Bacteria 10616
240 Ga0501038_0031484 3300049574 Bacteria 4687
241 Ga0501039_0004429 3300049575 Bacteria 10603
242 Ga0501043_0025155 3300049579 Bacteria 4670
243 Ga0501046_0000783 3300049580 Bacteria 30741
244 Ga0501047_0048898 3300049581 Bacteria 4083
245 Ga0501048_0004771 3300049582 Bacteria 10329
246 Ga0501067_0002194 3300049583 Bacteria 10774
247 Ga0501068_0000562 3300049584 Bacteria 18872
248 Ga0501069_0000891 3300049585 Bacteria 14251
249 Ga0501072_0001018 3300049588 Bacteria 20749
250 Ga0501073_0000325 3300049589 Bacteria 31963
251 Ga0501074_0000567 3300049590 Bacteria 22887
252 Ga0501076_0005401 3300049592 Bacteria 9186
253 Ga0501077_0014686 3300049593 Bacteria 4921
254 Ga0501079_0005643 3300049741 Bacteria 9339
255 Ga0501080_0000021 3300049742 Bacteria 91749
256 Ga0501035_0036893 3300049822 Bacteria 4428
257 Ga0501044_0058183 3300049823 Bacteria 3964
258 nmdc:mga05p37_122487_c1 3300050507 Bacteria 3194
259 nmdc:mga06r32_190962_c1 3300050510 Bacteria 2036
260 Ga0495595_0135319 3300053084 Bacteria 1207
261 Ga0501084_0000522 3300054114 Bacteria 29401
262 Ga0501082_0003396 3300060353 Bacteria 13899
263 Ga0075431_100343118
264 Ga0070683_100003433
265 Ga0070683_100033508
266 Ga0070683_100082382
267 Ga0070683_100123018
268 Ga0070690_100171517
269 Ga0068869_100077845
270 Ga0068869_100153886
271 Ga0070691_10062606
272 Ga0070671_100275177
273 Ga0070673_100169953
274 Ga0070659_100541652
275 Ga0070714_100002125
276 Ga0070713_100002298
277 Ga0070713_100200777
278 Ga0070694_100001996
279 Ga0070678_100047324
280 Ga0070662_100074379
281 Ga0070681_10000429
282 Ga0070679_100002104
283 Ga0070684_100031570
284 Ga0070684_100053189
285 Ga0068853_100026483
286 Ga0068853_100180666
287 Ga0070686_100307237
288 Ga0070693_100087048
289 Ga0068855_100006647
290 Ga0068855_100050211
291 Ga0068855_100291708
292 Ga0070664_100069784
293 Ga0070664_100325135
294 Ga0068857_100011881
295 Ga0068857_100016708
296 Ga0068856_100005596
297 Ga0068852_100406533
298 Ga0068852_100687405
299 Ga0068859_100973008
300 Ga0068864_100473623
301 Ga0068863_100158440
302 Ga0068858_100094156
303 Ga0068858_100508544
304 Ga0068860_100240029
305 Ga0070717_10007639
306 Ga0070717_10017951
307 Ga0070717_10028102
308 Ga0097621_100113503
309 Ga0068871_100017464
310 Ga0075428_100058040
311 Ga0075431_100016553
312 Ga0075431_100036222
313 Ga0097620_100973173
314 Ga0075435_100706723
315 Ga0105240_10029723
316 Ga0105240_10069321
317 Ga0105240_10115824
318 Ga0105245_10001662
319 Ga0105245_10003315
320 Ga0105245_10043099
321 Ga0105245_10475620
322 Ga0114129_10225320
323 Ga0105243_10078342
324 Ga0105241_10003601
325 Ga0105241_10439712
326 Ga0105242_10022749
327 Ga0105242_10434284
328 Ga0105248_10170040
329 Ga0105248_10176095
330 Ga0105248_10452526
331 Ga0105248_10702202
332 Ga0105237_10007542
333 Ga0105237_10109246
334 Ga0105237_10111210
335 Ga0105237_10621945
336 Ga0105238_10001038
337 Ga0105238_10182194
338 Ga0105238_10287595
339 Ga0105238_10329901
340 Ga0105249_10158801
341 Ga0105239_10001581
342 Ga0105239_10102704
343 Ga0105239_10526682
344 Ga0105239_10741410
345 Ga0157370_10002314
346 Ga0157370_10016203
347 Ga0157369_10006442
348 Ga0157369_10273825
349 Ga0157374_10501725
350 Ga0163162_10199649
351 Ga0157372_10002263
352 Ga0157372_10228844
353 Ga0157375_10756832
354 Ga0157375_10959718
355 Ga0213875_10081619
356 Ga0213875_10158535
357 Ga0207645_10080050
358 Ga0207654_10020547
359 Ga0207695_10008704
360 Ga0207695_10093120
361 Ga0207695_10096377
362 Ga0207695_10108599
363 Ga0207671_10030080
364 Ga0207671_10199272
365 Ga0207663_10187414
366 Ga0207663_10343700
367 Ga0207660_10035446
368 Ga0207652_10037871
369 Ga0207694_10288622
370 Ga0207687_10002248
371 Ga0207687_10003155
372 Ga0207687_10007425
373 Ga0207687_10338790
374 Ga0207700_10068389
375 Ga0207700_10189143
376 Ga0207664_10002633
377 Ga0207690_10176579
378 Ga0207686_10037605
379 Ga0207686_10207198
380 Ga0207686_10220500
381 Ga0207709_10193452
382 Ga0207704_10141623
383 Ga0207711_10106970
384 Ga0207711_10405396
385 Ga0207689_10244364
386 Ga0207689_10252306
387 Ga0207689_10266411
388 Ga0207689_10606714
389 Ga0207661_10002897
390 Ga0207661_10014185
391 Ga0207661_10070817
392 Ga0207661_10104185
393 Ga0207661_10248290
394 Ga0207679_10175491
395 Ga0207679_10287615
396 Ga0207667_10001646
397 Ga0207667_10006490
398 Ga0207667_10056655
399 Ga0207651_10308194
400 Ga0207640_10080153
401 Ga0207677_10175642
402 Ga0207703_10029467
403 Ga0207703_10065500
404 Ga0207703_10263049
405 Ga0207702_10042635
406 Ga0207648_10107015
407 Ga0207674_10001061
408 Ga0207674_10024980
409 Ga0207683_10109652
410 Ga0207698_10194373
411 Ga0268264_10021256
412 Ga0265338_10154136
413 Ga0265332_10093260
414 Ga0265325_10002043
415 Ga0265325_10104713
416 Ga0265313_10003103
417 Ga0265314_10054078
418 Ga0373926_0008556
419 Ga0373926_0022230
420 Ga0373934_0005224
421 Ga0373934_0013418
422 Ga0373923_0079195
423 Ga0373945_0071148
424 Ga0373945_0090037
425 Ga0373953_0005803
426 Ga0373954_0019341
427 Ga0373954_0053122
428 Ga0373957_0142453
429 Ga0373946_0178584
430 Ga0373955_0015621
431 Ga0373955_0069666
432 Ga0373935_0070707
433 Ga0373927_0001114
434 Ga0373927_0002765
435 Ga0373927_0005002
436 Ga0373927_0015169
437 Ga0373933_0139756
438 Ga0373933_0142279
439 Ga0373933_0157320
440 Ga0373933_0182500
441 Ga0373947_0000247
442 Ga0373947_0059553
443 Ga0373947_0200640
444 Ga0373937_0034609
445 Ga0373937_0037344
446 Ga0373937_0083749
447 Ga0373937_0281287
448 Ga0373937_0659996
449 Ga0373925_0000742
450 Ga0373925_0000927
451 Ga0373925_0010841
452 Ga0373925_0014043
453 Ga0373925_0133610
454 Ga0373925_0207344
455 Ga0436364_0687922
456 Ga0436364_1557422
457 Ga0436365_1132402
458 Ga0436363_0035222
459 Ga0466967_0249061
460 Ga0495629_0000010
461 Ga0495580_0014079
462 Ga0495580_0068535
463 Ga0495580_0144806
464 Ga0495580_0185385
465 Ga0495582_0002236
466 Ga0495639_0000443
467 Ga0495628_0350135
468 Ga0495630_0466202
469 Ga0495666_0000818
470 Ga0495652_0049713
471 Ga0495652_0485839
472 Ga0495665_0029183
473 Ga0495640_0233650
474 Ga0495586_0000580
475 Ga0495586_0042422
476 Ga0495622_0037489
477 Ga0495635_0010572
478 Ga0495635_0267935
479 Ga0495588_0089509
480 Ga0495588_0148171
481 Ga0495599_0000451
482 Ga0495599_0157440
483 Ga0495658_0003567
484 Ga0495624_0082429
485 Ga0495581_0172619
486 Ga0495674_0039280
487 Ga0495674_0158595
488 Ga0495676_0038879
489 Ga0495680_0003587
490 Ga0495675_0130829
491 Ga0495684_0009569
492 Ga0495684_0032285
493 Ga0495684_0331104
494 Ga0495602_0050620
495 Ga0495602_0236542
496 Ga0496106_0162446
497 Ga0496108_0847106
498 Ga0501032_0034713
499 Ga0501034_0008364
500 Ga0501036_0000814
501 Ga0501037_0004060
502 Ga0501038_0031484
503 Ga0501039_0004429
504 Ga0501043_0025155
505 Ga0501046_0000783
506 Ga0501047_0048898
507 Ga0501048_0004771
508 Ga0501067_0002194
509 Ga0501068_0000562
510 Ga0501069_0000891
511 Ga0501072_0001018
512 Ga0501073_0000325
513 Ga0501074_0000567
514 Ga0501076_0005401
515 Ga0501077_0014686
516 Ga0501079_0005643
517 Ga0501080_0000021
518 Ga0501035_0036893
519 Ga0501044_0058183
520 nmdc:mga05p37_122487_c1
521 nmdc:mga06r32_190962_c1
522 Ga0495595_0135319
523 Ga0501084_0000522
524 Ga0501082_0003396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

4

253

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9405 1 253
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.9297 1 253
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9295 1 256
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9259 1 256
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9192 1 256
ID Description Score Start End Superfamily
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9384 1 253 3.20.20.140
2gzxB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9274 1 253 3.20.20.140
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9216 1 256 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9192 1 256 3.20.20.140
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9182 1 256 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V9YR22-F1-model_v4 TatD family deoxyribonuclease 0.9706 1 209 GO:0005829
GO:0016788
GO:0046872
AF-A0A1G1PVL9-F1-model_v4 Hydrolase TatD 0.9697 1 172 GO:0016788
AF-A0A847Z521-F1-model_v4 TatD family hydrolase 0.9693 1 145 GO:0005829
GO:0016788
AF-A0A257LVS5-F1-model_v4 Hydrolase TatD 0.9665 1 159 GO:0005829
GO:0016788
AF-A0A355SBC3-F1-model_v4 Hydrolase TatD 0.9656 1 155 GO:0005829
GO:0016788

Map