F370713

General Info

Members Datasets Scaffolds Average Seq Length
261 178 522 177

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0201931|Ga0501082_0201931_263_796
Length 177
Sequence MKPLPLADVYALIEPGPVVLLTTARKGRANVMAMSWHMMVEFEPPQIACIVSNADYSFAALKATKECVIAIPPRKIAAKVVRAGNTSGRDVADKFAACKLTPVPASQVAAPLVEECIANLECRVIDTTLVGRYCIFILETVAAWIDPKQKNARTIHHRGNGRFAVDGEIIRLKSRMR

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
141 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
144 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
145 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
146 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
147 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
148 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
149 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
150 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
151 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
152 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
153 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
154 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
155 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
156 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
157 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
158 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
159 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
160 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
161 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
162 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
163 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
164 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
165 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
166 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
167 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
168 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
169 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
170 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
171 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
172 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
173 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
174 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
175 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
176 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
177 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
178 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.44
Metatranscriptomes 0.38
Isolates 14.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.2
Nodule 10.34
Rhizoplane 3.07
Rhizosphere 73.56
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0201931 3300060353 Bacteria 1730
2 JGI24740J21852_10013369 3300001979 Bacteria 3063
3 JGI24735J21928_10012018 3300002067 Bacteria 2739
4 Ga0055542_1007803 3300003762 Bacteria 2139
5 Ga0055529_1008211 3300003763 Bacteria 1394
6 Ga0070658_10019419 3300005327 Bacteria 5443
7 Ga0070658_10039459 3300005327 Bacteria 3809
8 Ga0070680_100064946 3300005336 Bacteria 2991
9 Ga0070660_100047750 3300005339 Bacteria 3286
10 Ga0070660_100061027 3300005339 Bacteria 2927
11 Ga0070661_100090403 3300005344 Bacteria 2267
12 Ga0070692_10568070 3300005345 Bacteria 746
13 Ga0070659_100584680 3300005366 Bacteria 958
14 Ga0070714_100012929 3300005435 Bacteria 6674
15 Ga0070713_101477451 3300005436 Bacteria 659
16 Ga0070663_100260604 3300005455 Bacteria 1375
17 Ga0070679_100198222 3300005530 Bacteria 1974
18 Ga0068853_100035106 3300005539 Bacteria 4258
19 Ga0070695_100180879 3300005545 Bacteria 1494
20 Ga0070665_100253848 3300005548 Bacteria 1759
21 Ga0068855_100170368 3300005563 Bacteria 2466
22 Ga0068855_100256941 3300005563 Bacteria 1947
23 Ga0068855_100856993 3300005563 Bacteria 962
24 Ga0068854_100128403 3300005578 Bacteria 1933
25 Ga0068854_100165636 3300005578 Bacteria 1716
26 Ga0068856_100037298 3300005614 Bacteria 4769
27 Ga0068856_100186758 3300005614 Bacteria 2087
28 Ga0068856_100304486 3300005614 Bacteria 1611
29 Ga0068856_101316709 3300005614 Bacteria 737
30 Ga0068852_100047128 3300005616 Bacteria 3675
31 Ga0068852_100239096 3300005616 Bacteria 1734
32 Ga0068866_11092840 3300005718 Bacteria 571
33 Ga0068861_100738196 3300005719 Bacteria 918
34 Ga0070717_10134164 3300006028 Bacteria 2131
35 Ga0075365_10001767 3300006038 Bacteria 10068
36 Ga0075368_10038209 3300006042 Bacteria 1879
37 Ga0075363_100028301 3300006048 Bacteria 2881
38 Ga0075363_100250015 3300006048 Bacteria 1021
39 Ga0075364_10002244 3300006051 Bacteria 10836
40 Ga0075367_10005411 3300006178 Bacteria 6336
41 Ga0075367_10139278 3300006178 Bacteria 1503
42 Ga0075369_10325892 3300006186 Bacteria 719
43 Ga0075370_10042535 3300006353 Bacteria 2567
44 Ga0105240_10032609 3300009093 Bacteria 6743
45 Ga0105240_10041747 3300009093 Bacteria 5850
46 Ga0105240_10184220 3300009093 Bacteria 2461
47 Ga0105240_11651838 3300009093 Bacteria 670
48 Ga0105247_10660524 3300009101 Bacteria 782
49 Ga0105243_10102251 3300009148 Bacteria 2381
50 Ga0105241_11114433 3300009174 Unclassified 744
51 Ga0105237_10026058 3300009545 Bacteria 5976
52 Ga0105237_10137922 3300009545 Bacteria 2433
53 Ga0105237_10162211 3300009545 Bacteria 2234
54 Ga0105238_10695003 3300009551 Bacteria 1029
55 Ga0105239_10003560 3300010375 Bacteria 19042
56 Ga0105239_10035038 3300010375 Bacteria 5512
57 Ga0105239_10067302 3300010375 Bacteria 3935
58 Ga0157371_10256752 3300013102 Bacteria 1259
59 Ga0157370_10049137 3300013104 Bacteria 4039
60 Ga0157369_10044040 3300013105 Bacteria 4861
61 Ga0157378_10560720 3300013297 Unclassified 1149
62 Ga0157372_10254868 3300013307 Bacteria 2037
63 Ga0157372_10475955 3300013307 Bacteria 1456
64 Ga0157372_10958864 3300013307 Bacteria 991
65 Ga0157375_10068365 3300013308 Bacteria 3554
66 Ga0182008_10010217 3300014497 Bacteria 5030
67 Ga0182008_10138895 3300014497 Bacteria 1215
68 Ga0182007_10190198 3300015262 Bacteria 713
69 Ga0206353_10755030 3300020082 Bacteria 2182
70 Ga0209148_1002895 3300025254 Bacteria 5246
71 Ga0209455_1000450 3300025272 Bacteria 31556
72 Ga0207647_10003622 3300025904 Bacteria 11566
73 Ga0207647_10037097 3300025904 Bacteria 3093
74 Ga0207685_10043055 3300025905 Bacteria 1699
75 Ga0207705_10168088 3300025909 Bacteria 1650
76 Ga0207654_10257315 3300025911 Bacteria 1172
77 Ga0207695_10001250 3300025913 Bacteria 43452
78 Ga0207695_10251888 3300025913 Bacteria 1665
79 Ga0207657_10044375 3300025919 Bacteria 3908
80 Ga0207657_10056111 3300025919 Bacteria 3400
81 Ga0207649_10049676 3300025920 Bacteria 2592
82 Ga0207652_10065255 3300025921 Bacteria 3152
83 Ga0207694_10549923 3300025924 Bacteria 969
84 Ga0207700_11242706 3300025928 Bacteria 664
85 Ga0207664_10193276 3300025929 Bacteria 1753
86 Ga0207690_10364515 3300025932 Bacteria 1145
87 Ga0207690_10633458 3300025932 Bacteria 875
88 Ga0207667_10038458 3300025949 Bacteria 5110
89 Ga0207703_10139610 3300026035 Bacteria 2102
90 Ga0207678_10091168 3300026067 Bacteria 2605
91 Ga0207702_10177504 3300026078 Bacteria 1958
92 Ga0268266_10120549 3300028379 Bacteria 2334
93 Ga0265337_1002092 3300028556 Bacteria 9435
94 Ga0265326_10013618 3300028558 Unclassified 2377
95 Ga0265334_10024445 3300028573 Bacteria 2449
96 Ga0265338_10000518 3300028800 Bacteria 68023
97 Ga0265338_10006104 3300028800 Bacteria 15467
98 Ga0265338_10033952 3300028800 Bacteria 4941
99 Ga0265338_10048497 3300028800 Bacteria 3863
100 Ga0265338_10239653 3300028800 Bacteria 1344
101 Ga0265338_10267333 3300028800 Bacteria 1254
102 Ga0265330_10009823 3300031235 Bacteria 4530
103 Ga0265330_10034185 3300031235 Bacteria 2271
104 Ga0265330_10064668 3300031235 Bacteria 1588
105 Ga0265330_10229797 3300031235 Bacteria 782
106 Ga0265332_10002154 3300031238 Bacteria 10151
107 Ga0265328_10009220 3300031239 Bacteria 4026
108 Ga0265328_10020341 3300031239 Bacteria 2540
109 Ga0265328_10056079 3300031239 Bacteria 1446
110 Ga0265328_10060708 3300031239 Bacteria 1388
111 Ga0265328_10141642 3300031239 Bacteria 902
112 Ga0265325_10012805 3300031241 Bacteria 4786
113 Ga0265325_10140272 3300031241 Bacteria 1150
114 Ga0265325_10347339 3300031241 Bacteria 656
115 Ga0265329_10005750 3300031242 Bacteria 4982
116 Ga0265340_10003886 3300031247 Bacteria 8418
117 Ga0265340_10005531 3300031247 Bacteria 7006
118 Ga0265340_10087453 3300031247 Bacteria 1460
119 Ga0265340_10112917 3300031247 Bacteria 1254
120 Ga0265339_10000937 3300031249 Bacteria 22398
121 Ga0265339_10054423 3300031249 Bacteria 2173
122 Ga0265339_10181831 3300031249 Bacteria 1046
123 Ga0265331_10000618 3300031250 Bacteria 30926
124 Ga0265331_10030564 3300031250 Bacteria 2681
125 Ga0265331_10063847 3300031250 Bacteria 1734
126 Ga0265327_10011548 3300031251 Bacteria 6065
127 Ga0265327_10200519 3300031251 Bacteria 904
128 Ga0265316_10017592 3300031344 Bacteria 6170
129 Ga0265316_10028024 3300031344 Bacteria 4651
130 Ga0265316_10077563 3300031344 Bacteria 2551
131 Ga0265316_10080325 3300031344 Bacteria 2501
132 Ga0265316_10200843 3300031344 Bacteria 1478
133 Ga0265316_10225929 3300031344 Bacteria 1380
134 Ga0265316_10255330 3300031344 Bacteria 1286
135 Ga0265316_10338871 3300031344 Bacteria 1090
136 Ga0265316_10421484 3300031344 Bacteria 959
137 Ga0265313_10003676 3300031595 Bacteria 12252
138 Ga0265313_10006724 3300031595 Bacteria 8042
139 Ga0265313_10119280 3300031595 Bacteria 1152
140 Ga0265314_10000160 3300031711 Bacteria 102289
141 Ga0265314_10245613 3300031711 Bacteria 1030
142 Ga0265314_10324321 3300031711 Bacteria 856
143 Ga0265314_10357146 3300031711 Bacteria 802
144 Ga0265342_10000270 3300031712 Bacteria 58343
145 Ga0265342_10001920 3300031712 Bacteria 18672
146 Ga0265342_10024336 3300031712 Bacteria 3823
147 Ga0265342_10035681 3300031712 Bacteria 3042
148 Ga0265342_10045438 3300031712 Bacteria 2643
149 Ga0265342_10116715 3300031712 Bacteria 1506
150 Ga0373923_0098841 3300035111 Bacteria 1285
151 Ga0373923_0276982 3300035111 Bacteria 790
152 Ga0373953_0152636 3300035117 Bacteria 991
153 Ga0373954_0156006 3300035118 Bacteria 1116
154 Ga0373956_0452323 3300035119 Bacteria 613
155 Ga0373955_0190762 3300035172 Bacteria 1218
156 Ga0316574_0053960 3300035398 Unclassified 2510
157 Ga0316584_0022570 3300036712 Bacteria 4593
158 Ga0451577_0000096 3300042876 Bacteria 195129
159 Ga0451577_0006681 3300042876 Bacteria 11446
160 Ga0451577_0010147 3300042876 Bacteria 9021
161 Ga0453683_0014405 3300044673 Bacteria 5134
162 Ga0453684_0002818 3300044712 Bacteria 41041
163 Ga0453684_0008965 3300044712 Bacteria 17678
164 Ga0453684_0030949 3300044712 Bacteria 7541
165 Ga0451576_0000823 3300045051 Bacteria 60545
166 Ga0451576_0024423 3300045051 Bacteria 6528
167 Ga0495629_0008296 3300046459 Bacteria 7635
168 Ga0495580_0003402 3300046472 Bacteria 13568
169 Ga0495630_0460099 3300046517 Bacteria 975
170 Ga0495652_0028930 3300046529 Bacteria 4870
171 Ga0495652_0190629 3300046529 Bacteria 1565
172 Ga0495622_0023601 3300046557 Bacteria 2869
173 Ga0495581_0074010 3300047315 Bacteria 1971
174 Ga0495604_0026208 3300047317 Bacteria 4642
175 Ga0495686_0005349 3300047472 Bacteria 10162
176 Ga0495602_0039650 3300048088 Bacteria 4334
177 Ga0495602_0349266 3300048088 Bacteria 1068
178 Ga0496102_0024596 3300048905 Bacteria 5355
179 Ga0496102_0124090 3300048905 Bacteria 2413
180 Ga0496103_0147520 3300048906 Bacteria 1506
181 Ga0496108_1076627 3300048911 Bacteria 684
182 Ga0496111_0206446 3300048914 Bacteria 1460
183 Ga0496112_0009360 3300048915 Bacteria 8821
184 Ga0496113_0184121 3300048916 Bacteria 1656
185 Ga0496115_0228728 3300048918 Bacteria 1534
186 Ga0496121_0482794 3300048924 Bacteria 791
187 Ga0496124_0377911 3300048927 Bacteria 992
188 Ga0496126_0013866 3300048929 Bacteria 8175
189 Ga0496126_0018496 3300048929 Bacteria 6900
190 Ga0495682_0218675 3300049460 Bacteria 675
191 Ga0501033_0003462 3300049570 Bacteria 12956
192 Ga0501034_0004182 3300049571 Bacteria 16107
193 Ga0501034_0105154 3300049571 Bacteria 2816
194 Ga0501036_0117315 3300049572 Bacteria 2248
195 Ga0501037_0020854 3300049573 Bacteria 4838
196 Ga0501038_0143041 3300049574 Bacteria 1955
197 Ga0501043_0037981 3300049579 Bacteria 3787
198 Ga0501043_0307106 3300049579 Bacteria 1211
199 Ga0501046_0131296 3300049580 Bacteria 1900
200 Ga0501047_0008083 3300049581 Bacteria 9926
201 Ga0501047_0667185 3300049581 Bacteria 858
202 Ga0501048_0140365 3300049582 Bacteria 1708
203 Ga0501070_0072883 3300049586 Bacteria 2842
204 Ga0501073_0011122 3300049589 Bacteria 6584
205 Ga0501073_0096036 3300049589 Bacteria 2058
206 Ga0501074_0347089 3300049590 Bacteria 1053
207 Ga0501080_0032999 3300049742 Bacteria 4830
208 Ga0501083_0222841 3300049744 Bacteria 1228
209 Ga0501083_0648385 3300049744 Bacteria 687
210 Ga0501035_0003269 3300049822 Bacteria 15535
211 Ga0501044_0007049 3300049823 Bacteria 12366
212 nmdc:mga03n38_26855_c1 3300050490 Bacteria 2382
213 nmdc:mga00v17_35136_c1 3300050491 Bacteria 2981
214 nmdc:mga0yw44_230722_c1 3300050492 Bacteria 1229
215 nmdc:mga06z11_107663_c1 3300050494 Bacteria 1539
216 nmdc:mga06z11_74700_c1 3300050494 Bacteria 1803
217 nmdc:mga07m45_129599_c1 3300050496 Bacteria 1459
218 nmdc:mga07m45_43576_c1 3300050496 Bacteria 2516
219 nmdc:mga0sz30_85051_c1 3300050516 Bacteria 1372
220 Ga0495612_0145062 3300053078 Bacteria 1031
221 Ga0495619_0121055 3300053085 Bacteria 1794
222 Ga0500643_029875 3300053087 Bacteria 1673
223 Ga0500593_136975 3300053117 Bacteria 969
224 Ga0500616_0015070 3300053153 Bacteria 4429
225 2513613794 2513237090 Bacteria 7096802
226 2588516724 2588253730 Bacteria 6881675
227 2588518044 2588253730 Bacteria 6881675
228 2643986531 2643221595 Bacteria 6565519
229 2644156406 2643221627 Bacteria 6761570
230 2694631724 2693429783 Bacteria 7019804
231 2694638034 2693429784 Bacteria 7241525
232 2776916205 2775507049 Bacteria 6284736
233 2828306596 2828305725 Bacteria 4916900
234 2871501040 2871495908 Bacteria 6935695
235 2876381952 2876377896 Bacteria 6565995
236 2878765063 2878760144 Bacteria 6823465
237 2878772226 2878767105 Bacteria 6898628
238 2885308154 2885305155 Bacteria 7348390
239 2885328901 2885326080 Bacteria 7134805
240 2885337550 2885334103 Bacteria 7216818
241 2889021260 2889016732 Bacteria 6700763
242 2903545855 2903540706 Bacteria 7062119
243 2937896230 2937891427 Bacteria 6357007
244 2937999706 2937994558 Bacteria 7036190
245 2938015467 2938014810 Bacteria 6700592
246 2958106337 2958100919 Bacteria 6800575
247 2958170176 2958165035 Bacteria 6906348
248 2958175849 2958172287 Bacteria 6716688
249 2961168628 2961163497 Bacteria 6901077
250 2965023448 2965018300 Bacteria 6883036
251 2965123370 2965119406 Bacteria 6956431
252 2968177039 2968171901 Bacteria 6894245
253 2970559910 2970554993 Bacteria 6814252
254 2977977129 2977971508 Bacteria 7472917
255 2977990866 2977986579 Bacteria 6581278
256 2979711318 2979710463 Bacteria 6785254
257 2979745210 2979742915 Bacteria 7301278
258 2987654589 2987652177 Bacteria 6969023
259 2987664656 2987659509 Bacteria 6966464
260 3004193708 3004188549 Bacteria 6952365
261 8002062410 8002060224 Bacteria 4026565
262 Ga0501082_0201931
263 JGI24740J21852_10013369
264 JGI24735J21928_10012018
265 Ga0055542_1007803
266 Ga0055529_1008211
267 Ga0070658_10019419
268 Ga0070658_10039459
269 Ga0070680_100064946
270 Ga0070660_100047750
271 Ga0070660_100061027
272 Ga0070661_100090403
273 Ga0070692_10568070
274 Ga0070659_100584680
275 Ga0070714_100012929
276 Ga0070713_101477451
277 Ga0070663_100260604
278 Ga0070679_100198222
279 Ga0068853_100035106
280 Ga0070695_100180879
281 Ga0070665_100253848
282 Ga0068855_100170368
283 Ga0068855_100256941
284 Ga0068855_100856993
285 Ga0068854_100128403
286 Ga0068854_100165636
287 Ga0068856_100037298
288 Ga0068856_100186758
289 Ga0068856_100304486
290 Ga0068856_101316709
291 Ga0068852_100047128
292 Ga0068852_100239096
293 Ga0068866_11092840
294 Ga0068861_100738196
295 Ga0070717_10134164
296 Ga0075365_10001767
297 Ga0075368_10038209
298 Ga0075363_100028301
299 Ga0075363_100250015
300 Ga0075364_10002244
301 Ga0075367_10005411
302 Ga0075367_10139278
303 Ga0075369_10325892
304 Ga0075370_10042535
305 Ga0105240_10032609
306 Ga0105240_10041747
307 Ga0105240_10184220
308 Ga0105240_11651838
309 Ga0105247_10660524
310 Ga0105243_10102251
311 Ga0105241_11114433
312 Ga0105237_10026058
313 Ga0105237_10137922
314 Ga0105237_10162211
315 Ga0105238_10695003
316 Ga0105239_10003560
317 Ga0105239_10035038
318 Ga0105239_10067302
319 Ga0157371_10256752
320 Ga0157370_10049137
321 Ga0157369_10044040
322 Ga0157378_10560720
323 Ga0157372_10254868
324 Ga0157372_10475955
325 Ga0157372_10958864
326 Ga0157375_10068365
327 Ga0182008_10010217
328 Ga0182008_10138895
329 Ga0182007_10190198
330 Ga0206353_10755030
331 Ga0209148_1002895
332 Ga0209455_1000450
333 Ga0207647_10003622
334 Ga0207647_10037097
335 Ga0207685_10043055
336 Ga0207705_10168088
337 Ga0207654_10257315
338 Ga0207695_10001250
339 Ga0207695_10251888
340 Ga0207657_10044375
341 Ga0207657_10056111
342 Ga0207649_10049676
343 Ga0207652_10065255
344 Ga0207694_10549923
345 Ga0207700_11242706
346 Ga0207664_10193276
347 Ga0207690_10364515
348 Ga0207690_10633458
349 Ga0207667_10038458
350 Ga0207703_10139610
351 Ga0207678_10091168
352 Ga0207702_10177504
353 Ga0268266_10120549
354 Ga0265337_1002092
355 Ga0265326_10013618
356 Ga0265334_10024445
357 Ga0265338_10000518
358 Ga0265338_10006104
359 Ga0265338_10033952
360 Ga0265338_10048497
361 Ga0265338_10239653
362 Ga0265338_10267333
363 Ga0265330_10009823
364 Ga0265330_10034185
365 Ga0265330_10064668
366 Ga0265330_10229797
367 Ga0265332_10002154
368 Ga0265328_10009220
369 Ga0265328_10020341
370 Ga0265328_10056079
371 Ga0265328_10060708
372 Ga0265328_10141642
373 Ga0265325_10012805
374 Ga0265325_10140272
375 Ga0265325_10347339
376 Ga0265329_10005750
377 Ga0265340_10003886
378 Ga0265340_10005531
379 Ga0265340_10087453
380 Ga0265340_10112917
381 Ga0265339_10000937
382 Ga0265339_10054423
383 Ga0265339_10181831
384 Ga0265331_10000618
385 Ga0265331_10030564
386 Ga0265331_10063847
387 Ga0265327_10011548
388 Ga0265327_10200519
389 Ga0265316_10017592
390 Ga0265316_10028024
391 Ga0265316_10077563
392 Ga0265316_10080325
393 Ga0265316_10200843
394 Ga0265316_10225929
395 Ga0265316_10255330
396 Ga0265316_10338871
397 Ga0265316_10421484
398 Ga0265313_10003676
399 Ga0265313_10006724
400 Ga0265313_10119280
401 Ga0265314_10000160
402 Ga0265314_10245613
403 Ga0265314_10324321
404 Ga0265314_10357146
405 Ga0265342_10000270
406 Ga0265342_10001920
407 Ga0265342_10024336
408 Ga0265342_10035681
409 Ga0265342_10045438
410 Ga0265342_10116715
411 Ga0373923_0098841
412 Ga0373923_0276982
413 Ga0373953_0152636
414 Ga0373954_0156006
415 Ga0373956_0452323
416 Ga0373955_0190762
417 Ga0316574_0053960
418 Ga0316584_0022570
419 Ga0451577_0000096
420 Ga0451577_0006681
421 Ga0451577_0010147
422 Ga0453683_0014405
423 Ga0453684_0002818
424 Ga0453684_0008965
425 Ga0453684_0030949
426 Ga0451576_0000823
427 Ga0451576_0024423
428 Ga0495629_0008296
429 Ga0495580_0003402
430 Ga0495630_0460099
431 Ga0495652_0028930
432 Ga0495652_0190629
433 Ga0495622_0023601
434 Ga0495581_0074010
435 Ga0495604_0026208
436 Ga0495686_0005349
437 Ga0495602_0039650
438 Ga0495602_0349266
439 Ga0496102_0024596
440 Ga0496102_0124090
441 Ga0496103_0147520
442 Ga0496108_1076627
443 Ga0496111_0206446
444 Ga0496112_0009360
445 Ga0496113_0184121
446 Ga0496115_0228728
447 Ga0496121_0482794
448 Ga0496124_0377911
449 Ga0496126_0013866
450 Ga0496126_0018496
451 Ga0495682_0218675
452 Ga0501033_0003462
453 Ga0501034_0004182
454 Ga0501034_0105154
455 Ga0501036_0117315
456 Ga0501037_0020854
457 Ga0501038_0143041
458 Ga0501043_0037981
459 Ga0501043_0307106
460 Ga0501046_0131296
461 Ga0501047_0008083
462 Ga0501047_0667185
463 Ga0501048_0140365
464 Ga0501070_0072883
465 Ga0501073_0011122
466 Ga0501073_0096036
467 Ga0501074_0347089
468 Ga0501080_0032999
469 Ga0501083_0222841
470 Ga0501083_0648385
471 Ga0501035_0003269
472 Ga0501044_0007049
473 nmdc:mga03n38_26855_c1
474 nmdc:mga00v17_35136_c1
475 nmdc:mga0yw44_230722_c1
476 nmdc:mga06z11_107663_c1
477 nmdc:mga06z11_74700_c1
478 nmdc:mga07m45_129599_c1
479 nmdc:mga07m45_43576_c1
480 nmdc:mga0sz30_85051_c1
481 Ga0495612_0145062
482 Ga0495619_0121055
483 Ga0500643_029875
484 Ga0500593_136975
485 Ga0500616_0015070
486 2513613794
487 2588516724
488 2588518044
489 2643986531
490 2644156406
491 2694631724
492 2694638034
493 2776916205
494 2828306596
495 2871501040
496 2876381952
497 2878765063
498 2878772226
499 2885308154
500 2885328901
501 2885337550
502 2889021260
503 2903545855
504 2937896230
505 2937999706
506 2938015467
507 2958106337
508 2958170176
509 2958175849
510 2961168628
511 2965023448
512 2965123370
513 2968177039
514 2970559910
515 2977977129
516 2977990866
517 2979711318
518 2979745210
519 2987654589
520 2987664656
521 3004193708
522 8002062410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

13

164

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9747 2 171
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9316 2 171
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.9261 2 173
4hx6-assembly1.cif.gz_B streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.8981 16 155
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.8972 2 173
ID Description Score Start End Superfamily
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9735 2 171 2.30.110.10
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.948 2 172 2.30.110.10
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9453 2 171 2.30.110.10
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.912 2 172 2.30.110.10
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9095 16 145 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7Y9W4J7-F1-model_v4 Flavin reductase (DIM6/NTAB) family NADH-FMN oxidoreductase RutF 0.9958 2 177 GO:0010181
GO:0016646
AF-A0A258SKZ0-F1-model_v4 Flavin reductase 0.995 2 145 GO:0010181
GO:0016646
AF-A0A2N9NJP8-F1-model_v4 Flavin reductase domain protein FMN-binding (Modular protein) 0.9931 1 177 GO:0010181
GO:0016646
AF-A0A2S6GGC4-F1-model_v4 Flavin reductase (DIM6/NTAB) family NADH-FMN oxidoreductase RutF 0.9925 1 177 GO:0010181
GO:0016646
AF-K2DLI3-F1-model_v4 Flavin reductase protein 0.9925 2 157 GO:0010181
GO:0016646

Map