F370574

General Info

Members Datasets Scaffolds Average Seq Length
261 177 522 263

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0000736|Ga0495662_0000736_6498_7358
Length 286
Sequence VTDAAVATAATPELRQVPAYTVDELAPRRARHCVAIFVINENGRLLAQLDKMKPLAGQVDVLLADGGSTDGSTERTRLAEKGVRVLLTKTGPGRLSAQMRMAFDYALRAGYEGIITMDGNDKDDPAAIPRFVTALDEGCDHVQGSRFVAGGEAVNTPWSRLLGIKLLHAPLISAAARRRYTDTTNGFRAYSRRLLEDPRVAPFRDVFSRYELHYYLAIRSARLGYRVTEVPVRRAYPSEGKTPTKISPLRGNLLVLATLAKACLHRFDPGDVRVGEGARTVDTPSR

Samples

Sample ID Description Type Environment
1 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
176 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
177 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.77
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 0
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495662_0000736 3300046476 Bacteria 15663
2 Ga0070658_10171418 3300005327 Bacteria 1823
3 Ga0070683_100000061 3300005329 Bacteria 80712
4 Ga0070683_100000597 3300005329 Bacteria 25917
5 Ga0070683_100017675 3300005329 Bacteria 6301
6 Ga0070683_100040920 3300005329 Bacteria 4262
7 Ga0070683_100247823 3300005329 Bacteria 1694
8 Ga0070683_100447163 3300005329 Bacteria 1233
9 Ga0070670_100000205 3300005331 Bacteria 54998
10 Ga0070670_100094600 3300005331 Bacteria 2570
11 Ga0068869_100062580 3300005334 Bacteria 2732
12 Ga0070666_10049992 3300005335 Unclassified 2811
13 Ga0070680_100001446 3300005336 Bacteria 17204
14 Ga0070680_100016434 3300005336 Bacteria 5824
15 Ga0070680_100041708 3300005336 Bacteria 3721
16 Ga0068868_100000179 3300005338 Bacteria 42162
17 Ga0070687_100038216 3300005343 Unclassified 2405
18 Ga0070661_100316371 3300005344 Unclassified 1218
19 Ga0070661_100479539 3300005344 Unclassified 993
20 Ga0070668_100017322 3300005347 Bacteria 5395
21 Ga0070669_100339492 3300005353 Bacteria 1217
22 Ga0070675_100087407 3300005354 Bacteria 2607
23 Ga0070674_100176456 3300005356 Bacteria 1633
24 Ga0070673_100063696 3300005364 Unclassified 2934
25 Ga0070688_100014656 3300005365 Unclassified 4445
26 Ga0070659_100262261 3300005366 Bacteria 1434
27 Ga0070667_100224189 3300005367 Bacteria 1674
28 Ga0070713_100166889 3300005436 Bacteria 1969
29 Ga0070713_100293079 3300005436 Bacteria 1496
30 Ga0070705_100279454 3300005440 Bacteria 1186
31 Ga0070708_100000019 3300005445 Bacteria 118191
32 Ga0070678_100534033 3300005456 Bacteria 1039
33 Ga0070681_10000977 3300005458 Bacteria 24176
34 Ga0070681_10048726 3300005458 Bacteria 4233
35 Ga0070681_10218268 3300005458 Unclassified 1823
36 Ga0070681_10479374 3300005458 Bacteria 1157
37 Ga0068867_100152956 3300005459 Bacteria 1814
38 Ga0070685_10173832 3300005466 Bacteria 1382
39 Ga0070698_100393794 3300005471 Bacteria 1318
40 Ga0070679_100000497 3300005530 Bacteria 33512
41 Ga0070679_100001063 3300005530 Bacteria 23971
42 Ga0070679_100262533 3300005530 Bacteria 1682
43 Ga0070684_100001160 3300005535 Bacteria 18916
44 Ga0070684_100012014 3300005535 Bacteria 6920
45 Ga0070684_100024440 3300005535 Bacteria 5070
46 Ga0070684_100026937 3300005535 Bacteria 4846
47 Ga0070684_100095417 3300005535 Bacteria 2650
48 Ga0070665_100013664 3300005548 Bacteria 8168
49 Ga0068855_100030775 3300005563 Bacteria 6417
50 Ga0068855_100087454 3300005563 Bacteria 3602
51 Ga0068855_100121430 3300005563 Unclassified 2990
52 Ga0068857_100072117 3300005577 Unclassified 3078
53 Ga0068857_100272148 3300005577 Bacteria 1557
54 Ga0068857_100342181 3300005577 Bacteria 1384
55 Ga0068854_100001312 3300005578 Bacteria 14997
56 Ga0068856_100012714 3300005614 Bacteria 8152
57 Ga0068856_100105454 3300005614 Unclassified 2813
58 Ga0068852_100039693 3300005616 Bacteria 3965
59 Ga0068859_100073129 3300005617 Bacteria 3466
60 Ga0068859_100154508 3300005617 Bacteria 2371
61 Ga0068864_100044031 3300005618 Unclassified 3824
62 Ga0068864_100173725 3300005618 Bacteria 1966
63 Ga0068861_100033008 3300005719 Bacteria 3816
64 Ga0068863_100069983 3300005841 Bacteria 3318
65 Ga0081538_10000281 3300005981 Bacteria 58298
66 Ga0070716_100147418 3300006173 Bacteria 1509
67 Ga0075428_100018488 3300006844 Bacteria 7706
68 Ga0075430_100143669 3300006846 Bacteria 1987
69 Ga0075431_100139558 3300006847 Unclassified 2499
70 Ga0075434_100098813 3300006871 Unclassified 2924
71 Ga0075434_100465089 3300006871 Bacteria 1286
72 Ga0097620_100073127 3300006931 Bacteria 3466
73 Ga0097620_100154507 3300006931 Bacteria 2371
74 Ga0075435_100365653 3300007076 Bacteria 1238
75 Ga0099794_10002457 3300007265 Bacteria 6835
76 Ga0105244_10035591 3300009036 Bacteria 2615
77 Ga0105240_10001729 3300009093 Bacteria 36849
78 Ga0105245_10862631 3300009098 Bacteria 946
79 Ga0114129_10001197 3300009147 Bacteria 34466
80 Ga0105243_10234000 3300009148 Bacteria 1631
81 Ga0105243_10438827 3300009148 Bacteria 1222
82 Ga0105242_10077448 3300009176 Bacteria 2774
83 Ga0105248_10110679 3300009177 Unclassified 3097
84 Ga0105237_10255725 3300009545 Bacteria 1754
85 Ga0105238_10048679 3300009551 Bacteria 4271
86 Ga0105238_10102178 3300009551 Bacteria 2849
87 Ga0105238_10229079 3300009551 Bacteria 1835
88 Ga0105238_10335257 3300009551 Bacteria 1500
89 Ga0105239_10030235 3300010375 Bacteria 5954
90 Ga0105239_10222543 3300010375 Bacteria 2117
91 Ga0105246_10080960 3300011119 Bacteria 2313
92 Ga0157373_10054298 3300013100 Bacteria 2847
93 Ga0157370_10057679 3300013104 Bacteria 3691
94 Ga0157369_10000317 3300013105 Bacteria 64962
95 Ga0157369_10061590 3300013105 Bacteria 4044
96 Ga0157369_10410600 3300013105 Bacteria 1404
97 Ga0157369_10541840 3300013105 Unclassified 1203
98 Ga0163162_10137828 3300013306 Bacteria 2551
99 Ga0157372_10008126 3300013307 Bacteria 11157
100 Ga0157372_10275574 3300013307 Bacteria 1955
101 Ga0157375_10004835 3300013308 Bacteria 11704
102 Ga0157375_10010302 3300013308 Bacteria 8228
103 Ga0157375_10185886 3300013308 Archaea 2231
104 Ga0157375_10308630 3300013308 Bacteria 1746
105 Ga0163163_10005512 3300014325 Bacteria 10955
106 Ga0163163_10158948 3300014325 Bacteria 2305
107 Ga0157377_10161446 3300014745 Bacteria 1394
108 Ga0157376_10000002 3300014969 Bacteria 684532
109 Ga0157376_10249602 3300014969 Bacteria 1657
110 Ga0163161_10193554 3300017792 Bacteria 1564
111 Ga0207655_1078947 3300025728 Bacteria 1194
112 Ga0207699_10020417 3300025906 Unclassified 3551
113 Ga0207707_10065120 3300025912 Bacteria 3174
114 Ga0207695_10014588 3300025913 Bacteria 9294
115 Ga0207695_10126192 3300025913 Unclassified 2521
116 Ga0207660_10009780 3300025917 Bacteria 6208
117 Ga0207660_10035877 3300025917 Bacteria 3445
118 Ga0207660_10082504 3300025917 Bacteria 2365
119 Ga0207662_10003004 3300025918 Bacteria 8590
120 Ga0207649_10616530 3300025920 Bacteria 836
121 Ga0207652_10004839 3300025921 Bacteria 10909
122 Ga0207646_10039161 3300025922 Bacteria 4266
123 Ga0207694_10010922 3300025924 Bacteria 6860
124 Ga0207650_10000251 3300025925 Bacteria 58147
125 Ga0207650_10225717 3300025925 Bacteria 1509
126 Ga0207659_10101314 3300025926 Bacteria 2172
127 Ga0207659_10461427 3300025926 Unclassified 1071
128 Ga0207700_10411233 3300025928 Bacteria 1187
129 Ga0207700_10590080 3300025928 Bacteria 988
130 Ga0207690_10148209 3300025932 Bacteria 1737
131 Ga0207686_10116955 3300025934 Bacteria 1808
132 Ga0207686_10161811 3300025934 Bacteria 1569
133 Ga0207709_10176444 3300025935 Bacteria 1505
134 Ga0207669_10182130 3300025937 Bacteria 1507
135 Ga0207691_10124699 3300025940 Bacteria 2280
136 Ga0207691_10323684 3300025940 Bacteria 1321
137 Ga0207711_10217402 3300025941 Bacteria 1747
138 Ga0207689_10068127 3300025942 Unclassified 2925
139 Ga0207661_10000002 3300025944 Bacteria 816104
140 Ga0207661_10067741 3300025944 Bacteria 2904
141 Ga0207661_10153453 3300025944 Bacteria 1993
142 Ga0207661_10162610 3300025944 Bacteria 1938
143 Ga0207661_10184382 3300025944 Unclassified 1826
144 Ga0207661_10195559 3300025944 Bacteria 1775
145 Ga0207661_10544887 3300025944 Bacteria 1063
146 Ga0207679_10408903 3300025945 Bacteria 1195
147 Ga0207667_10217922 3300025949 Unclassified 1956
148 Ga0207651_10024882 3300025960 Unclassified 3712
149 Ga0207712_10069894 3300025961 Unclassified 2521
150 Ga0207668_10149671 3300025972 Bacteria 1805
151 Ga0207640_10001534 3300025981 Bacteria 12459
152 Ga0207658_10083638 3300025986 Bacteria 2454
153 Ga0207677_10000243 3300026023 Bacteria 42167
154 Ga0207677_10210292 3300026023 Bacteria 1553
155 Ga0207702_10025649 3300026078 Bacteria 4893
156 Ga0207702_10414177 3300026078 Bacteria 1302
157 Ga0207648_10240681 3300026089 Bacteria 1611
158 Ga0207676_10095962 3300026095 Bacteria 2447
159 Ga0207676_10451970 3300026095 Bacteria 1211
160 Ga0207674_10037438 3300026116 Bacteria 5046
161 Ga0207674_10128547 3300026116 Unclassified 2498
162 Ga0207675_100050053 3300026118 Bacteria 3899
163 Ga0207698_10111192 3300026142 Bacteria 2296
164 Ga0268266_10117906 3300028379 Bacteria 2359
165 Ga0265331_10014111 3300031250 Bacteria 4268
166 Ga0265327_10002561 3300031251 Bacteria 18853
167 Ga0307513_10478802 3300031456 Bacteria 965
168 Ga0307416_100133009 3300032002 Unclassified 2244
169 Ga0307415_100483837 3300032126 Bacteria 1078
170 Ga0373953_0033248 3300035117 Unclassified 2016
171 Ga0373953_0109529 3300035117 Unclassified 1167
172 Ga0373943_0152840 3300035170 Bacteria 1251
173 Ga0373955_0003873 3300035172 Bacteria 6598
174 Ga0373955_0093088 3300035172 Bacteria 1720
175 Ga0373924_0136100 3300035410 Bacteria 1070
176 Ga0373927_0005159 3300035695 Bacteria 9034
177 Ga0373933_0029747 3300035724 Bacteria 3160
178 Ga0373933_0307722 3300035724 Bacteria 1026
179 Ga0373937_0005581 3300036401 Bacteria 10797
180 Ga0373925_0015750 3300037068 Bacteria 5472
181 Ga0373925_0414491 3300037068 Bacteria 1100
182 Ga0466972_0008640 3300044658 Bacteria 5109
183 Ga0495592_0088266 3300046454 Bacteria 2229
184 Ga0495629_0164436 3300046459 Bacteria 1541
185 Ga0495638_0044518 3300046460 Bacteria 2795
186 Ga0495651_0033392 3300046462 Bacteria 4014
187 Ga0495653_0018903 3300046463 Bacteria 5591
188 Ga0495580_0016192 3300046472 Bacteria 5603
189 Ga0495580_0025114 3300046472 Bacteria 4354
190 Ga0495580_0184991 3300046472 Unclassified 1438
191 Ga0495582_0092985 3300046473 Bacteria 1683
192 Ga0495582_0151211 3300046473 Bacteria 1318
193 Ga0495662_0125701 3300046476 Bacteria 1260
194 Ga0495664_0046745 3300046477 Bacteria 2568
195 Ga0495594_0064454 3300046499 Bacteria 2031
196 Ga0495608_0041686 3300046511 Bacteria 3071
197 Ga0495610_0000087 3300046512 Bacteria 108198
198 Ga0495618_0163138 3300046514 Bacteria 1420
199 Ga0495618_0196427 3300046514 Unclassified 1278
200 Ga0495620_0003056 3300046515 Bacteria 9614
201 Ga0495628_0011785 3300046516 Bacteria 7381
202 Ga0495630_0000009 3300046517 Bacteria 305799
203 Ga0495630_0299651 3300046517 Unclassified 1228
204 Ga0495666_0094851 3300046526 Bacteria 1407
205 Ga0495666_0102493 3300046526 Bacteria 1348
206 Ga0495665_0011171 3300046531 Bacteria 4861
207 Ga0495665_0142175 3300046531 Bacteria 1254
208 Ga0495640_0115369 3300046533 Bacteria 1750
209 Ga0495586_0070218 3300046535 Bacteria 1912
210 Ga0495586_0083684 3300046535 Bacteria 1756
211 Ga0495587_0000739 3300046536 Bacteria 21873
212 Ga0495587_0007661 3300046536 Bacteria 6985
213 Ga0495645_0000365 3300046543 Bacteria 31442
214 Ga0495645_0050451 3300046543 Bacteria 3030
215 Ga0495667_0008143 3300046559 Bacteria 7114
216 Ga0495667_0018092 3300046559 Unclassified 4760
217 Ga0495634_0140024 3300046642 Bacteria 1536
218 Ga0495625_0267277 3300046660 Bacteria 1105
219 Ga0495635_0035163 3300046663 Bacteria 3474
220 Ga0495588_0096992 3300046674 Bacteria 1547
221 Ga0495657_0043624 3300046675 Bacteria 3057
222 Ga0495599_0013792 3300046678 Bacteria 5000
223 Ga0495599_0052711 3300046678 Bacteria 2548
224 Ga0495646_0133668 3300046680 Bacteria 1394
225 Ga0495669_0000004 3300046684 Bacteria 208878
226 Ga0495600_0050331 3300046809 Unclassified 2718
227 Ga0495581_0146662 3300047315 Bacteria 1377
228 Ga0495674_0025001 3300047319 Bacteria 5481
229 Ga0495672_0005941 3300047320 Bacteria 9566
230 Ga0495675_0022642 3300047444 Bacteria 4006
231 Ga0495684_0031599 3300047471 Bacteria 4065
232 Ga0495684_0056734 3300047471 Bacteria 2985
233 Ga0495684_0124632 3300047471 Bacteria 1938
234 Ga0495684_0414084 3300047471 Bacteria 943
235 Ga0495686_0000903 3300047472 Bacteria 37367
236 Ga0495686_0275246 3300047472 Bacteria 937
237 Ga0495593_0047297 3300047673 Bacteria 2289
238 Ga0495602_0070582 3300048088 Bacteria 2988
239 Ga0496117_0000084 3300048920 Bacteria 214308
240 Ga0501033_0126822 3300049570 Bacteria 1850
241 Ga0501034_0522822 3300049571 Bacteria 1098
242 Ga0501043_0312962 3300049579 Bacteria 1198
243 Ga0501070_0129153 3300049586 Bacteria 2088
244 Ga0501070_0598090 3300049586 Bacteria 879
245 Ga0501073_0074818 3300049589 Bacteria 2358
246 Ga0501073_0092189 3300049589 Bacteria 2106
247 Ga0501035_0549778 3300049822 Bacteria 946
248 nmdc:mga0yw44_121425_c1 3300050492 Bacteria 915
249 nmdc:mga05p37_10672_c1 3300050507 Bacteria 10901
250 nmdc:mga06r32_51002_c1 3300050510 Bacteria 3959
251 nmdc:mga0n895_160005_c1 3300050512 Unclassified 2283
252 nmdc:mga0rr50_139736_c1 3300050513 Bacteria 1947
253 nmdc:mga0rr50_361181_c1 3300050513 Bacteria 1222
254 nmdc:mga0a205_305678_c1 3300050515 Bacteria 1463
255 Ga0495595_0032172 3300053084 Bacteria 2361
256 Ga0495619_0085495 3300053085 Unclassified 2130
257 Ga0500645_003174 3300053730 Bacteria 6832
258 Ga0501082_0230177 3300060353 Bacteria 1613
259 2990268390 2990265787 Bacteria 3943888
260 2993696578 2993693658 Bacteria 4040749
261 8018153913 8018150411 Bacteria 5549903
262 Ga0495662_0000736
263 Ga0070658_10171418
264 Ga0070683_100000061
265 Ga0070683_100000597
266 Ga0070683_100017675
267 Ga0070683_100040920
268 Ga0070683_100247823
269 Ga0070683_100447163
270 Ga0070670_100000205
271 Ga0070670_100094600
272 Ga0068869_100062580
273 Ga0070666_10049992
274 Ga0070680_100001446
275 Ga0070680_100016434
276 Ga0070680_100041708
277 Ga0068868_100000179
278 Ga0070687_100038216
279 Ga0070661_100316371
280 Ga0070661_100479539
281 Ga0070668_100017322
282 Ga0070669_100339492
283 Ga0070675_100087407
284 Ga0070674_100176456
285 Ga0070673_100063696
286 Ga0070688_100014656
287 Ga0070659_100262261
288 Ga0070667_100224189
289 Ga0070713_100166889
290 Ga0070713_100293079
291 Ga0070705_100279454
292 Ga0070708_100000019
293 Ga0070678_100534033
294 Ga0070681_10000977
295 Ga0070681_10048726
296 Ga0070681_10218268
297 Ga0070681_10479374
298 Ga0068867_100152956
299 Ga0070685_10173832
300 Ga0070698_100393794
301 Ga0070679_100000497
302 Ga0070679_100001063
303 Ga0070679_100262533
304 Ga0070684_100001160
305 Ga0070684_100012014
306 Ga0070684_100024440
307 Ga0070684_100026937
308 Ga0070684_100095417
309 Ga0070665_100013664
310 Ga0068855_100030775
311 Ga0068855_100087454
312 Ga0068855_100121430
313 Ga0068857_100072117
314 Ga0068857_100272148
315 Ga0068857_100342181
316 Ga0068854_100001312
317 Ga0068856_100012714
318 Ga0068856_100105454
319 Ga0068852_100039693
320 Ga0068859_100073129
321 Ga0068859_100154508
322 Ga0068864_100044031
323 Ga0068864_100173725
324 Ga0068861_100033008
325 Ga0068863_100069983
326 Ga0081538_10000281
327 Ga0070716_100147418
328 Ga0075428_100018488
329 Ga0075430_100143669
330 Ga0075431_100139558
331 Ga0075434_100098813
332 Ga0075434_100465089
333 Ga0097620_100073127
334 Ga0097620_100154507
335 Ga0075435_100365653
336 Ga0099794_10002457
337 Ga0105244_10035591
338 Ga0105240_10001729
339 Ga0105245_10862631
340 Ga0114129_10001197
341 Ga0105243_10234000
342 Ga0105243_10438827
343 Ga0105242_10077448
344 Ga0105248_10110679
345 Ga0105237_10255725
346 Ga0105238_10048679
347 Ga0105238_10102178
348 Ga0105238_10229079
349 Ga0105238_10335257
350 Ga0105239_10030235
351 Ga0105239_10222543
352 Ga0105246_10080960
353 Ga0157373_10054298
354 Ga0157370_10057679
355 Ga0157369_10000317
356 Ga0157369_10061590
357 Ga0157369_10410600
358 Ga0157369_10541840
359 Ga0163162_10137828
360 Ga0157372_10008126
361 Ga0157372_10275574
362 Ga0157375_10004835
363 Ga0157375_10010302
364 Ga0157375_10185886
365 Ga0157375_10308630
366 Ga0163163_10005512
367 Ga0163163_10158948
368 Ga0157377_10161446
369 Ga0157376_10000002
370 Ga0157376_10249602
371 Ga0163161_10193554
372 Ga0207655_1078947
373 Ga0207699_10020417
374 Ga0207707_10065120
375 Ga0207695_10014588
376 Ga0207695_10126192
377 Ga0207660_10009780
378 Ga0207660_10035877
379 Ga0207660_10082504
380 Ga0207662_10003004
381 Ga0207649_10616530
382 Ga0207652_10004839
383 Ga0207646_10039161
384 Ga0207694_10010922
385 Ga0207650_10000251
386 Ga0207650_10225717
387 Ga0207659_10101314
388 Ga0207659_10461427
389 Ga0207700_10411233
390 Ga0207700_10590080
391 Ga0207690_10148209
392 Ga0207686_10116955
393 Ga0207686_10161811
394 Ga0207709_10176444
395 Ga0207669_10182130
396 Ga0207691_10124699
397 Ga0207691_10323684
398 Ga0207711_10217402
399 Ga0207689_10068127
400 Ga0207661_10000002
401 Ga0207661_10067741
402 Ga0207661_10153453
403 Ga0207661_10162610
404 Ga0207661_10184382
405 Ga0207661_10195559
406 Ga0207661_10544887
407 Ga0207679_10408903
408 Ga0207667_10217922
409 Ga0207651_10024882
410 Ga0207712_10069894
411 Ga0207668_10149671
412 Ga0207640_10001534
413 Ga0207658_10083638
414 Ga0207677_10000243
415 Ga0207677_10210292
416 Ga0207702_10025649
417 Ga0207702_10414177
418 Ga0207648_10240681
419 Ga0207676_10095962
420 Ga0207676_10451970
421 Ga0207674_10037438
422 Ga0207674_10128547
423 Ga0207675_100050053
424 Ga0207698_10111192
425 Ga0268266_10117906
426 Ga0265331_10014111
427 Ga0265327_10002561
428 Ga0307513_10478802
429 Ga0307416_100133009
430 Ga0307415_100483837
431 Ga0373953_0033248
432 Ga0373953_0109529
433 Ga0373943_0152840
434 Ga0373955_0003873
435 Ga0373955_0093088
436 Ga0373924_0136100
437 Ga0373927_0005159
438 Ga0373933_0029747
439 Ga0373933_0307722
440 Ga0373937_0005581
441 Ga0373925_0015750
442 Ga0373925_0414491
443 Ga0466972_0008640
444 Ga0495592_0088266
445 Ga0495629_0164436
446 Ga0495638_0044518
447 Ga0495651_0033392
448 Ga0495653_0018903
449 Ga0495580_0016192
450 Ga0495580_0025114
451 Ga0495580_0184991
452 Ga0495582_0092985
453 Ga0495582_0151211
454 Ga0495662_0125701
455 Ga0495664_0046745
456 Ga0495594_0064454
457 Ga0495608_0041686
458 Ga0495610_0000087
459 Ga0495618_0163138
460 Ga0495618_0196427
461 Ga0495620_0003056
462 Ga0495628_0011785
463 Ga0495630_0000009
464 Ga0495630_0299651
465 Ga0495666_0094851
466 Ga0495666_0102493
467 Ga0495665_0011171
468 Ga0495665_0142175
469 Ga0495640_0115369
470 Ga0495586_0070218
471 Ga0495586_0083684
472 Ga0495587_0000739
473 Ga0495587_0007661
474 Ga0495645_0000365
475 Ga0495645_0050451
476 Ga0495667_0008143
477 Ga0495667_0018092
478 Ga0495634_0140024
479 Ga0495625_0267277
480 Ga0495635_0035163
481 Ga0495588_0096992
482 Ga0495657_0043624
483 Ga0495599_0013792
484 Ga0495599_0052711
485 Ga0495646_0133668
486 Ga0495669_0000004
487 Ga0495600_0050331
488 Ga0495581_0146662
489 Ga0495674_0025001
490 Ga0495672_0005941
491 Ga0495675_0022642
492 Ga0495684_0031599
493 Ga0495684_0056734
494 Ga0495684_0124632
495 Ga0495684_0414084
496 Ga0495686_0000903
497 Ga0495686_0275246
498 Ga0495593_0047297
499 Ga0495602_0070582
500 Ga0496117_0000084
501 Ga0501033_0126822
502 Ga0501034_0522822
503 Ga0501043_0312962
504 Ga0501070_0129153
505 Ga0501070_0598090
506 Ga0501073_0074818
507 Ga0501073_0092189
508 Ga0501035_0549778
509 nmdc:mga0yw44_121425_c1
510 nmdc:mga05p37_10672_c1
511 nmdc:mga06r32_51002_c1
512 nmdc:mga0n895_160005_c1
513 nmdc:mga0rr50_139736_c1
514 nmdc:mga0rr50_361181_c1
515 nmdc:mga0a205_305678_c1
516 Ga0495595_0032172
517 Ga0495619_0085495
518 Ga0500645_003174
519 Ga0501082_0230177
520 2990268390
521 2993696578
522 8018153913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

33

198

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pvl-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 - apo form 0.7766 31 265
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7708 29 265
7pho-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.7465 31 265
4dec-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and phosphoglyceric acid (pga) 0.7417 31 268
5jt0-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate (udp) and glucosyl-3-phosphoglycerate (gpg) - gpgs*gpg*udp*mn2+ 0.7405 31 265
ID Description Score Start End Superfamily
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8322 30 261 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8289 29 265 3.90.550.10
af_O06376_3_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8161 26 256 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8145 30 263 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7914 30 263 3.90.550.10
ID Description Score Start End GO Terms
AF-U4V5M1-F1-model_v4 Uncharacterized protein 0.9949 100 268
AF-K1SUL5-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9923 130 268 GO:0016757
AF-A0A653J500-F1-model_v4 Glycosyl transferase family 2 0.9897 33 268 GO:0005886
GO:0016757
AF-U4V5M1-F1-model_v4 Uncharacterized protein 0.989 100 268
AF-A0A2A7MN86-F1-model_v4 Glycosyltransferase family 2 protein 0.9852 8 268 GO:0016757

Map